Psyllid ID: psy15143

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MFFELSKLIKEKKKKKKKKKKKKKKKKKKKKKKKNLIKEKKKKKKKKKTKKKSKRRRRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAVIC
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHHHHHcccccccHHcHHHcccccc
cccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEHHcHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHcccccHHHHHcHHcccccc
MFFELSKLIKEKKKKKKKKKKKKKKKKKKKKKKKNLIKEKKKKKKKKKtkkkskrrrrknytktnichgeqtlltSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNkegirwrhiefsdntlclqlvegkpngllcvlddqakavic
mffelsklikekkkkkkkkkkkkkkkkkkkkkkknlikekkkkkkkkktkkkskrrrrknytktnichgeqtlLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDdqakavic
MFFELsklikekkkkkkkkkkkkkkkkkkkkkkknlikekkkkkkkkktkkkskrrrrknytkTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAVIC
*************************************************************TKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQA*****
*FFE*S********************************************************KTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAV**
MFFELSKLIKE************************************************NYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAVIC
MFFELSKLIKEKKKKKKKKKKKKKKKKKKKKKKKNLIKEKKKKKKKKKTKKKSKRRRRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAVIC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQAKAVIC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q13459 2157 Unconventional myosin-IXb yes N/A 0.449 0.031 0.597 1e-21
Q9Z1N3 2626 Unconventional myosin-IXa yes N/A 0.449 0.025 0.597 3e-21
Q8C170 2542 Unconventional myosin-IXa no N/A 0.449 0.026 0.597 3e-21
B2RTY4 2548 Unconventional myosin-IXa no N/A 0.449 0.026 0.597 4e-21
Q9QZZ4 3511 Unconventional myosin-XV no N/A 0.442 0.018 0.636 9e-20
Q9UKN7 3530 Unconventional myosin-XV no N/A 0.442 0.018 0.636 1e-19
Q9QY06 2114 Unconventional myosin-IXb yes N/A 0.449 0.031 0.582 2e-18
Q13402 2215 Unconventional myosin-VII no N/A 0.456 0.030 0.544 3e-18
P97479 2215 Unconventional myosin-VII no N/A 0.483 0.032 0.513 5e-18
Q63358 1980 Unconventional myosin-IXb no N/A 0.449 0.033 0.582 7e-18
>sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 51/67 (76%)

Query: 78  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 137
           SFEQ CINYANE LQYYFNQH+F+ EQEEY  EGI W +I ++DN  C+ L+  KP GL 
Sbjct: 531 SFEQFCINYANEQLQYYFNQHIFKLEQEEYQGEGITWHNIGYTDNVGCIHLISKKPTGLF 590

Query: 138 CVLDDQA 144
            +LD+++
Sbjct: 591 YLLDEES 597
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. May be involved in the remodeling of the actin cytoskeleton. Binds actin with high affinity both in the absence and presence of ATP and its mechanochemical activity is inhibited by calcium ions. Also acts as a GTPase activating protein on Rho.
Homo sapiens (taxid: 9606)
>sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 Back     alignment and function description
>sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 Back     alignment and function description
>sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 Back     alignment and function description
>sp|Q9QZZ4|MYO15_MOUSE Unconventional myosin-XV OS=Mus musculus GN=Myo15a PE=1 SV=2 Back     alignment and function description
>sp|Q9UKN7|MYO15_HUMAN Unconventional myosin-XV OS=Homo sapiens GN=MYO15A PE=1 SV=2 Back     alignment and function description
>sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 Back     alignment and function description
>sp|Q13402|MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens GN=MYO7A PE=1 SV=2 Back     alignment and function description
>sp|P97479|MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus GN=Myo7a PE=1 SV=2 Back     alignment and function description
>sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
328701267 1776 PREDICTED: myosin-IXb isoform 4 [Acyrtho 0.637 0.053 0.663 1e-30
328701269 1847 PREDICTED: myosin-IXb isoform 1 [Acyrtho 0.637 0.051 0.663 1e-30
328701263 1931 PREDICTED: myosin-IXb isoform 2 [Acyrtho 0.637 0.049 0.663 1e-30
328701265 1863 PREDICTED: myosin-IXb isoform 3 [Acyrtho 0.637 0.050 0.663 1e-30
270002356 2021 hypothetical protein TcasGA2_TC001372 [T 0.637 0.047 0.652 2e-30
189234985 1843 PREDICTED: similar to myosin-rhogap prot 0.637 0.051 0.652 2e-30
242011074 783 myosin IIIB, putative [Pediculus humanus 0.637 0.121 0.642 2e-28
322797024 2118 hypothetical protein SINV_09798 [Solenop 0.637 0.044 0.621 9e-28
383855596 2288 PREDICTED: unconventional myosin-IXa-lik 0.637 0.041 0.610 2e-27
332022806 2287 Myosin-IXa [Acromyrmex echinatior] 0.637 0.041 0.610 2e-27
>gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 71/95 (74%)

Query: 49  TKKKSKRRRRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYN 108
           +KK + R  + N        G +   TS SFEQ CINYANEHLQYYFNQHVF+YEQEEY 
Sbjct: 416 SKKDTLRDHQGNSIGVLDIFGFEDFGTSNSFEQFCINYANEHLQYYFNQHVFKYEQEEYR 475

Query: 109 KEGIRWRHIEFSDNTLCLQLVEGKPNGLLCVLDDQ 143
           KEGI+W  I+F DNT CLQL+EGKPNGLLCVLDDQ
Sbjct: 476 KEGIKWSDIDFLDNTGCLQLIEGKPNGLLCVLDDQ 510

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242011074|ref|XP_002426282.1| myosin IIIB, putative [Pediculus humanus corporis] gi|212510345|gb|EEB13544.1| myosin IIIB, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322797024|gb|EFZ19338.1| hypothetical protein SINV_09798 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383855596|ref|XP_003703296.1| PREDICTED: unconventional myosin-IXa-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332022806|gb|EGI63079.1| Myosin-IXa [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
WB|WBGene00002040 1880 hum-7 [Caenorhabditis elegans 0.449 0.035 0.656 3.9e-20
UNIPROTKB|F1S9U2548 F1S9U2 "Uncharacterized protei 0.449 0.122 0.597 1.4e-19
UNIPROTKB|G3MXH1 1104 Bt.27781 "Uncharacterized prot 0.449 0.060 0.597 8.1e-19
UNIPROTKB|E1BS57 2001 Gga.50857 "Uncharacterized pro 0.449 0.033 0.597 8.4e-19
UNIPROTKB|E1C471 2031 Gga.50857 "Uncharacterized pro 0.449 0.032 0.597 8.5e-19
UNIPROTKB|E1C470 2140 Gga.50857 "Uncharacterized pro 0.449 0.031 0.597 9.1e-19
UNIPROTKB|H3BMM1 1301 MYO9A "Unconventional myosin-I 0.449 0.051 0.597 1e-18
UNIPROTKB|E1BNV7 2159 MYO9B "Uncharacterized protein 0.449 0.031 0.597 1.2e-18
UNIPROTKB|E2R266 2161 MYO9B "Uncharacterized protein 0.449 0.031 0.597 1.2e-18
UNIPROTKB|G3MXE8 1951 Bt.27781 "Uncharacterized prot 0.449 0.034 0.597 1.7e-18
WB|WBGene00002040 hum-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 3.9e-20, Sum P(2) = 3.9e-20
 Identities = 44/67 (65%), Positives = 57/67 (85%)

Query:    78 SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 137
             SFEQLCINYANE LQ YFNQH+FQ+EQEEY KEGI W +IE++DNT C+QL + KP G+L
Sbjct:   555 SFEQLCINYANEKLQSYFNQHIFQFEQEEYLKEGISWTNIEYTDNTECVQLFQSKPYGIL 614

Query:   138 CVLDDQA 144
              ++D+++
Sbjct:   615 RLVDEES 621
GO:0007165 "signal transduction" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003774 "motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
GO:0060002 "plus-end directed microfilament motor activity" evidence=IDA
GO:0005516 "calmodulin binding" evidence=IPI
GO:0033275 "actin-myosin filament sliding" evidence=IDA
UNIPROTKB|F1S9U2 F1S9U2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS57 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C471 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C470 Gga.50857 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H3BMM1 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNV7 MYO9B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R266 MYO9B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXE8 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9U1M8MYOI_DICDINo assigned EC number0.55880.45630.0288yesN/A
P32492MYO4_YEASTNo assigned EC number0.61760.44960.0455yesN/A
Q9Z1N3MYO9A_RATNo assigned EC number0.59700.44960.0255yesN/A
Q13459MYO9B_HUMANNo assigned EC number0.59700.44960.0310yesN/A
O74805MYO51_SCHPONo assigned EC number0.58820.44960.0455yesN/A
Q875X3MYO2A_NAUCCNo assigned EC number0.60290.44960.0427yesN/A
Q9QY06MYO9B_MOUSENo assigned EC number0.58200.44960.0316yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 3e-31
smart00242 677 smart00242, MYSc, Myosin 3e-31
cd00124 679 cd00124, MYSc, Myosin motor domain 1e-28
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 5e-27
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 1e-26
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 2e-26
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 7e-26
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-25
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 1e-23
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 1e-21
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-20
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 4e-20
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 1e-19
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-18
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-09
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 2e-09
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-08
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-08
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 8e-07
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 2e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-06
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-05
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 1e-05
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 3e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 4e-05
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 6e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 6e-05
PRK07561859 PRK07561, PRK07561, DNA topoisomerase I subunit om 1e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 1e-04
PLN02381 1066 PLN02381, PLN02381, valyl-tRNA synthetase 1e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 2e-04
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 2e-04
pfam12569516 pfam12569, NARP1, NMDA receptor-regulated protein 2e-04
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 3e-04
pfam08432182 pfam08432, DUF1742, Fungal protein of unknown func 3e-04
PHA02616259 PHA02616, PHA02616, VP2/VP3; Provisional 4e-04
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 6e-04
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 7e-04
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 7e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 8e-04
COG0810244 COG0810, TonB, Periplasmic protein TonB, links inn 9e-04
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.001
PRK11642813 PRK11642, PRK11642, exoribonuclease R; Provisional 0.001
COG1498395 COG1498, SIK1, Protein implicated in ribosomal bio 0.001
pfam14181155 pfam14181, YqfQ, YqfQ-like protein 0.001
pfam11947149 pfam11947, DUF3464, Protein of unknown function (D 0.001
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.001
pfam07946322 pfam07946, DUF1682, Protein of unknown function (D 0.001
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.001
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.001
pfam08208193 pfam08208, RNA_polI_A34, DNA-directed RNA polymera 0.002
PTZ00372 413 PTZ00372, PTZ00372, endonuclease 4-like protein; P 0.002
pfam11947149 pfam11947, DUF3464, Protein of unknown function (D 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.002
PRK04950213 PRK04950, PRK04950, ProP expression regulator; Pro 0.002
PRK06319860 PRK06319, PRK06319, DNA topoisomerase I/SWI domain 0.002
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.003
pfam08496154 pfam08496, Peptidase_S49_N, Peptidase family S49 N 0.003
PTZ001081388 PTZ00108, PTZ00108, DNA topoisomerase 2-like prote 0.003
PTZ00069300 PTZ00069, PTZ00069, 60S ribosomal protein L5; Prov 0.003
PRK05901 509 PRK05901, PRK05901, RNA polymerase sigma factor; P 0.004
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information 
 Score =  117 bits (294), Expect = 3e-31
 Identities = 44/67 (65%), Positives = 54/67 (80%)

Query: 78  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 137
           SFEQLCINYANE LQYYFNQH+F+ EQEEY  EGI W +IE++DN  C+QL   KP GLL
Sbjct: 394 SFEQLCINYANEQLQYYFNQHIFKLEQEEYQGEGITWTNIEYTDNVGCIQLFSKKPTGLL 453

Query: 138 CVLDDQA 144
            +LD+++
Sbjct: 454 YLLDEES 460

Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236048 PRK07561, PRK07561, DNA topoisomerase I subunit omega; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|215214 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|221641 pfam12569, NARP1, NMDA receptor-regulated protein 1 Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|219838 pfam08432, DUF1742, Fungal protein of unknown function (DUF1742) Back     alignment and domain information
>gnl|CDD|222911 PHA02616, PHA02616, VP2/VP3; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional Back     alignment and domain information
>gnl|CDD|224415 COG1498, SIK1, Protein implicated in ribosomal biogenesis, Nop56p homolog [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein Back     alignment and domain information
>gnl|CDD|204792 pfam11947, DUF3464, Protein of unknown function (DUF3464) Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|219655 pfam07946, DUF1682, Protein of unknown function (DUF1682) Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|219746 pfam08208, RNA_polI_A34, DNA-directed RNA polymerase I subunit RPA34 Back     alignment and domain information
>gnl|CDD|240388 PTZ00372, PTZ00372, endonuclease 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|204792 pfam11947, DUF3464, Protein of unknown function (DUF3464) Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|235322 PRK04950, PRK04950, ProP expression regulator; Provisional Back     alignment and domain information
>gnl|CDD|235778 PRK06319, PRK06319, DNA topoisomerase I/SWI domain fusion protein; Validated Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information
>gnl|CDD|219868 pfam08496, Peptidase_S49_N, Peptidase family S49 N-terminal Back     alignment and domain information
>gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240254 PTZ00069, PTZ00069, 60S ribosomal protein L5; Provisional Back     alignment and domain information
>gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
PTZ00014 821 myosin-A; Provisional 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 99.98
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 99.98
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 99.98
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 99.98
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 99.98
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 99.97
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 99.97
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 99.97
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 99.97
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 99.97
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 99.96
KOG0161|consensus 1930 99.96
KOG0164|consensus 1001 99.95
KOG0163|consensus 1259 99.95
KOG0162|consensus 1106 99.94
KOG0160|consensus 862 99.92
KOG4229|consensus 1062 99.88
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-34  Score=277.37  Aligned_cols=90  Identities=46%  Similarity=0.782  Sum_probs=86.7

Q ss_pred             cCcceeecccccccccccchhhhhHhhhhhhhHHHHHHHHhhhhhhHhhhhhcCCcccccccCChhhHHHHhhc-CCCcc
Q psy15143         58 RKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEG-KPNGL  136 (149)
Q Consensus        58 ~~~~I~ILDIfGFE~f~~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EgI~w~~i~~~dN~~~ldLI~~-kp~GL  136 (149)
                      ..+|||||||||||+|+ .|||||||||||||+|||+|++|+|..||++|..|||+|.+|+|.||++|+|||+. .|.||
T Consensus       426 ~~~fIGVLDIyGFEiFE-kNSFEQlCINYtNEKLQQ~Fn~h~FklEQEeY~kE~IeW~~Idy~DnQ~~IDLIE~~~p~GI  504 (1463)
T COG5022         426 ASNFIGVLDIYGFEIFE-KNSFEQLCINYTNEKLQQFFNQHMFKLEQEEYVKEGIEWSFIDYFDNQPCIDLIEKKNPLGI  504 (1463)
T ss_pred             cccceeEEeecchhhhc-cCcHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhcCcccccccccCcchhHHHhccCCCch
Confidence            46899999999999999 99999999999999999999999999999999999999999999999999999997 47899


Q ss_pred             cccchhhhcccc
Q psy15143        137 LCVLDDQAKAVI  148 (149)
Q Consensus       137 LsILDEEc~fp~  148 (149)
                      |++|||||.+|-
T Consensus       505 lslLDEE~~~p~  516 (1463)
T COG5022         505 LSLLDEECVMPH  516 (1463)
T ss_pred             HhhhcHHhcCCC
Confidence            999999999983

>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 4e-17
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 4e-17
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 8e-17
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 8e-17
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 8e-17
1b7t_A 835 Myosin Digested By Papain Length = 835 8e-17
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 8e-17
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 9e-17
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 1e-16
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 1e-16
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 3e-16
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 6e-16
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 6e-16
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 9e-16
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 9e-16
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 1e-15
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 1e-15
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 1e-15
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-15
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 1e-15
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 1e-15
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-15
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-15
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-15
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 1e-15
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 1e-15
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 1e-15
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 1e-15
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-15
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 1e-15
2y9e_X 758 Structural Basis For The Allosteric Interference Of 1e-15
2y0r_X 758 Structural Basis For The Allosteric Interference Of 1e-15
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 1e-15
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 1e-15
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-15
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 2e-15
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 3e-15
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 1e-13
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 2e-13
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 2e-13
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 3e-13
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 3e-13
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 3e-13
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 3e-13
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 4e-13
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 4e-13
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 8e-13
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 8e-13
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 6e-12
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 6e-12
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 6e-12
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 6e-12
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 6e-12
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 6e-12
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 7e-12
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 7e-12
2x51_A 789 M6 Delta Insert1 Length = 789 7e-12
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 7e-12
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 7e-12
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 7e-12
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/67 (56%), Positives = 50/67 (74%), Gaps = 2/67 (2%)
Query: 78  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFS-DNTLCLQLVEGKPNGL 136
           SFEQLCINY NE LQ +FN H+F  EQEEY KEGI+W  I+F  D  +C+ L+E KP G+
Sbjct: 472 SFEQLCINYTNERLQQFFNHHMFVLEQEEYKKEGIQWEFIDFGMDLQMCIDLIE-KPMGI 530
Query: 137 LCVLDDQ 143
           L +L+++
Sbjct: 531 LSILEEE 537
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 5e-34
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 2e-33
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 1e-31
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 1e-29
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 2e-29
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 6e-29
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-28
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-27
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-26
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-23
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 9e-05
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 4e-04
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 7e-04
1kxf_A264 Sindbis virus capsid protein; chymotrypsin-like se 7e-04
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
 Score =  124 bits (313), Expect = 5e-34
 Identities = 30/68 (44%), Positives = 45/68 (66%)

Query: 78  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 137
           SFEQ CINY NE LQ +FN+ + + EQE Y KEG+    + + DN  C+ L+E +  G+L
Sbjct: 463 SFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGIL 522

Query: 138 CVLDDQAK 145
            +LD++ +
Sbjct: 523 DILDEENR 530
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure
>1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.98
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.98
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.97
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.97
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.97
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
Probab=100.00  E-value=5.6e-35  Score=270.67  Aligned_cols=91  Identities=34%  Similarity=0.594  Sum_probs=88.4

Q ss_pred             ccCcceeecccccccccccchhhhhHhhhhhhhHHHHHHHHhhhhhhHhhhhhcCCcccccccCChhhHHHHhhcCCCcc
Q psy15143         57 RRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGL  136 (149)
Q Consensus        57 ~~~~~I~ILDIfGFE~f~~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EgI~w~~i~~~dN~~~ldLI~~kp~GL  136 (149)
                      ...++||||||||||+|+ .|||||||||||||+||++|++++|..||++|.+|||+|.+|+|.||++|||||+++|.||
T Consensus       443 ~~~~~IGvLDI~GFE~f~-~NsFEQlcINyaNEkLQq~F~~~~f~~EqeeY~~EgI~w~~i~f~DN~~~idLie~kp~GI  521 (784)
T 2v26_A          443 TSSYFIGVLDIAGFEYFE-HNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGI  521 (784)
T ss_dssp             CCSEEEEEEECCCCCCCS-SCCHHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHTTCCCCCCCCCCCHHHHHHHHCTTTSH
T ss_pred             cccceeeecccCCcccCC-cCCHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHhcCCCcccccccChHHHHHHHhhccccH
Confidence            356899999999999999 9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhhcccc
Q psy15143        137 LCVLDDQAKAVI  148 (149)
Q Consensus       137 LsILDEEc~fp~  148 (149)
                      |+||||||++|.
T Consensus       522 lslLDEe~~~p~  533 (784)
T 2v26_A          522 LDILDEENRLPQ  533 (784)
T ss_dssp             HHHHHHHHHSSS
T ss_pred             HHHHHHHhcCCC
Confidence            999999999985
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 9e-16
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 2e-13
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 3e-13
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 6e-13
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 1e-12
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 8e-12
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

 Score = 70.9 bits (173), Expect = 9e-16
 Identities = 32/66 (48%), Positives = 45/66 (68%)

Query: 78  SFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGLL 137
           SFEQL IN+ NE LQ  F +   + EQEEY +EGI W++IE+ +N    +L+E KP GL+
Sbjct: 389 SFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGLI 448

Query: 138 CVLDDQ 143
            +LD+ 
Sbjct: 449 SLLDEA 454
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 99.96
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 99.96
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 99.96
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 99.96
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.96
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 99.96
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]

Probab=99.96  E-value=3.5e-31  Score=239.51  Aligned_cols=91  Identities=36%  Similarity=0.542  Sum_probs=88.1

Q ss_pred             ccCcceeecccccccccccchhhhhHhhhhhhhHHHHHHHHhhhhhhHhhhhhcCCcccccccCChhhHHHHhhcCCCcc
Q psy15143         57 RRKNYTKTNICHGEQTLLTSVSFEQLCINYANEHLQYYFNQHVFQYEQEEYNKEGIRWRHIEFSDNTLCLQLVEGKPNGL  136 (149)
Q Consensus        57 ~~~~~I~ILDIfGFE~f~~~NsfEQLcINyaNErLq~~f~~~if~~eqeeY~~EgI~w~~i~~~dN~~~ldLI~~kp~GL  136 (149)
                      ...++||||||||||+|+ .|||||||||||||+||++|++++|..++++|.+|||+|+.++|.||++|+|||+++|.||
T Consensus       369 ~~~~~IgiLDifGFE~f~-~NsfEQLcINyaNEkLq~~f~~~if~~e~~~Y~~EgI~~~~i~~~dN~~~l~li~~~~~Gi  447 (684)
T d1lkxa_         369 EKGPVIGILDIYGFEVFQ-NNSFEQLNINFCNEKLQQLFIELTLKSEQEEYVREGIEWKNIEYFNNKPICELIEKKPIGL  447 (684)
T ss_dssp             CCCCEEEEEECCCCCCCS-SBCHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHTTCCCCCCCCSCCCHHHHHTTSSSSSH
T ss_pred             cccceEEEeeccCCcCCC-CCcHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHhccCCCCCCCcCCchHHHHHHHhccchH
Confidence            346799999999999999 9999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhhcccc
Q psy15143        137 LCVLDDQAKAVI  148 (149)
Q Consensus       137 LsILDEEc~fp~  148 (149)
                      |++|||||++|.
T Consensus       448 l~lLdee~~~~~  459 (684)
T d1lkxa_         448 ISLLDEACLIAK  459 (684)
T ss_dssp             HHHHHHHHHSTT
T ss_pred             HHHhHHHhcCCC
Confidence            999999999985
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure