Psyllid ID: psy15180
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| 1345880 | 134 | RecName: Full=Cytochrome b5; Short=CYTB5 | 0.893 | 0.873 | 0.488 | 2e-27 | |
| 332376849 | 129 | unknown [Dendroctonus ponderosae] | 0.938 | 0.953 | 0.436 | 9e-25 | |
| 195172784 | 135 | GL20014 [Drosophila persimilis] gi|19845 | 0.893 | 0.866 | 0.458 | 2e-24 | |
| 194863782 | 134 | GG23285 [Drosophila erecta] gi|190662478 | 0.916 | 0.895 | 0.454 | 2e-24 | |
| 195474418 | 134 | GE19131 [Drosophila yakuba] gi|194175589 | 0.916 | 0.895 | 0.454 | 2e-24 | |
| 156553911 | 138 | PREDICTED: cytochrome b5-like isoform 1 | 0.908 | 0.862 | 0.447 | 2e-24 | |
| 195425367 | 133 | GK10686 [Drosophila willistoni] gi|19415 | 0.893 | 0.879 | 0.451 | 3e-24 | |
| 195384329 | 135 | GJ19962 [Drosophila virilis] gi|19414566 | 0.916 | 0.888 | 0.453 | 3e-24 | |
| 195332153 | 134 | GM20961 [Drosophila sechellia] gi|195581 | 0.916 | 0.895 | 0.446 | 4e-24 | |
| 187127216 | 134 | cytochrome B5-like protein [Acyrthosipho | 0.893 | 0.873 | 0.463 | 5e-24 |
| >gi|1345880|sp|P49096.1|CYB5_MUSDO RecName: Full=Cytochrome b5; Short=CYTB5 gi|600524|gb|AAA56985.1| cytochrome b5 [Musca domestica] | Back alignment and taxonomy information |
|---|
Score = 126 bits (317), Expect = 2e-27, Method: Compositional matrix adjust.
Identities = 65/133 (48%), Positives = 87/133 (65%), Gaps = 16/133 (12%)
Query: 3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHS 62
K FT EV ++ K N +I VY+V FLNEHPGGEEVL++Q G++ATEHFEDVGHS
Sbjct: 7 KYFTRAEVAKNNTKDKNWFIIHNNVYDVTAFLNEHPGGEEVLIEQAGKDATEHFEDVGHS 66
Query: 63 TEARELMKKYKVGTISDPE--NIPESSTGGSSSYDGKYVPPKSTD---EESGMPSWVVPL 117
++ARE+MK+YKVG + E N+PE S P +T+ EES M SW++P
Sbjct: 67 SDAREMMKQYKVGELVAEERSNVPEKSE-----------PTWNTEQKTEESSMKSWLMPF 115
Query: 118 VFGLLVVLVYQYF 130
V GL+ L+Y++F
Sbjct: 116 VLGLVATLIYKFF 128
|
Source: Musca domestica Species: Musca domestica Genus: Musca Family: Muscidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332376849|gb|AEE63564.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|195172784|ref|XP_002027176.1| GL20014 [Drosophila persimilis] gi|198459487|ref|XP_001361397.2| GA15264 [Drosophila pseudoobscura pseudoobscura] gi|194112989|gb|EDW35032.1| GL20014 [Drosophila persimilis] gi|198136706|gb|EAL25975.2| GA15264 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|194863782|ref|XP_001970611.1| GG23285 [Drosophila erecta] gi|190662478|gb|EDV59670.1| GG23285 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195474418|ref|XP_002089488.1| GE19131 [Drosophila yakuba] gi|194175589|gb|EDW89200.1| GE19131 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|156553911|ref|XP_001602324.1| PREDICTED: cytochrome b5-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195425367|ref|XP_002060982.1| GK10686 [Drosophila willistoni] gi|194157067|gb|EDW71968.1| GK10686 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195384329|ref|XP_002050870.1| GJ19962 [Drosophila virilis] gi|194145667|gb|EDW62063.1| GJ19962 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195332153|ref|XP_002032763.1| GM20961 [Drosophila sechellia] gi|195581248|ref|XP_002080446.1| GD10488 [Drosophila simulans] gi|194124733|gb|EDW46776.1| GM20961 [Drosophila sechellia] gi|194192455|gb|EDX06031.1| GD10488 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|187127216|ref|NP_001119627.1| cytochrome B5-like protein [Acyrthosiphon pisum] gi|89574491|gb|ABD76376.1| cytochrome B5-like protein [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 131 | ||||||
| FB|FBgn0264294 | 134 | Cyt-b5 "Cytochrome b5" [Drosop | 0.938 | 0.917 | 0.387 | 7.2e-20 | |
| ASPGD|ASPL0000044220 | 136 | AN2069 [Emericella nidulans (t | 0.969 | 0.933 | 0.407 | 1.1e-18 | |
| TAIR|locus:2046417 | 134 | CB5-B "cytochrome B5 isoform B | 0.694 | 0.679 | 0.495 | 3.6e-18 | |
| UNIPROTKB|F1NSI3 | 144 | CYB5B "Uncharacterized protein | 0.893 | 0.812 | 0.404 | 7.5e-18 | |
| UNIPROTKB|F1NXL2 | 150 | CYB5B "Uncharacterized protein | 0.893 | 0.78 | 0.404 | 7.5e-18 | |
| UNIPROTKB|H3BUX2 | 140 | CYB5B "Cytochrome b5 type B" [ | 0.694 | 0.65 | 0.483 | 1.2e-17 | |
| UNIPROTKB|J3KNF8 | 150 | CYB5B "Cytochrome b5 type B (O | 0.694 | 0.606 | 0.483 | 1.2e-17 | |
| UNIPROTKB|O43169 | 146 | CYB5B "Cytochrome b5 type B" [ | 0.694 | 0.623 | 0.483 | 1.2e-17 | |
| UNIPROTKB|Q0P5F6 | 146 | CYB5B "Uncharacterized protein | 0.893 | 0.801 | 0.388 | 1.6e-17 | |
| UNIPROTKB|F1S393 | 144 | CYB5B "Uncharacterized protein | 0.625 | 0.569 | 0.469 | 8.6e-17 |
| FB|FBgn0264294 Cyt-b5 "Cytochrome b5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 236 (88.1 bits), Expect = 7.2e-20, P = 7.2e-20
Identities = 50/129 (38%), Positives = 74/129 (57%)
Query: 2 SKEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGH 61
+K FT EV + ++I +Y+V FLNEHPGGEEVL++Q G++ATE+FEDVGH
Sbjct: 6 TKTFTRAEVAKHNTNKDTWLLIHNNIYDVTAFLNEHPGGEEVLIEQAGKDATENFEDVGH 65
Query: 62 STEARELMKKYKVGTISDPENIPESSTGGSSSYDGKYVPPKSTDEESGMPSWXXXXXXXX 121
S +AR++MKKYK+G + + E T + + + + T EES + SW
Sbjct: 66 SNDARDMMKKYKIGELVESER-----TSVAQKSEPTWSTEQQT-EESSVKSWLVPLVLCL 119
Query: 122 XXXXXYQYF 130
Y++F
Sbjct: 120 VATLFYKFF 128
|
|
| ASPGD|ASPL0000044220 AN2069 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046417 CB5-B "cytochrome B5 isoform B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NSI3 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXL2 CYB5B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BUX2 CYB5B "Cytochrome b5 type B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3KNF8 CYB5B "Cytochrome b5 type B (Outer mitochondrial membrane), isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43169 CYB5B "Cytochrome b5 type B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0P5F6 CYB5B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S393 CYB5B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| pfam00173 | 74 | pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid | 3e-26 | |
| COG5274 | 164 | COG5274, CYB5, Cytochrome b involved in lipid meta | 4e-19 | |
| PLN02252 | 888 | PLN02252, PLN02252, nitrate reductase [NADPH] | 4e-14 | |
| PLN03198 | 526 | PLN03198, PLN03198, delta6-acyl-lipid desaturase; | 7e-06 |
| >gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain | Back alignment and domain information |
|---|
Score = 93.0 bits (232), Expect = 3e-26
Identities = 36/73 (49%), Positives = 49/73 (67%)
Query: 5 FTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTE 64
FT +EV + IVI G VY+V FL +HPGGE+V+L G++ATE FED HS
Sbjct: 1 FTLEEVKKHNKDGDCWIVINGKVYDVTRFLKDHPGGEDVILSAAGKDATEAFEDAIHSEA 60
Query: 65 ARELMKKYKVGTI 77
AR+L++KY+VG +
Sbjct: 61 ARKLLEKYRVGEL 73
|
This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. Length = 74 |
| >gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| KOG0537|consensus | 124 | 100.0 | ||
| PF00173 | 76 | Cyt-b5: Cytochrome b5-like Heme/Steroid binding do | 99.92 | |
| KOG0536|consensus | 145 | 99.9 | ||
| COG5274 | 164 | CYB5 Cytochrome b involved in lipid metabolism [En | 99.85 | |
| PLN03198 | 526 | delta6-acyl-lipid desaturase; Provisional | 99.84 | |
| PLN03199 | 485 | delta6-acyl-lipid desaturase-like protein; Provisi | 99.83 | |
| PLN02252 | 888 | nitrate reductase [NADPH] | 99.81 | |
| KOG4232|consensus | 430 | 99.61 | ||
| KOG4576|consensus | 167 | 99.54 | ||
| COG4892 | 81 | Predicted heme/steroid binding protein [General fu | 98.68 | |
| KOG1110|consensus | 183 | 98.1 | ||
| KOG1108|consensus | 281 | 96.72 | ||
| PF14901 | 94 | Jiv90: Cleavage inducing molecular chaperone | 88.89 | |
| PF05283 | 186 | MGC-24: Multi-glycosylated core protein 24 (MGC-24 | 81.22 |
| >KOG0537|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-33 Score=198.74 Aligned_cols=84 Identities=44% Similarity=0.776 Sum_probs=79.8
Q ss_pred CCCcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCC
Q psy15180 1 MSKEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDP 80 (131)
Q Consensus 1 m~~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~ 80 (131)
|.++|+++||++||+++||||+|+|+|||||+|+++||||.++|+.+||+|+|+.|++++||.+|++||++|+||.+.+.
T Consensus 3 ~~k~~~~~EV~kHn~~~d~Wvii~gkVYDvT~Fl~eHPGG~~vLl~~AGkDaT~~F~~~gHS~~A~~ml~~y~ig~~~~~ 82 (124)
T KOG0537|consen 3 DLKYYTLSEVAKHNKKDDCWVIIHGKVYDVTSFLDEHPGGEDVLLEYAGKDATEAFEDVGHSKDAREMLEEYYIGEVPTT 82 (124)
T ss_pred ccccccHHHHHhhcCCCCeEEEECCEEEeccchhhhCCChHHHHHHHhchhhHHhccccCCcHHHHHHhhhcccccccCC
Confidence 34889999999999999999999999999999999999999999999999999999999999999999999999999987
Q ss_pred CCCC
Q psy15180 81 ENIP 84 (131)
Q Consensus 81 ~~~~ 84 (131)
+...
T Consensus 83 ~~~~ 86 (124)
T KOG0537|consen 83 ARPV 86 (124)
T ss_pred Cccc
Confidence 6543
|
|
| >PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] | Back alignment and domain information |
|---|
| >KOG0536|consensus | Back alignment and domain information |
|---|
| >COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN03198 delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
| >PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02252 nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >KOG4232|consensus | Back alignment and domain information |
|---|
| >KOG4576|consensus | Back alignment and domain information |
|---|
| >COG4892 Predicted heme/steroid binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1110|consensus | Back alignment and domain information |
|---|
| >KOG1108|consensus | Back alignment and domain information |
|---|
| >PF14901 Jiv90: Cleavage inducing molecular chaperone | Back alignment and domain information |
|---|
| >PF05283 MGC-24: Multi-glycosylated core protein 24 (MGC-24); InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 131 | ||||
| 2ibj_A | 88 | Structure Of House Fly Cytochrome B5 Length = 88 | 8e-22 | ||
| 3ner_A | 92 | Structure Of Human Type B Cytochrome B5 Length = 92 | 2e-17 | ||
| 3mus_A | 87 | 2a Resolution Structure Of Rat Type B Cytochrome B5 | 1e-16 | ||
| 1b5m_A | 84 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 1e-16 | ||
| 1eue_A | 86 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 2e-16 | ||
| 1bfx_A | 99 | The Solution Nmr Structure Of The B Form Of Oxidize | 4e-16 | ||
| 1i87_A | 98 | Solution Structure Of The Water-Soluble Fragment Of | 4e-16 | ||
| 1awp_A | 92 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 4e-16 | ||
| 1aqa_A | 94 | Solution Structure Of Reduced Microsomal Rat Cytoch | 5e-16 | ||
| 1blv_A | 94 | Solution Structure Of Oxidized Rat Microsomal Cytoc | 5e-16 | ||
| 1icc_A | 87 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 1e-15 | ||
| 1ib7_A | 94 | Solution Structure Of F35y Mutant Of Rat Ferro Cyto | 1e-15 | ||
| 3ozz_B | 82 | Structure Of A Cytochrome B5 Core-Swap Mutant Lengt | 1e-15 | ||
| 1jex_A | 94 | Solution Structure Of A67v Mutant Of Rat Ferro Cyto | 2e-15 | ||
| 2i89_A | 93 | Structure Of Septuple Mutant Of Rat Outer Mitochond | 3e-15 | ||
| 1lj0_A | 92 | Structure Of Quintuple Mutant Of The Rat Outer Mito | 5e-15 | ||
| 1hko_A | 104 | Nmr Structure Of Bovine Cytochrome B5 Length = 104 | 5e-15 | ||
| 1cyo_A | 93 | Bovine Cytochrome B(5) Length = 93 | 6e-15 | ||
| 2i96_A | 108 | Solution Structure Of The Oxidized Microsomal Human | 7e-15 | ||
| 1ehb_A | 82 | Crystal Structure Of Recombinant Trypsin-Solubilize | 8e-15 | ||
| 2m33_A | 104 | Solution Nmr Structure Of Full-length Oxidized Micr | 8e-15 | ||
| 1do9_A | 94 | Solution Structure Of Oxidized Microsomal Rabbit Cy | 9e-15 | ||
| 1u9u_A | 82 | Crystal Structure Of F58y Mutant Of Cytochrome B5 L | 2e-14 | ||
| 1m20_A | 82 | Crystal Structure Of F35y Mutant Of Trypsin-Solubil | 2e-14 | ||
| 1u9m_A | 82 | Crystal Structure Of F58w Mutant Of Cytochrome B5 L | 2e-14 | ||
| 1lr6_A | 82 | Crystal Structure Of V45y Mutant Of Cytochrome B5 L | 3e-14 | ||
| 1lqx_A | 82 | Crystal Structure Of V45e Mutant Of Cytochrome B5 L | 5e-14 | ||
| 1sh4_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 5e-14 | ||
| 1j0q_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 5e-14 | ||
| 1es1_A | 82 | Crystal Structure Of Val61his Mutant Of Trypsin-Sol | 5e-14 | ||
| 1m59_A | 82 | Crystal Structure Of P40v Mutant Of Trypsin-Solubil | 1e-13 | ||
| 1m2i_A | 82 | Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME | 1e-13 | ||
| 1i5u_A | 82 | Solution Structure Of Cytochrome B5 Triple Mutant ( | 6e-13 | ||
| 1m2m_A | 82 | Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt | 2e-12 | ||
| 1f03_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 2e-12 | ||
| 3lf5_A | 88 | Structure Of Human Nadh Cytochrome B5 Oxidoreductas | 6e-08 | ||
| 1cxy_A | 90 | Structure And Characterization Of Ectothiorhodospir | 1e-06 | ||
| 1x3x_A | 82 | Crystal Structure Of Cytochrome B5 From Ascaris Suu | 1e-04 |
| >pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 | Back alignment and structure |
|
| >pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 | Back alignment and structure |
| >pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 | Back alignment and structure |
| >pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 | Back alignment and structure |
| >pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 | Back alignment and structure |
| >pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 | Back alignment and structure |
| >pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 | Back alignment and structure |
| >pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 | Back alignment and structure |
| >pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 | Back alignment and structure |
| >pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 | Back alignment and structure |
| >pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 | Back alignment and structure |
| >pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 | Back alignment and structure |
| >pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 | Back alignment and structure |
| >pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 | Back alignment and structure |
| >pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 | Back alignment and structure |
| >pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 | Back alignment and structure |
| >pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 | Back alignment and structure |
| >pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 | Back alignment and structure |
| >pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 | Back alignment and structure |
| >pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 | Back alignment and structure |
| >pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 | Back alignment and structure |
| >pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 | Back alignment and structure |
| >pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 | Back alignment and structure |
| >pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 | Back alignment and structure |
| >pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 | Back alignment and structure |
| >pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 131 | |||
| 3ner_A | 92 | Cytochrome B5 type B; heme, electron transport; HE | 5e-29 | |
| 1hko_A | 104 | Cytochrome B5; electron transfer protein, heme, el | 7e-29 | |
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 9e-29 | |
| 1cyo_A | 93 | Cytochrome B5; electron transport; HET: HEM; 1.50A | 4e-28 | |
| 3lf5_A | 88 | Cytochrome B5 reductase 4; NCB5OR, electron transf | 1e-26 | |
| 2keo_A | 112 | Probable E3 ubiquitin-protein ligase HERC2; protei | 3e-26 | |
| 1cxy_A | 90 | Cytochrome B5; helix, beta-strand, electron transp | 2e-24 | |
| 1mj4_A | 82 | Sulfite oxidase; cytochrome B5, heme, oxidoreducta | 5e-24 | |
| 1x3x_A | 82 | Cytochrome B5; hemoprotein, porcine parasitic nama | 9e-21 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 2e-12 | |
| 1sox_A | 466 | Sulfite oxidase; oxidoreductase, sulfite oxidation | 7e-06 |
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 | Back alignment and structure |
|---|
Score = 100 bits (251), Expect = 5e-29
Identities = 41/83 (49%), Positives = 56/83 (67%)
Query: 3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHS 62
+ +EV + +VI G VY+V FLNEHPGGEEVLL+Q G +A+E FEDVGHS
Sbjct: 10 TYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHS 69
Query: 63 TEARELMKKYKVGTISDPENIPE 85
++ARE++K+Y +G I + PE
Sbjct: 70 SDAREMLKQYYIGDIHPSDLKPE 92
|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 | Back alignment and structure |
|---|
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 | Back alignment and structure |
|---|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 | Back alignment and structure |
|---|
| >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 99.96 | |
| 3ner_A | 92 | Cytochrome B5 type B; heme, electron transport; HE | 99.96 | |
| 1cyo_A | 93 | Cytochrome B5; electron transport; HET: HEM; 1.50A | 99.96 | |
| 1hko_A | 104 | Cytochrome B5; electron transfer protein, heme, el | 99.96 | |
| 1cxy_A | 90 | Cytochrome B5; helix, beta-strand, electron transp | 99.96 | |
| 3lf5_A | 88 | Cytochrome B5 reductase 4; NCB5OR, electron transf | 99.96 | |
| 1x3x_A | 82 | Cytochrome B5; hemoprotein, porcine parasitic nama | 99.95 | |
| 1mj4_A | 82 | Sulfite oxidase; cytochrome B5, heme, oxidoreducta | 99.94 | |
| 2keo_A | 112 | Probable E3 ubiquitin-protein ligase HERC2; protei | 99.94 | |
| 1sox_A | 466 | Sulfite oxidase; oxidoreductase, sulfite oxidation | 99.87 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 99.86 | |
| 1j03_A | 102 | Putative steroid binding protein; alpha and beta, | 99.74 |
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} | Back alignment and structure |
|---|
Probab=99.96 E-value=1.1e-30 Score=173.65 Aligned_cols=80 Identities=58% Similarity=0.942 Sum_probs=76.5
Q ss_pred CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCCCC
Q psy15180 3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDPEN 82 (131)
Q Consensus 3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~~~ 82 (131)
+.||++||++|++.++|||+|+|+|||||+|+..||||.++|+.++|+|+|+.|++.+||.+++++|++|+||.|++.+.
T Consensus 7 ~~~t~~ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~i~~~aG~DaT~~f~~~~Hs~~a~~~L~~~~IG~l~~~~~ 86 (88)
T 2ibj_A 7 KYFTRAEVAKNNTKDKNWFIIHNNVYDVTAFLNEHPGGEEVLIEQAGKDATEHFEDVGHSSDAREMMKQYKVGELVAEER 86 (88)
T ss_dssp CEECHHHHHTSEETTEEEEEETTEEEECGGGTTTCTTCSHHHHTTTTEECHHHHHHHTCCHHHHHHHGGGEEEEECGGGC
T ss_pred CccCHHHHHHhCCCCCEEEEECCEEEECCcchhhCcCHHHHHHHhCCCcchHHHHHcCCCHHHHHHHHcCceEEeCcccc
Confidence 78999999999999999999999999999999999999999999999999999998889999999999999999987553
|
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... | Back alignment and structure |
|---|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} | Back alignment and structure |
|---|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 131 | ||||
| d1cyoa_ | 88 | d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta | 4e-22 | |
| d1cxya_ | 81 | d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira | 8e-21 | |
| d1euea_ | 86 | d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic | 4e-20 | |
| d1mj4a_ | 80 | d.120.1.1 (A:) Sulfite oxidase, N-terminal domain | 1e-19 | |
| d1soxa2 | 91 | d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom | 7e-18 | |
| d1kbia2 | 97 | d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal | 2e-16 |
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Cytochrome b5 species: Cow (Bos taurus) [TaxId: 9913]
Score = 81.4 bits (201), Expect = 4e-22
Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
Query: 3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHS 62
K +T +E+ + + + +++ VY++ FL EHPGGEEVL +Q G +ATE+FEDVGHS
Sbjct: 5 KYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHS 64
Query: 63 TEARELMKKYKVGTI--SDPENI 83
T+AREL K + +G + D I
Sbjct: 65 TDARELSKTFIIGELHPDDRSKI 87
|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 | Back information, alignment and structure |
|---|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 131 | |||
| d1cyoa_ | 88 | Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | 99.97 | |
| d1euea_ | 86 | Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 | 99.97 | |
| d1cxya_ | 81 | Cytochrome b558 {Ectothiorhodospira vacuolata [Tax | 99.96 | |
| d1soxa2 | 91 | Sulfite oxidase, N-terminal domain {Chicken (Gallu | 99.96 | |
| d1mj4a_ | 80 | Sulfite oxidase, N-terminal domain {Human (Homo sa | 99.95 | |
| d1kbia2 | 97 | Flavocytochrome b2, N-terminal domain {Baker's yea | 99.95 | |
| d1t0ga_ | 109 | Putative steroid binding protein AT2G24940 {Thale | 98.71 |
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Cytochrome b5 species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.97 E-value=1.4e-32 Score=181.48 Aligned_cols=81 Identities=43% Similarity=0.763 Sum_probs=77.9
Q ss_pred CcCCHHHHhccCCCCCeEEEEcCeEeeccccCccCCChHHHHHhcCCCcchHHHhhcCCCHHHHHHhhcCceeeccCCCC
Q psy15180 3 KEFTYKEVVESTDKTANLIVIKGVVYNVAPFLNEHPGGEEVLLDQRGQNATEHFEDVGHSTEARELMKKYKVGTISDPEN 82 (131)
Q Consensus 3 ~~~t~~ev~~h~~~~~~wvii~g~VYDvT~f~~~HPGG~~~l~~~aG~D~T~~f~~~~Hs~~a~~~L~~~~VG~l~~~~~ 82 (131)
|.||++||++||++++||++|+|+|||||+|+..||||.++|+.++|+|+|+.|+.++||..++++|++|+||+|.+++.
T Consensus 5 k~yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~F~~~~hs~~a~~~l~~~~IG~l~~~~~ 84 (88)
T d1cyoa_ 5 KYYTLEEIQKHNNSKSTWLILHYKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDARELSKTFIIGELHPDDR 84 (88)
T ss_dssp CEECHHHHTTCEETTEEEEEETTEEEECTTTTTTCTTCSHHHHHHTTSBCHHHHHHTTCCHHHHHHHTTTEEEEECGGGG
T ss_pred ccccHHHHHhhCCCCCeEEEECCEEEecchhhcccCCchHHHHHHcCCchHHHHHHHCCCHHHHHHHHcCccEEECcccc
Confidence 88999999999999999999999999999999999999999999999999999999999999999999999999997664
Q ss_pred C
Q psy15180 83 I 83 (131)
Q Consensus 83 ~ 83 (131)
.
T Consensus 85 ~ 85 (88)
T d1cyoa_ 85 S 85 (88)
T ss_dssp G
T ss_pred C
Confidence 4
|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|