Psyllid ID: psy15183


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930------1940------1950------1960------1970---
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTKMSDTNQEIPKSDEANKELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSLDGMKKKQQQQVSPPHDSMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFLKSKEYAKAIQEKVDKENAEQKKIDALTPQVKTEPEENVKITQEPVVLKQIKSEEKVEMEKEKRKKILREREEEKEEQPAMKKIKVEKPEESNEKTKRHKIKSEPKENDSSKGKSGGTISTVDFSKVNYNKYMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKKDGETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPNLTTEQQKDRRKELAKKLVEMNAKKREERLVDDERHLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSEEEQERLIELEEILRQHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
cccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccEEccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHccccccccccccccccccccccccccccHHHHccccccccccHHcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccEEEccHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEEEEcccEEEEEcccccccHHHHHHHHccccEEEEEccccHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHccccHHHHHHcHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHccccccccccHHccccHHHHHHHHHHHcHHHHHHHccccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcEEEEEEEcccccccEEEEEcccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHEEEEccHHHHHHHHccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcHHccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHccEEEcccccccccHHHHHHHHHHHccccccEEEEEEcccccccccHHHHHHccccccccccccHHHHHHHccccEEEcccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHccccccccccHHcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccHHHHHcccccccccccccccccccccccccEEEccHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEEEEcccEEEEEcccccccHHHHHHHHccccEEEEEccccHHHHHHHHHcccccccccHHHHHHHHccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccc
ccEEEEEccccccHHHHHHHHHccccccccccHHHHHcccHHHHHHcccccccEEEEEEcccHcHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHcccccccEcccccccccccccccEEEcccccccHHHHccccccccccccccEEEHccccccHHHHcccccccccccccccEEEEccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHEHEEEccccccEEEEHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccEEEEEcccHHHHHHHHcHHHHHHHHHHHHHccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHEccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccccHcccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEccccccccHHHHHHHHHHHHHcccHHHHHccHHcccHHHHHHHcccHHHHHHHHHHcccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHcHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccHHHccccccccccEEEEEcccccEEccccccccccccccccccccccccccccccccccHHHHHccccEEEEEccccccEEccHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccEEEEEcccccccEEEEEcccccHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcEccEEcccccEEEcccccccHHHHccHHHccHHHHHHHcccHHHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHccccHHHHHHHHEEcccccccccHHHHHHHHHHHHcccEEEEccccccEEEEEcHHHHHHHHHHHHHHHcHHHHHcccccEEEccHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccEEEEcccccccHHHHcccHHccccccccHHHHHHHHHHcccHHHHHHHHcEEEcccccccccHHHHHHHHHHHHccccEEEEEEccccccEEEEEcHHHHHHHHHHHHHHHcHHHHHcccccEEEEEEcccccccccEEEEcccccEEEEcccEEEEEEccccEEEEHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHcccccccEcccccccccccccccEEEcccccccHHHHccccccccccccccEEEHccccccHHHHccccccccccHccccEEEEccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHEEEEEccccccEEEEHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHccEEEEEcccHHHHHHHHcHHHHHHHHHHHHHccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHHHEEcccccHHHHHHcc
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKsingalpskvksrltfksgklNTFLFIVTKmsdtnqeipksdeanKELSKTLDVLVQNAYKSIVKCTKtaqsfpsthenslliaspnyisgvagtsdKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVmagtktpsvlpsqpkivKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGaveierpqlqfkvKVDNSYEQLFepklkekpnaLKPLAILLEKYDAiesfchpyeyeldlyvpkedflkceepkqalplsdtplmmitePEQVTQLVSELKQQQEIAIDLEYhnyrsyqgytclmqistRDKDYIVDTLKLREDLEVLNevltdknivkvfHGADSDIKWLQKDFGLYVVGmfdthqackflpmprQSLAYLLKHycdvdsdktfqlfdwrhrplpepaiqyarTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSrnicklkyekpvfneegyMNIFRSHALLNNQQKYALRELYKWRDRiardkdestgyvlpnhMLLQMAQSIPRDIQgifaccnpvpqtvkEHVLDIHAIILKARLQsltkpveklqpsldgmkkkqqqqvspphdsmdclnykglppvfpnniicapsnthlssydpqdkkiAQIGLFFedkmkigsnkyqkiklktsrfetpyqrFLKSKEYAKAIQEKVDKENaeqkkidaltpqvktepeenvkitqepvvlKQIKSEEKVEMEKEKRKKILREREEEKEEQPAMKKikvekpeesnektkrhkiksepkendsskgksggtistvdfskvnynkymakpdtkilpdpyyEYLDelrdsslpivfdngawccrvgwascekpnlIFKNLIakprkergkkdgetqvgndiSNIEAVRFQLKTqfdknvvthyDIQEQIFDYAFSHLsintegnvnhpivltepflnpnysrSLMSELLFECyqvpsvcygiDSLFSyqyngwegqsgVIIScgyqcthvipvingcidaskakridlggfSVIHHLHKLLQlkypshinsitpsrseellwDYGFVATDYREHLRKWLDaefydsnvvkvqlpyavpvpnltteQQKDRRKELAKKLVEMNAKKREERLVDDERHLNELLELREiveltpsdhsHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYnngedlteepkaklskeiavpesEAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARkekrdddfgmrdedwDVYKVINkdagdtdsEEEQERLIELEEILRqhdpeftslnqeqelspkeANQLHIGvermcgpeclfqpsmLGSIQAGISETLNFVLNSYPQHIAQSLANNIFvtgslcqlpgFVERLNKdllenrpfqshfsvslaenpeldawsgarqfslsenfhdfavtqsdyqekggeffrvhpcsnnkvksrltfksgklntyrfcDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKtaqsfpsthenslliaspnyisgvagtsdKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVmagtktpsvlpsqpkivKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGaveierpqlqfkvKVDNSYEQLFepklkekpnaLKPLAILLEKYDAiesfchpyeyeldlyvpkedflkceepkqalplsdtplmmitePEQVTQLVSELKQQQEIAIDLEYhnyrsyqgytclmqistRDKDYIVDTLKLREDLEVLNevltdknivkvfHGADSDIKWLQKDFGLYVVGmfdthqackflpmprQSLAYLLKHycdvdsdktfqlfdwrhrplpepaiqyarTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSrnicklkyekpvfneegymnif
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGalpskvksrltfksgklNTFLFIVTKMSDTNQEIPKSDEANKELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMagtktpsvlpsqpkiVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFepklkekpnaLKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLnevltdknivkvFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSLDGMKKKQQQQVSPPHDSMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFedkmkigsnkyqkiklktsrfetpyqrflKSKEYAKAIQEKvdkenaeqkkidaltpqvktepeenvkitqepvvlkqikseekvemekeKRKKilrereeekeeqpamkkikvekpeesnektkrhkiksepkendsskgksggtistvdfskvnynkymakpdtkilpdPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNliakprkergkkdgetqvgndisniEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPyavpvpnltteqqkdRRKELAKKLVEmnakkreerlvdderhLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYnngedlteepkaklskeiavpeseaefKAWLietkkkrayiidkknarkqrrqdlAKRRTAAAQERMRLIselarkekrdddfgmrdedwdvYKVINkdagdtdseeEQERLIELEEILRQHDPeftslnqeqelsPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEffrvhpcsnnkvksrltfksgklntyrfcDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMagtktpsvlpsqpkiVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFepklkekpnaLKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLnevltdknivkvFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLStftnsrnicklkyekpvfneegymnif
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTKMSDTNQEIPKSDEANKELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSLDGMKKKQQQQVSPPHDSMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFLKSKEYAKAIQEKVDKENAEQKKIDALTPQVKTEPEENVKITQEPVVLKQIkseekvemekekrkkilrereeekeeQPAMKKIKVEKPEESNEKTKRHKIKSEPKENDsskgksggTISTVDFSKVNYNKYMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKKDGETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPNLTTEQQKDRRKELAKKLVEMNAKKREERLVDDerhlnellelreIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSeeeqerlieleeilrqHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
*****YRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTK********************TLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESIN***********************************WQ********SANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEE***********LMMI*****VTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQS*******************************CLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFL***********************************************************************************************************************TVDFSKVNYNKYMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIA*****************DISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPN**************************************LLELREIV****************************************AKIIAY*************************EFKAWLIETKKKRAYII**********************************************DWDVYKVI**********************************************LHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESIN***********************************WQ********SANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEE***********LMMI*****VTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEE******
****LYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKV***********************************************NAYKSIVKCTKTAQSFPSTHENSLLIASPNY**********VMTLVDSL*****************QKDILTEANDKLLESINTRIDVM***************************************************EIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAI*********SFCHPYEYELDLYVPKEDF**********PLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQG******P**QTVKEHVLDIHAIILKARLQSL***************************************************************IAQ********************************************************************************************************************************************************************YMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRK*******ETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLR**********NVVKVQLPYAVPV**************L********************RHLNELLE***********************INNIQDLNK*************************************************LIETK***********************************************FGMRDEDWDVYKVIN***********QERLIELEEILRQHDPEFT************ANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTF*S******RFCDNVWTFVL***********************************AYKSIVKCTKTAQSFPSTHENSLLIASP***************L*DSL******************KDILTEANDKLLESINTRIDVM***************************************************EIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAI*********SFCHPYEYELDLYVPKEDF**********PLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTKMSDTNQEIPKSDEANKELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSL****************SMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFLKSKEYAKAIQEKVDKENAEQKKIDALTPQVKTEPEENVKITQEPVVLKQIKSEE*********KKILRE***********KKIKV*******************************TISTVDFSKVNYNKYMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPR**********QVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPNLT**********LAKKLVEMNAKKREERLVDDERHLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKK******************QERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDA*********ERLIELEEILRQHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
*SYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTKM***************ELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKE********************KSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSLDGMKKKQQQQVSPPHDSMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFLKSKEYAKAIQEKVD*********DALTPQ***********TQEPVVLK******************************************************************************************************LRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKKDGETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPNLTTEQQKDRRKELAKKLVEMNAKKREERLVDDERHLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSEEEQERLIELEEILRQHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWN*****************KSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYQLYRNTTLGNTLQESLDELIQYGTITPTLAMKVLLQFDKSINGALPSKVKSRLTFKSGKLNTFLFIVTKMSDTNQEIPKSDEANKELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRSHALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKPVEKLQPSLDGMKKKQQQQVSPPHDSMDCLNYKGLPPVFPNNIICAPSNTHLSSYDPQDKKIAQIGLFFEDKMKIGSNKYQKIKLKTSRFETPYQRFLKSKEYAKAIQEKVDKENAEQKKIDALTPQVKTEPEENVKITQEPVVLKQIKSEEKxxxxxxxxxxxxxxxxxxxxxxPAMKKIKVEKPEESNEKTKRHKIKSEPKENDSSKGKSGGTISTVDFSKVNYNKYMAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKKDGETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDYREHLRKWLDAEFYDSNVVKVQLPYAVPVPNLTxxxxxxxxxxxxxxxxxxxxxKREERLVDDERHLNELLELREIVELTPSDHSHAREAFKSMGINNxxxxxxxxxxxxxxxxxxxxxxxxxxxxEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSEEEQERLIELEEILRQHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSNNKVKSRLTFKSGKLNTYRFCDNVWTFVLTDVEFREVAEIARVNKLKIVACDELSKTLDVLVQNAYKSIVKCTKTAQSFPSTHENSLLIASPNYISGVAGTSDKVMTLVDSLLKTQNISKSMSKLYLEGQKDILTEANDKLLESINTRIDVMAGTKTPSVLPSQPKIVKESWNKNAKASNVWQEVHDNKKKSANWFMLNKGAVEIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1973 2.2.26 [Sep-21-2011]
Q17GZ9655 Actin-related protein 5 O N/A N/A 0.313 0.945 0.491 1e-176
Q9VEC3648 Actin-related protein 5 O yes N/A 0.306 0.933 0.405 1e-136
Q293V2651 Actin-related protein 5 O yes N/A 0.306 0.927 0.419 1e-129
Q01780885 Exosome component 10 OS=H yes N/A 0.258 0.577 0.417 1e-115
P56960887 Exosome component 10 OS=M yes N/A 0.258 0.576 0.409 1e-113
Q9Y7X8721 Actin-like protein arp5 O yes N/A 0.313 0.858 0.306 2e-92
Q5ZJA4611 Actin-related protein 5 O no N/A 0.184 0.595 0.428 1e-81
Q12149733 Exosome complex exonuclea yes N/A 0.178 0.481 0.424 7e-81
Q10146777 Exosome complex exonuclea no N/A 0.188 0.477 0.418 5e-77
P53946755 Actin-related protein 5 O no N/A 0.319 0.834 0.286 1e-76
>sp|Q17GZ9|ARP5_AEDAE Actin-related protein 5 OS=Aedes aegypti GN=Arp5 PE=3 SV=1 Back     alignment and function desciption
 Score =  622 bits (1603), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 317/645 (49%), Positives = 430/645 (66%), Gaps = 26/645 (4%)

Query: 849  DTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKK 908
            D K+ PD    Y D        IV DNG++ CR GWA  + P+L+FKN++AKPRK+R KK
Sbjct: 8    DIKVKPDIVCTYPDPTVPPDAAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPRKDRSKK 67

Query: 909  DGE------TQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNV 962
            D         Q+GNDI+NIEAVRFQL+TQFD+NVVTH  +QEQIFDY F  L IN +G V
Sbjct: 68   DTSEVVVPTVQIGNDITNIEAVRFQLRTQFDRNVVTHLHVQEQIFDYLFGRLGINADGCV 127

Query: 963  NHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGY 1022
             HP++LTE   NPNYSR LMSEL+FECY +P + Y +D L SY+ NG +  SG+I+SCGY
Sbjct: 128  PHPVLLTECVANPNYSRMLMSELMFECYGIPGIVYAVDGLLSYRMNGGQ-DSGLIVSCGY 186

Query: 1023 QCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYG 1082
            Q THVIPV+NG +   K +RI+LGGF++I+ + +LLQLKYP H+N+IT SR+E ++ +Y 
Sbjct: 187  QATHVIPVLNGRMVEDKVRRINLGGFNMINFMFRLLQLKYPVHVNAITLSRAETMIHNYC 246

Query: 1083 FVATDYREHLRKWLDAEFYDSNVVKVQLPY--AVPVPNLTTEQQKDRRKELAKKLVEMNA 1140
              A DY E LR W   EFY+ NV+K+QLPY   V  P LT EQ+ ++RKEL+++L E+N 
Sbjct: 247  SFAYDYTESLRNWALLEFYEQNVIKIQLPYNQNVSAPTLTAEQRLEKRKELSRRLAEINL 306

Query: 1141 KKREERLVDDERHLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKI 1200
            +KREE+L +D+  L  +L      E T  D  +         + N+ +  K I  L+++I
Sbjct: 307  RKREEKLAEDKVLLTRMLA----AEDTLDDEDNVGFTLHEFSVKNVDEYRKMIVTLRERI 362

Query: 1201 EKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQ 1260
             KT  K+    N +    +P+ K   ++  P      + W+IET++KR  I+DKK  RKQ
Sbjct: 363  AKTTQKM----NSQQTNNQPEEK-PLQLLQPPPNMTIEEWVIETRRKRDEILDKKQIRKQ 417

Query: 1261 RRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSEEEQE 1320
            R+QDLAKRRTAAAQERMR+IS LA+KEK  DDFGMRDEDWDVYK I+++ GD+DS+ E E
Sbjct: 418  RKQDLAKRRTAAAQERMRIISHLAKKEKGVDDFGMRDEDWDVYKSISRE-GDSDSDAENE 476

Query: 1321 RLIELEEILRQHDPEFTSLNQEQELSP---KEANQLHIGVERMCGPECLFQPSMLGSIQA 1377
            +LIE EEIL+QHD  F     E  ++P    E +QLHIGVER+  PE LFQPSM+G  +A
Sbjct: 477  KLIECEEILKQHDSTFV----EPVVAPGNIAEFHQLHIGVERIRVPEILFQPSMIGVQEA 532

Query: 1378 GISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLA 1437
            G++ T+++VL  +P+     L  N+ +TG    + GF ERL+++L    PFQS +++ +A
Sbjct: 533  GLTGTIDYVLKLFPKEDQVKLVGNVMLTGGCANIRGFKERLSRELQAILPFQSVYNLMVA 592

Query: 1438 ENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSN 1482
             +P LDAW GA QF+ S+ F    +T+  Y E GGE+F+ H  SN
Sbjct: 593  GSPSLDAWRGASQFANSQEFKQSLITRQLYDECGGEYFKEHTASN 637




Proposed core component of the chromatin remodeling Ino80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair.
Aedes aegypti (taxid: 7159)
>sp|Q9VEC3|ARP5_DROME Actin-related protein 5 OS=Drosophila melanogaster GN=Arp5 PE=1 SV=1 Back     alignment and function description
>sp|Q293V2|ARP5_DROPS Actin-related protein 5 OS=Drosophila pseudoobscura pseudoobscura GN=Arp5 PE=3 SV=2 Back     alignment and function description
>sp|Q01780|EXOSX_HUMAN Exosome component 10 OS=Homo sapiens GN=EXOSC10 PE=1 SV=2 Back     alignment and function description
>sp|P56960|EXOSX_MOUSE Exosome component 10 OS=Mus musculus GN=Exosc10 PE=1 SV=2 Back     alignment and function description
>sp|Q9Y7X8|ARP5_SCHPO Actin-like protein arp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp5 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZJA4|ARP5_CHICK Actin-related protein 5 OS=Gallus gallus GN=ACTR5 PE=2 SV=1 Back     alignment and function description
>sp|Q12149|RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP6 PE=1 SV=1 Back     alignment and function description
>sp|Q10146|RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp6 PE=3 SV=2 Back     alignment and function description
>sp|P53946|ARP5_YEAST Actin-related protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1973
193681033669 PREDICTED: actin-related protein 5-like 0.320 0.944 0.565 0.0
66546559674 PREDICTED: actin-related protein 5 [Apis 0.321 0.942 0.552 0.0
380013757674 PREDICTED: actin-related protein 5-like 0.321 0.942 0.552 0.0
340711120674 PREDICTED: actin-related protein 5-like 0.321 0.942 0.550 0.0
350405629674 PREDICTED: actin-related protein 5-like 0.321 0.942 0.552 0.0
332028059675 Actin-related protein 5 [Acromyrmex echi 0.320 0.937 0.560 0.0
307207670681 Actin-related protein 5 [Harpegnathos sa 0.321 0.932 0.556 0.0
383857110674 PREDICTED: actin-related protein 5-like 0.321 0.942 0.548 0.0
322791717644 hypothetical protein SINV_08926 [Solenop 0.307 0.942 0.567 0.0
242013807661 conserved hypothetical protein [Pediculu 0.319 0.953 0.530 0.0
>gi|193681033|ref|XP_001947910.1| PREDICTED: actin-related protein 5-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/640 (56%), Positives = 489/640 (76%), Gaps = 8/640 (1%)

Query: 849  DTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKK 908
            D K++PD YY+Y   LR+S  PIV DNG++ C+ GWA+   PNLIFKN++A+PRKERGKK
Sbjct: 10   DLKLVPDKYYDYSQTLRNSKTPIVIDNGSFTCKAGWATSSVPNLIFKNILARPRKERGKK 69

Query: 909  DGETQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVL 968
            DGET +GNDI+NIEAVRFQLK+QFD+NV+T +++QEQIFDY FSHL I++ G++NHPI++
Sbjct: 70   DGETLIGNDIANIEAVRFQLKSQFDRNVITQFNVQEQIFDYTFSHLGIDSNGSINHPIII 129

Query: 969  TEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGYQCTHVI 1028
            TEP  NPNYSR LMSELLFECY VP +CYGID LFSYQ+NG  G++G++++CG+  TH+I
Sbjct: 130  TEPVANPNYSRLLMSELLFECYHVPGICYGIDGLFSYQHNGHNGKTGLVVNCGHHTTHII 189

Query: 1029 PVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYGFVATDY 1088
            PVING  D   ++RID+GG+ + ++LHKLLQLKYP+H N+ITPSR+EELL+++GF+A  Y
Sbjct: 190  PVINGTPDLINSRRIDVGGYHITYYLHKLLQLKYPAHYNAITPSRAEELLYEHGFLAVHY 249

Query: 1089 REHLRKWLDAEFYDSNVVKVQLPYAVPVPNLTTEQQKDRRKELAKKLVEMNAKKREERLV 1148
             + L++W D E+YD NV ++QLPY++ V  LT +QQ+D+R+E+AKKLVEMNA+KR+E+L 
Sbjct: 250  TDALKQWSDPEYYDHNVKRIQLPYSMAVL-LTPDQQRDKRREMAKKLVEMNARKRDEKLA 308

Query: 1149 DDERHLNELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKII 1208
            +DE  L++LL +RE++E         RE  +S G+ N +DL K I  LQ +I++ K+KI 
Sbjct: 309  EDEEQLHQLLMIREMIE-DGEPIEEVREVLRSHGLKNEKDLRKLITDLQTRIDRAKSKIA 367

Query: 1209 AY-----NNGEDLTEEPKAKLSK-EIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQRR 1262
            A      N  E +TEEPK +L K +I +P+ E+  K WL +  KKR  IIDKK  RKQRR
Sbjct: 368  AASLSASNVDEHVTEEPKLRLFKNKIQLPKEESISKTWLKDIYKKRQDIIDKKTVRKQRR 427

Query: 1263 QDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSEEEQERL 1322
            QD+AKR TAA+ ERMRLIS+LARK+KRDDDFG RDEDWDVYKVINK+ GDTDSEEEQE++
Sbjct: 428  QDMAKRGTAASLERMRLISQLARKDKRDDDFGSRDEDWDVYKVINKEGGDTDSEEEQEKI 487

Query: 1323 IELEEILRQHDPEFTSLNQEQELSPKEANQLHIGVERMCGPECLFQPSMLGSIQAGISET 1382
             ELEE+LR +DP F S N  +E +PKEA+QLH G+ERM   E LFQPS++G  Q GI++T
Sbjct: 488  SELEEVLRFYDPTFVSSNNNEEQNPKEAHQLHFGIERMRCTEVLFQPSIIGCGQGGITDT 547

Query: 1383 LNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPEL 1442
            + F+L  Y    A  +A N+F+TG   +LP F +R+ ++L E RP +S+ +V L+++P L
Sbjct: 548  IEFILKKYNDQTANDIAENVFLTGGPTKLPDFKQRVYRELREMRPLESNINVKLSDSPFL 607

Query: 1443 DAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSN 1482
            DAWSGAR+F+  ++FH + +T   Y E GG++F  + CSN
Sbjct: 608  DAWSGAREFANKQDFHKYLLTPEMYAEMGGDYFIENSCSN 647




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|66546559|ref|XP_623919.1| PREDICTED: actin-related protein 5 [Apis mellifera] Back     alignment and taxonomy information
>gi|380013757|ref|XP_003690915.1| PREDICTED: actin-related protein 5-like [Apis florea] Back     alignment and taxonomy information
>gi|340711120|ref|XP_003394128.1| PREDICTED: actin-related protein 5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350405629|ref|XP_003487499.1| PREDICTED: actin-related protein 5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332028059|gb|EGI68110.1| Actin-related protein 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307207670|gb|EFN85307.1| Actin-related protein 5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383857110|ref|XP_003704049.1| PREDICTED: actin-related protein 5-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322791717|gb|EFZ15993.1| hypothetical protein SINV_08926 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242013807|ref|XP_002427592.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512007|gb|EEB14854.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1973
UNIPROTKB|Q17GZ9655 Arp5 "Actin-related protein 5" 0.313 0.945 0.472 1.3e-153
FB|FBgn0038269900 Rrp6 "Rrp6" [Drosophila melano 0.341 0.747 0.374 1.8e-121
UNIPROTKB|Q293V2651 Arp5 "Actin-related protein 5" 0.285 0.866 0.405 3e-119
UNIPROTKB|E1C525910 EXOSC10 "Uncharacterized prote 0.180 0.391 0.494 9e-112
UNIPROTKB|F1PI20908 EXOSC10 "Uncharacterized prote 0.187 0.406 0.485 1.2e-111
UNIPROTKB|Q01780885 EXOSC10 "Exosome component 10" 0.167 0.374 0.515 1.2e-111
FB|FBgn0038576648 Arp5 "Actin-related protein 5" 0.288 0.878 0.394 3.5e-111
UNIPROTKB|F1RHR9886 EXOSC10 "Uncharacterized prote 0.280 0.624 0.365 3.5e-110
RGD|2323986859 LOC100366273 "rCG30986-like" [ 0.251 0.577 0.397 1.5e-109
UNIPROTKB|E1BMZ5890 EXOSC10 "Uncharacterized prote 0.178 0.396 0.494 1.6e-109
UNIPROTKB|Q17GZ9 Arp5 "Actin-related protein 5" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
 Score = 1498 (532.4 bits), Expect = 1.3e-153, P = 1.3e-153
 Identities = 305/645 (47%), Positives = 413/645 (64%)

Query:   849 DTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKK 908
             D K+ PD    Y D        IV DNG++ CR GWA  + P+L+FKN++AKPRK+R KK
Sbjct:     8 DIKVKPDIVCTYPDPTVPPDAAIVIDNGSYHCRAGWAGKDVPSLVFKNVLAKPRKDRSKK 67

Query:   909 DGE------TQVGNDISNIEAVRFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNV 962
             D         Q+GNDI+NIEAVRFQL+TQFD+NVVTH  +QEQIFDY F  L IN +G V
Sbjct:    68 DTSEVVVPTVQIGNDITNIEAVRFQLRTQFDRNVVTHLHVQEQIFDYLFGRLGINADGCV 127

Query:   963 NHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFSYQYNGWEGQSGVIISCGY 1022
              HP++LTE   NPNYSR LMSEL+FECY +P + Y +D L SY+ NG +  SG+I+SCGY
Sbjct:   128 PHPVLLTECVANPNYSRMLMSELMFECYGIPGIVYAVDGLLSYRMNGGQ-DSGLIVSCGY 186

Query:  1023 QCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYG 1082
             Q THVIPV+NG +   K +RI+LGGF++I+ + +LLQLKYP H+N+IT SR+E ++ +Y 
Sbjct:   187 QATHVIPVLNGRMVEDKVRRINLGGFNMINFMFRLLQLKYPVHVNAITLSRAETMIHNYC 246

Query:  1083 FVATDYREHLRKWLDAEFYDSNVVKVQLPYA--VPVPNLTTEQQKDRRKELAKKLVEMNA 1140
               A DY E LR W   EFY+ NV+K+QLPY   V  P LT EQ+ ++RKEL+++L E+N 
Sbjct:   247 SFAYDYTESLRNWALLEFYEQNVIKIQLPYNQNVSAPTLTAEQRLEKRKELSRRLAEINL 306

Query:  1141 KKREERLVDDXXXXXXXXXXXXIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKI 1200
             +KREE+L +D              E T  D  +         + N+ +  K I  L+++I
Sbjct:   307 RKREEKLAEDKVLLTRMLAA----EDTLDDEDNVGFTLHEFSVKNVDEYRKMIVTLRERI 362

Query:  1201 EKTKAKIIAYNNGEDLTEEPKAKLSKEIAVPESEAEFKAWLIETKKKRAYIIDKKNARKQ 1260
              KT  K+    N +    +P+ K   ++  P      + W+IET++KR  I+DKK  RKQ
Sbjct:   363 AKTTQKM----NSQQTNNQPEEK-PLQLLQPPPNMTIEEWVIETRRKRDEILDKKQIRKQ 417

Query:  1261 RRQDLAKRRTAAAQERMRLISELARKEKRDDDFGMRDEDWDVYKVINKDAGDTDSXXXXX 1320
             R+QDLAKRRTAAAQERMR+IS LA+KEK  DDFGMRDEDWDVYK I+++ GD+DS     
Sbjct:   418 RKQDLAKRRTAAAQERMRIISHLAKKEKGVDDFGMRDEDWDVYKSISRE-GDSDSDAENE 476

Query:  1321 XXXXXXXXXXXHDPEFTSLNQEQELSP---KEANQLHIGVERMCGPECLFQPSMLGSIQA 1377
                        HD  F     E  ++P    E +QLHIGVER+  PE LFQPSM+G  +A
Sbjct:   477 KLIECEEILKQHDSTFV----EPVVAPGNIAEFHQLHIGVERIRVPEILFQPSMIGVQEA 532

Query:  1378 GISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLA 1437
             G++ T+++VL  +P+     L  N+ +TG    + GF ERL+++L    PFQS +++ +A
Sbjct:   533 GLTGTIDYVLKLFPKEDQVKLVGNVMLTGGCANIRGFKERLSRELQAILPFQSVYNLMVA 592

Query:  1438 ENPELDAWSGARQFSLSENFHDFAVTQSDYQEKGGEFFRVHPCSN 1482
              +P LDAW GA QF+ S+ F    +T+  Y E GGE+F+ H  SN
Sbjct:   593 GSPSLDAWRGASQFANSQEFKQSLITRQLYDECGGEYFKEHTASN 637




GO:0006338 "chromatin remodeling" evidence=ISS
GO:0006351 "transcription, DNA-dependent" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
FB|FBgn0038269 Rrp6 "Rrp6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q293V2 Arp5 "Actin-related protein 5" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|E1C525 EXOSC10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI20 EXOSC10 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q01780 EXOSC10 "Exosome component 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0038576 Arp5 "Actin-related protein 5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHR9 EXOSC10 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|2323986 LOC100366273 "rCG30986-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BMZ5 EXOSC10 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.13LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1973
cd06147192 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease d 1e-103
cd06147192 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease d 1e-103
COG0349361 COG0349, Rnd, Ribonuclease D [Translation, ribosom 2e-54
cd06142178 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domai 1e-51
cd06142178 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domai 1e-51
pfam01612172 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease 1e-49
pfam01612172 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease 1e-49
cd06129161 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease doma 2e-43
cd06129161 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease doma 2e-43
COG0349 361 COG0349, Rnd, Ribonuclease D [Translation, ribosom 5e-41
smart00474172 smart00474, 35EXOc, 3'-5' exonuclease 3e-37
smart00474172 smart00474, 35EXOc, 3'-5' exonuclease 3e-37
COG5277444 COG5277, COG5277, Actin and related proteins [Cyto 2e-35
smart00268373 smart00268, ACTIN, Actin 1e-32
TIGR01388367 TIGR01388, rnd, ribonuclease D 4e-30
pfam00022367 pfam00022, Actin, Actin 3e-24
PTZ00004378 PTZ00004, PTZ00004, actin-2; Provisional 4e-22
pfam0226849 pfam02268, TFIIA_gamma_N, Transcription initiation 5e-22
cd1014549 cd10145, TFIIA_gamma_N, Gamma subunit of transcrip 5e-21
pfam0275151 pfam02751, TFIIA_gamma_C, Transcription initiation 1e-20
TIGR01388 367 TIGR01388, rnd, ribonuclease D 4e-20
PTZ00466380 PTZ00466, PTZ00466, actin-like protein; Provisiona 4e-19
PTZ00281376 PTZ00281, PTZ00281, actin; Provisional 4e-19
cd1001447 cd10014, TFIIA_gamma_C, Gamma subunit of transcrip 2e-18
smart00268373 smart00268, ACTIN, Actin 1e-17
pfam00022367 pfam00022, Actin, Actin 5e-17
PRK10829373 PRK10829, PRK10829, ribonuclease D; Provisional 5e-17
cd06148197 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease dom 3e-15
cd06148197 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease dom 3e-15
COG5123113 COG5123, TOA2, Transcription initiation factor IIA 2e-14
cd06141170 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain o 2e-14
cd06141170 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain o 2e-14
pfam0057068 pfam00570, HRDC, HRDC domain 3e-14
cd06146193 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease d 3e-14
cd06146193 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease d 3e-14
COG5277444 COG5277, COG5277, Actin and related proteins [Cyto 4e-14
smart0034181 smart00341, HRDC, Helicase and RNase D C-terminal 6e-14
PTZ00452375 PTZ00452, PTZ00452, actin; Provisional 2e-12
PTZ00280414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 5e-12
PRK10829 373 PRK10829, PRK10829, ribonuclease D; Provisional 6e-12
cd09018150 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' e 2e-09
cd09018150 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' e 2e-09
PTZ00004378 PTZ00004, PTZ00004, actin-2; Provisional 3e-09
PTZ00281376 PTZ00281, PTZ00281, actin; Provisional 3e-09
COG5123113 COG5123, TOA2, Transcription initiation factor IIA 2e-08
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 5e-06
PTZ00466380 PTZ00466, PTZ00466, actin-like protein; Provisiona 7e-05
PTZ00452375 PTZ00452, PTZ00452, actin; Provisional 1e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
PRK05755880 PRK05755, PRK05755, DNA polymerase I; Provisional 3e-04
PRK05755 880 PRK05755, PRK05755, DNA polymerase I; Provisional 3e-04
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
PTZ00280414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.002
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.002
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 0.003
>gnl|CDD|99850 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
 Score =  328 bits (844), Expect = e-103
 Identities = 118/192 (61%), Positives = 149/192 (77%), Gaps = 1/192 (0%)

Query: 317 SDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTL 376
            +TPL  +   E++ +LV +LK  +EIA+DLE+H+YRSY G+TCLMQISTR++DYIVDTL
Sbjct: 1   DETPLTFVDTEEKLEELVEKLKNCKEIAVDLEHHSYRSYLGFTCLMQISTREEDYIVDTL 60

Query: 377 KLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSL 436
           KLR+D+ +LNEV TD NI+KVFHGADSDI WLQ+DFGLYVV +FDT QA + L +PR SL
Sbjct: 61  KLRDDMHILNEVFTDPNILKVFHGADSDIIWLQRDFGLYVVNLFDTGQAARVLNLPRHSL 120

Query: 437 AYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDL-SAAAHGK 495
           AYLL+ YC+VD+DK +QL DWR RPLPE  I+YAR DTHYLLY+YD ++ +L   A    
Sbjct: 121 AYLLQKYCNVDADKKYQLADWRIRPLPEEMIKYAREDTHYLLYIYDRLRNELLERANALA 180

Query: 496 QNLVLSTFTNSR 507
            NL+ S    SR
Sbjct: 181 PNLLESVLNCSR 192


Yeast Rrp6p and its human homolog, the polymyositis/scleroderma autoantigen 100kDa (PM/Scl-100), are exosome-associated proteins involved in the degradation and processing of precursors to stable RNAs. Both proteins contain a DEDDy-type DnaQ-like 3'-5' exonuclease domain possessing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. The motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. PM/Scl-100, an autoantigen present in the nucleolar compartment of the cell, reacts with autoantibodies produced by about 50% of patients with polymyositis-scleroderma overlap syndrome. Length = 192

>gnl|CDD|99850 cd06147, Rrp6p_like_exo, DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>gnl|CDD|223426 COG0349, Rnd, Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|176654 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>gnl|CDD|176654 cd06142, RNaseD_exo, DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>gnl|CDD|216604 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|216604 pfam01612, DNA_pol_A_exo1, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|176650 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|176650 cd06129, RNaseD_like, DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|223426 COG0349, Rnd, Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|214681 smart00474, 35EXOc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|214681 smart00474, 35EXOc, 3'-5' exonuclease Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|130455 TIGR01388, rnd, ribonuclease D Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|145428 pfam02268, TFIIA_gamma_N, Transcription initiation factor IIA, gamma subunit, helical domain Back     alignment and domain information
>gnl|CDD|199901 cd10145, TFIIA_gamma_N, Gamma subunit of transcription initiation factor IIA, N-terminal helical domain Back     alignment and domain information
>gnl|CDD|190407 pfam02751, TFIIA_gamma_C, Transcription initiation factor IIA, gamma subunit Back     alignment and domain information
>gnl|CDD|130455 TIGR01388, rnd, ribonuclease D Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information
>gnl|CDD|199900 cd10014, TFIIA_gamma_C, Gamma subunit of transcription initiation factor IIA, C-terminal domain Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|236771 PRK10829, PRK10829, ribonuclease D; Provisional Back     alignment and domain information
>gnl|CDD|99851 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>gnl|CDD|99851 cd06148, Egl_like_exo, DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>gnl|CDD|227452 COG5123, TOA2, Transcription initiation factor IIA, gamma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|176653 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>gnl|CDD|176653 cd06141, WRN_exo, DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>gnl|CDD|201312 pfam00570, HRDC, HRDC domain Back     alignment and domain information
>gnl|CDD|176655 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>gnl|CDD|176655 cd06146, mut-7_like_exo, DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|128635 smart00341, HRDC, Helicase and RNase D C-terminal Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|236771 PRK10829, PRK10829, ribonuclease D; Provisional Back     alignment and domain information
>gnl|CDD|176656 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|176656 cd09018, DEDDy_polA_RNaseD_like_exo, DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information
>gnl|CDD|227452 COG5123, TOA2, Transcription initiation factor IIA, gamma subunit [Transcription] Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235591 PRK05755, PRK05755, DNA polymerase I; Provisional Back     alignment and domain information
>gnl|CDD|235591 PRK05755, PRK05755, DNA polymerase I; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1973
KOG0681|consensus645 100.0
KOG2206|consensus687 100.0
PTZ00452375 actin; Provisional 100.0
PTZ00466380 actin-like protein; Provisional 100.0
KOG0676|consensus372 100.0
PTZ00281376 actin; Provisional 100.0
PTZ00004378 actin-2; Provisional 100.0
PTZ00280414 Actin-related protein 3; Provisional 100.0
KOG0679|consensus426 100.0
KOG0677|consensus389 100.0
PF00022393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 100.0
smart00268373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 100.0
KOG0680|consensus400 100.0
cd00012371 ACTIN Actin; An ubiquitous protein involved in the 100.0
KOG2206|consensus 687 100.0
COG5277444 Actin and related proteins [Cytoskeleton] 100.0
PRK10829373 ribonuclease D; Provisional 100.0
COG0349361 Rnd Ribonuclease D [Translation, ribosomal structu 100.0
KOG0678|consensus415 100.0
TIGR01388367 rnd ribonuclease D. This model describes ribonucle 100.0
KOG0797|consensus618 100.0
KOG3463|consensus109 99.96
PRK13930335 rod shape-determining protein MreB; Provisional 99.95
PRK10829 373 ribonuclease D; Provisional 99.95
cd06129161 RNaseD_like DEDDy 3'-5' exonuclease domain of RNas 99.94
PRK13927334 rod shape-determining protein MreB; Provisional 99.94
cd06146193 mut-7_like_exo DEDDy 3'-5' exonuclease domain of C 99.94
COG0349 361 Rnd Ribonuclease D [Translation, ribosomal structu 99.94
cd06129161 RNaseD_like DEDDy 3'-5' exonuclease domain of RNas 99.93
TIGR00904333 mreB cell shape determining protein, MreB/Mrl fami 99.92
cd06146193 mut-7_like_exo DEDDy 3'-5' exonuclease domain of C 99.92
cd06148197 Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro 99.92
cd06141170 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and 99.91
PRK13929335 rod-share determining protein MreBH; Provisional 99.91
COG5123113 TOA2 Transcription initiation factor IIA, gamma su 99.91
TIGR01388 367 rnd ribonuclease D. This model describes ribonucle 99.9
PF01612176 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00 99.9
cd06141170 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and 99.89
cd06148197 Egl_like_exo DEDDy 3'-5' exonuclease domain of Dro 99.89
PF01612176 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR00 99.88
PRK13928336 rod shape-determining protein Mbl; Provisional 99.85
PF06723326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.84
KOG3463|consensus109 99.84
PF0275152 TFIIA_gamma_C: Transcription initiation factor IIA 99.81
PF0226849 TFIIA_gamma_N: Transcription initiation factor IIA 99.79
cd06142178 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon 99.75
cd06147192 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y 99.73
cd06142178 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribon 99.73
cd06147192 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of y 99.72
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo 99.69
smart00474172 35EXOc 3'-5' exonuclease. 3\' -5' exonuclease proo 99.67
PF0806691 PMC2NT: PMC2NT (NUC016) domain; InterPro: IPR01258 99.6
COG1077342 MreB Actin-like ATPase involved in cell morphogene 99.59
PRK05755880 DNA polymerase I; Provisional 99.58
PF0806691 PMC2NT: PMC2NT (NUC016) domain; InterPro: IPR01258 99.55
cd06140178 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' 99.53
cd09018150 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease 99.5
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is res 99.5
PRK14975553 bifunctional 3'-5' exonuclease/DNA polymerase; Pro 99.5
COG5123113 TOA2 Transcription initiation factor IIA, gamma su 99.5
cd06140178 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' 99.48
cd00007155 35EXOc 3'-5' exonuclease. The 35EXOc domain is res 99.47
cd09018150 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease 99.46
PRK05755 880 DNA polymerase I; Provisional 99.45
cd06139193 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease 99.35
cd06139193 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease 99.31
TIGR02529239 EutJ ethanolamine utilization protein EutJ family 99.28
KOG2207|consensus617 99.25
PRK14975 553 bifunctional 3'-5' exonuclease/DNA polymerase; Pro 99.24
PRK15080267 ethanolamine utilization protein EutJ; Provisional 99.14
PF0057068 HRDC: HRDC domain Bloom syndrome. Werner syndrome. 99.13
KOG2207|consensus617 99.12
smart0034181 HRDC Helicase and RNase D C-terminal. Hypothetical 99.12
COG0749593 PolA DNA polymerase I - 3'-5' exonuclease and poly 99.08
COG0749 593 PolA DNA polymerase I - 3'-5' exonuclease and poly 99.07
TIGR00593 887 pola DNA polymerase I. This family is based on the 99.02
TIGR00593887 pola DNA polymerase I. This family is based on the 98.97
CHL00094621 dnaK heat shock protein 70 98.73
PTZ00400663 DnaK-type molecular chaperone; Provisional 98.73
TIGR02350595 prok_dnaK chaperone protein DnaK. Members of this 98.64
PLN03184673 chloroplast Hsp70; Provisional 98.63
cd06128151 DNA_polA_exo DEDDy 3'-5' exonuclease domain of fam 98.61
TIGR01991599 HscA Fe-S protein assembly chaperone HscA. The Hea 98.6
PTZ00009653 heat shock 70 kDa protein; Provisional 98.59
PRK00290627 dnaK molecular chaperone DnaK; Provisional 98.59
PRK01433595 hscA chaperone protein HscA; Provisional 98.57
PTZ00186657 heat shock 70 kDa precursor protein; Provisional 98.56
PRK13411653 molecular chaperone DnaK; Provisional 98.55
PRK05183616 hscA chaperone protein HscA; Provisional 98.54
TIGR01174371 ftsA cell division protein FtsA. This bacterial ce 98.54
PRK13410668 molecular chaperone DnaK; Provisional 98.53
PF0275152 TFIIA_gamma_C: Transcription initiation factor IIA 98.48
cd06128151 DNA_polA_exo DEDDy 3'-5' exonuclease domain of fam 98.48
PRK09472420 ftsA cell division protein FtsA; Reviewed 98.43
PRK11678450 putative chaperone; Provisional 98.4
PF00012602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 98.33
COG0849418 ftsA Cell division ATPase FtsA [Cell division and 98.04
TIGR01175348 pilM type IV pilus assembly protein PilM. This pro 97.93
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.72
PF11104340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 97.65
KOG4373|consensus319 97.57
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 97.48
KOG4373|consensus319 97.47
TIGR03739320 PRTRC_D PRTRC system protein D. A novel genetic sy 97.07
COG0443579 DnaK Molecular chaperone [Posttranslational modifi 96.98
cd0612596 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonucleas 96.79
PRK10719475 eutA reactivating factor for ethanolamine ammonia 96.33
PRK08517257 DNA polymerase III subunit epsilon; Provisional 96.25
KOG0104|consensus902 96.21
PRK13917344 plasmid segregation protein ParM; Provisional 96.18
PRK06310250 DNA polymerase III subunit epsilon; Validated 96.11
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 96.09
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 95.95
PRK06310250 DNA polymerase III subunit epsilon; Validated 95.91
cd06144152 REX4_like DEDDh 3'-5' exonuclease domain of RNA ex 95.79
PRK06063313 DNA polymerase III subunit epsilon; Provisional 95.75
PRK06807313 DNA polymerase III subunit epsilon; Validated 95.68
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 95.63
PRK08517257 DNA polymerase III subunit epsilon; Provisional 95.62
PRK07740244 hypothetical protein; Provisional 95.61
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 95.54
PRK07942232 DNA polymerase III subunit epsilon; Provisional 95.52
PRK07942232 DNA polymerase III subunit epsilon; Provisional 95.4
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 95.38
cd06137161 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the 95.33
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 95.31
PRK06807 313 DNA polymerase III subunit epsilon; Validated 95.25
cd06149157 ISG20 DEDDh 3'-5' exonuclease domain of Interferon 95.1
PF06406318 StbA: StbA protein; InterPro: IPR009440 This entry 95.1
cd06145150 REX1_like DEDDh 3'-5' exonuclease domain of RNA ex 95.09
PRK06063313 DNA polymerase III subunit epsilon; Provisional 95.05
PLN031371195 ATP-dependent DNA helicase; Q4-like; Provisional 94.95
PRK07740244 hypothetical protein; Provisional 94.93
cd06143174 PAN2_exo DEDDh 3'-5' exonuclease domain of the euk 94.93
TIGR01405 1213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 94.92
KOG2249|consensus280 94.8
TIGR014051213 polC_Gram_pos DNA polymerase III, alpha chain, Gra 94.75
PRK07883557 hypothetical protein; Validated 94.73
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 94.57
PF06277473 EutA: Ethanolamine utilisation protein EutA; Inter 94.53
PRK05601377 DNA polymerase III subunit epsilon; Validated 94.46
KOG2249|consensus280 94.42
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 94.38
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 94.33
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 94.27
cd06131167 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonucl 94.14
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-posit 94.11
PRK05168211 ribonuclease T; Provisional 93.96
COG4972354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 93.91
PRK06309232 DNA polymerase III subunit epsilon; Validated 93.8
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 93.8
PRK07883 557 hypothetical protein; Validated 93.77
PRK09145202 DNA polymerase III subunit epsilon; Validated 93.76
TIGR01406225 dnaQ_proteo DNA polymerase III, epsilon subunit, P 93.73
TIGR00573217 dnaq exonuclease, DNA polymerase III, epsilon subu 93.7
KOG2405|consensus458 93.63
PRK09145202 DNA polymerase III subunit epsilon; Validated 93.63
COG4820277 EutJ Ethanolamine utilization protein, possible ch 93.62
PRK05711240 DNA polymerase III subunit epsilon; Provisional 93.59
PRK05711240 DNA polymerase III subunit epsilon; Provisional 93.51
TIGR01298200 RNaseT ribonuclease T. in gamma-subdivision Proteo 93.49
COG21761444 PolC DNA polymerase III, alpha subunit (gram-posit 93.49
cd05160199 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain 93.26
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 93.03
PRK06309232 DNA polymerase III subunit epsilon; Validated 93.03
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 92.98
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 92.91
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 92.89
cd05780195 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom 92.86
PRK09146239 DNA polymerase III subunit epsilon; Validated 92.84
PRK05168211 ribonuclease T; Provisional 92.49
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 92.42
PRK05601377 DNA polymerase III subunit epsilon; Validated 92.38
cd06134189 RNaseT DEDDh 3'-5' exonuclease domain of RNase T. 92.37
PF13482164 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 92.3
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 92.14
cd06143174 PAN2_exo DEDDh 3'-5' exonuclease domain of the euk 92.13
PRK09146239 DNA polymerase III subunit epsilon; Validated 91.88
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 91.65
cd06127159 DEDDh DEDDh 3'-5' exonuclease domain family. DEDDh 91.54
KOG2405|consensus458 91.38
smart00479169 EXOIII exonuclease domain in DNA-polymerase alpha 91.36
cd05780195 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease dom 91.25
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 91.14
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 90.68
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 90.6
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 90.55
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 90.18
cd06136177 TREX1_2 DEDDh 3'-5' exonuclease domain of three pr 89.09
PRK06195309 DNA polymerase III subunit epsilon; Validated 88.82
cd06130156 DNA_pol_III_epsilon_like an uncharacterized bacter 88.66
PRK09182294 DNA polymerase III subunit epsilon; Validated 88.53
TIGR03706300 exo_poly_only exopolyphosphatase. It appears that 88.12
PRK10854513 exopolyphosphatase; Provisional 87.47
PRK004481437 polC DNA polymerase III PolC; Validated 87.37
PRK07247195 DNA polymerase III subunit epsilon; Validated 87.02
PRK06195 309 DNA polymerase III subunit epsilon; Validated 86.98
PRK11031496 guanosine pentaphosphate phosphohydrolase; Provisi 86.39
PRK00448 1437 polC DNA polymerase III PolC; Validated 85.53
PRK07247195 DNA polymerase III subunit epsilon; Validated 85.48
cd05785207 DNA_polB_like2_exo Uncharacterized bacterial subgr 85.11
PF09281138 Taq-exonuc: Taq polymerase, exonuclease; InterPro: 85.03
KOG0103|consensus727 84.68
PRK09182294 DNA polymerase III subunit epsilon; Validated 83.68
KOG0101|consensus620 83.45
PRK11779476 sbcB exonuclease I; Provisional 83.26
cd05785207 DNA_polB_like2_exo Uncharacterized bacterial subgr 82.53
>KOG0681|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-89  Score=811.59  Aligned_cols=615  Identities=38%  Similarity=0.643  Sum_probs=498.1

Q ss_pred             cCCCCCCCCCCCccccccccCCCCceEEEEcCcceEEEEEeCCCCccEEEecceeeccCCCCCccccceecccccccccc
Q psy15183        845 MAKPDTKILPDPYYEYLDELRDSSLPIVFDNGAWCCRVGWASCEKPNLIFKNLIAKPRKERGKKDGETQVGNDISNIEAV  924 (1973)
Q Consensus       845 ~~~~~~~~~p~~~~~~~~~~~~~~~~IVID~GS~~iKaG~Age~~P~~i~Pn~vgr~~~~~~~~~~~~~vGdea~~~~~~  924 (1973)
                      ..+.|....|+|+- + .++. ...||||||||+.|||||+|+..|+++|+|++.|+++.... ....+||+++......
T Consensus         3 ~~~r~p~a~p~p~~-~-q~~~-n~~piVIDNGS~~~RaGw~ge~eP~lvFrNvl~r~Rdrk~~-~s~t~vgnd~~~~~~~   78 (645)
T KOG0681|consen    3 LELRDPRAFPDPNR-E-QSYS-NTIPIVIDNGSYECRAGWAGEKEPRLVFRNVLTRPRDRKLG-ASVTLVGNDILNFQGV   78 (645)
T ss_pred             eeccCccccCCchh-h-hccc-CCCcEEEeCCceeEeecccCCCCccchhhhhhccccccccc-cccccccchhhhhhhh
Confidence            34445445566663 0 1122 26799999999999999999999999999999999966522 2245999999998888


Q ss_pred             ccEEeecccCCcccCHHHHHHHHHHHHhhcCcCCCCCCCCcEEEEeCCCCcHHHHHHHHHHHHHhcCCCeEeechhhHHh
Q psy15183        925 RFQLKTQFDKNVVTHYDIQEQIFDYAFSHLSINTEGNVNHPIVLTEPFLNPNYSRSLMSELLFECYQVPSVCYGIDSLFS 1004 (1973)
Q Consensus       925 ~~~l~~Pi~~G~V~dwd~le~i~~~if~~L~i~~~~~~~~pVlltEp~~~p~~~Re~l~ElLFE~~~vpav~~~~~sllS 1004 (1973)
                      +...++||++.+|+||+.+|+|+||+|.+||++..+ ++|||||||+.+||..+|+.|+|+|||+||||+|.++.++++|
T Consensus        79 Rs~~rSPFd~nVvtNwel~E~ilDY~F~~LG~~~~~-idhPIilTE~laNP~~~R~~m~elLFE~YgvP~V~yGIDslfS  157 (645)
T KOG0681|consen   79 RSSPRSPFDRNVVTNWELMEQILDYIFGKLGVDGQG-IDHPIILTEALANPVYSRSEMVELLFETYGVPKVAYGIDSLFS  157 (645)
T ss_pred             hccCCCCCcCCccccHHHHHHHHHHHHHhcCCCccC-CCCCeeeehhccChHHHHHHHHHHHHHHcCCcceeechhhHHH
Confidence            888999999999999999999999999999999986 8999999999999999999999999999999999999999999


Q ss_pred             hhhcCC--CCceEEEEeeCCCceEEEEeecCEEccCCcEEeeccHHHHHHHHHHHHhhhCCCCCCCCCHHHHHHHHHHhe
Q psy15183       1005 YQYNGW--EGQSGVIISCGYQCTHVIPVINGCIDASKAKRIDLGGFSVIHHLHKLLQLKYPSHINSITPSRSEELLWDYG 1082 (1973)
Q Consensus      1005 ~ya~G~--g~~tgLVVDiG~s~T~V~PV~dG~vl~~si~rl~vGG~~lt~~L~~lL~~k~~~~~~~~~~~~~e~iKe~~c 1082 (1973)
                      +|.+-.  ++.+|+||++||++|||+||.||..+...++|+|+||.+++.||.+||+.+||.|.+.+++..++.+++.||
T Consensus       158 ~~hN~~~~~~~~~liis~g~~~T~vipvldG~~il~~~kRiN~GG~qa~dYL~~Lmq~Kyp~~~~~~t~sk~E~l~~eHc  237 (645)
T KOG0681|consen  158 FYHNYGKSSNKSGLIISMGHSATHVIPVLDGRLILKDVKRINWGGYQAGDYLSRLMQLKYPFHLNAFTGSKAERLLHEHC  237 (645)
T ss_pred             HhhccCcccCcceEEEecCCCcceeEEEecCchhhhcceeeccCcchHHHHHHHHHhccCccchhhcCHHHHHHHhhhhc
Confidence            996422  135799999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eccccHHHHHHhhhccccccccceecccCcc-CCCCCcchHHHHHHHHHHHHHHHHHHHHhhhhhhhhhH------HHHH
Q psy15183       1083 FVATDYREHLRKWLDAEFYDSNVVKVQLPYA-VPVPNLTTEQQKDRRKELAKKLVEMNAKKREERLVDDE------RHLN 1155 (1973)
Q Consensus      1083 ~va~dy~~el~~~~~~~~~~~~~~~iqlP~~-~~~~~~~~e~~~~~r~~~~~rL~e~~~~~r~e~l~~~e------~~l~ 1155 (1973)
                      ||++||.+++..|...+.++++.+++|+||. ++.++ +....+++|++  +||+++++-+|.+++.+.+      ++|.
T Consensus       238 yis~DY~eei~~~l~~d~~d~~~~~~qlP~~evl~~~-e~~l~Ae~kqe--kRlq~~a~lkrv~k~~~re~~redeqql~  314 (645)
T KOG0681|consen  238 YISPDYREEIIKILEMDYYDENRNYFQLPYTEVLAEV-ELALTAEKKQE--KRLQEQAALKRVEKINARENRREDEQQLE  314 (645)
T ss_pred             eeCcchHHHHHHHhhhhhhhccceEEecccccccchh-hhhccHHHHHH--HHHHHHHHHhhHHHHHHHHhhhhhHHHHH
Confidence            9999999999999999999999999999999 33332 12235556665  7888888888887776663      3333


Q ss_pred             HHHHHHHHhhcCCCCchhhHHHhhhcCCcchhhhhHHHHHHHHHHHHHHHhHhhcCCCCCCCchhhhhhhhcc--cCcch
Q psy15183       1156 ELLELREIVELTPSDHSHAREAFKSMGINNIQDLNKSINQLQQKIEKTKAKIIAYNNGEDLTEEPKAKLSKEI--AVPES 1233 (1973)
Q Consensus      1156 ~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~el~~~i~~~~~~i~k~~~~~~~~~~~~~l~~~~~ek~~~~~--~~p~~ 1233 (1973)
                      .+..++...++.   .. +...+.-....++-+.       .+-..+.++++...+.+.+|-+-+ ||...|+  +.-++
T Consensus       315 ~~~kaq~e~e~~---~D-~~q~~~ll~v~~eL~~-------d~lk~k~~qr~lkas~dar~rar~-eke~Er~~k~~~~r  382 (645)
T KOG0681|consen  315 SYNKAQGEQESN---LD-LEQKFPLLNVPAELDE-------DQLKEKKKQRILKASTDARLRARV-EKELERLNKLEEER  382 (645)
T ss_pred             HHHHhhhchhcC---cc-HhhhchhhcchhhhCH-------HHHHHHHHHHHHHhhhhhhccccc-cchHHHhhcccccc
Confidence            332222111111   00 1111111111111111       111122222222222222222111 1111111  11223


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHhhh--------ccCCCCCCCCCcchhhhhh
Q psy15183       1234 EAEFKAWLIETKKKRAYIIDKKNARKQRRQDLAKRRTAAAQERMRLISELARK--------EKRDDDFGMRDEDWDVYKV 1305 (1973)
Q Consensus      1234 ~~~~~~~~~~~r~~r~~i~~k~~~r~~~~~~~~~r~s~a~q~r~~~i~~~~~~--------~~~~d~f~lpd~dw~vy~~ 1305 (1973)
                      ..++..|++++|.++..++++++++++++.++++|+|.++|.||+.++.++.+        ...+|.||+.|+||++|.+
T Consensus       383 ~~~~~swl~e~r~k~~~ller~~~kk~lk~e~~~r~s~~Sq~rmr~~~~La~~~~~rrk~~~~t~D~fg~~Dedw~vYe~  462 (645)
T KOG0681|consen  383 EENLISWLEELREKLEKLLERISQKKRLKQELKDRKSHASQLRMRALARLAYEQVVRRKRKEATPDNFGARDEDWDVYED  462 (645)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhhhHhhhHHHHhhhHHHHHHHhcccCCccccccchhhHHHHHH
Confidence            47799999999999999999999999999999999999999999999999887        2348889999999999965


Q ss_pred             hccCCCCCChHHHHHHHHHHHHHHhhCCCCcccccccc--------ccCCCCCcEEEecceeeecccccCCCCCcCcccc
Q psy15183       1306 INKDAGDTDSEEEQERLIELEEILRQHDPEFTSLNQEQ--------ELSPKEANQLHIGVERMCGPECLFQPSMLGSIQA 1377 (1973)
Q Consensus      1306 i~~d~~~~d~e~e~~~l~~le~~l~~~dp~~~~~~~~~--------~~~~~dg~~i~l~~ER~~~pEiLF~Ps~ig~~~~ 1377 (1973)
                      +     +.+.+.+.+.+..++..|.++||.|+......        +.-+.+.+++++|+||+++|||+|+|+++|.+|+
T Consensus       463 l-----ee~~~~~~~dl~~l~~~L~e~Dp~F~~~~~~~~d~~~~~~p~~~~e~~qlh~nVEriRvPEIiFqPsiiG~dQa  537 (645)
T KOG0681|consen  463 L-----EEENKSILEDLKSLNHELLEFDPHFTQYVEGTTDPRNGVLPGFTAEDYQLHLNVERIRVPEIIFQPSIIGIDQA  537 (645)
T ss_pred             h-----hhhhhhHHHHHHHHHHHHHhhCcccccccccccCcccCcchhHHHhhhhhhhcceeeccceeeeccccccchhh
Confidence            4     22233445788899999999999999974221        1124778899999999999999999999999999


Q ss_pred             cHHHHHHHHHhcCCHHHHHHhhcCEEEECCCCCcccHHHHHHHHHhhcCCCCCceEEEecCCCcccceeccccccccccc
Q psy15183       1378 GISETLNFVLNSYPQHIAQSLANNIFVTGSLCQLPGFVERLNKDLLENRPFQSHFSVSLAENPELDAWSGARQFSLSENF 1457 (1973)
Q Consensus      1378 gL~e~I~~sI~~~~~d~r~~L~~NIvLTGG~S~ipGf~eRL~~EL~~l~p~~~~i~V~~~~dp~~~aW~GaSilasl~sf 1457 (1973)
                      ||.|++..++.+.|.+.+..|.+||+||||+|++||+.+||..||+++.|.++.|+|+.+.||..+||+||+.||....|
T Consensus       538 Gl~Ei~~~il~r~p~~eq~~lV~nVllTGG~s~~pGmkeRi~kElt~mrP~gS~i~V~rasdP~LDAW~GA~~~a~n~~f  617 (645)
T KOG0681|consen  538 GLAEIMDTILRRYPHDEQEKLVSNVLLTGGCSQLPGMKERIKKELTSMRPVGSSINVVRASDPVLDAWRGASAWAANPTF  617 (645)
T ss_pred             hHHHHHHHHHHhCchhhhHhhhhheEeecccccCcCHHHHHHHHhheecccCCceEEEecCCcchhhhhhhHHhhcCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccceeHHHHhhcCCceeecccCCCCc
Q psy15183       1458 HDFAVTQSDYQEKGGEFFRVHPCSNNK 1484 (1973)
Q Consensus      1458 ~~~~ITreeY~E~G~~il~rk~~~n~~ 1484 (1973)
                      ...||||+||+|.|+.+++.++++|..
T Consensus       618 ~~~~~Tr~dy~E~G~e~~kEh~~~n~~  644 (645)
T KOG0681|consen  618 TLTQITRKDYEEKGEEYLKEHVASNIY  644 (645)
T ss_pred             chhhhhHHhhhhhhHHHHHHHhhcccc
Confidence            999999999999999999999988754



>KOG2206|consensus Back     alignment and domain information
>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>PTZ00281 actin; Provisional Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>KOG2206|consensus Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>KOG3463|consensus Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK10829 ribonuclease D; Provisional Back     alignment and domain information
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>COG0349 Rnd Ribonuclease D [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd06129 RNaseD_like DEDDy 3'-5' exonuclease domain of RNase D, WRN, and similar proteins Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>cd06146 mut-7_like_exo DEDDy 3'-5' exonuclease domain of Caenorhabditis elegans mut-7 and similar proteins Back     alignment and domain information
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>COG5123 TOA2 Transcription initiation factor IIA, gamma subunit [Transcription] Back     alignment and domain information
>TIGR01388 rnd ribonuclease D Back     alignment and domain information
>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides Back     alignment and domain information
>cd06141 WRN_exo DEDDy 3'-5' exonuclease domain of WRN and similar proteins Back     alignment and domain information
>cd06148 Egl_like_exo DEDDy 3'-5' exonuclease domain of Drosophila Egalitarian (Egl) and similar proteins Back     alignment and domain information
>PF01612 DNA_pol_A_exo1: 3'-5' exonuclease; InterPro: IPR002562 This domain is responsible for the 3'-5' exonuclease proofreading activity of Escherichia coli DNA polymerase I (polI) and other enzymes, it catalyses the hydrolysis of unpaired or mismatched nucleotides Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>KOG3463|consensus Back     alignment and domain information
>PF02751 TFIIA_gamma_C: Transcription initiation factor IIA, gamma subunit; InterPro: IPR015871 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site Back     alignment and domain information
>PF02268 TFIIA_gamma_N: Transcription initiation factor IIA, gamma subunit, helical domain; InterPro: IPR015872 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site Back     alignment and domain information
>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>cd06142 RNaseD_exo DEDDy 3'-5' exonuclease domain of Ribonuclease D and similar proteins Back     alignment and domain information
>cd06147 Rrp6p_like_exo DEDDy 3'-5' exonuclease domain of yeast Rrp6p, human polymyositis/scleroderma autoantigen 100kDa, and similar proteins Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>smart00474 35EXOc 3'-5' exonuclease Back     alignment and domain information
>PF08066 PMC2NT: PMC2NT (NUC016) domain; InterPro: IPR012588 Exosomes are nano-compartments that function in the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA) [, ] Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>PF08066 PMC2NT: PMC2NT (NUC016) domain; InterPro: IPR012588 Exosomes are nano-compartments that function in the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA) [, ] Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases Back     alignment and domain information
>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>PRK14975 bifunctional 3'-5' exonuclease/DNA polymerase; Provisional Back     alignment and domain information
>COG5123 TOA2 Transcription initiation factor IIA, gamma subunit [Transcription] Back     alignment and domain information
>cd06140 DNA_polA_I_Bacillus_like_exo inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases Back     alignment and domain information
>cd00007 35EXOc 3'-5' exonuclease Back     alignment and domain information
>cd09018 DEDDy_polA_RNaseD_like_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases, RNase D, WRN, and similar proteins Back     alignment and domain information
>PRK05755 DNA polymerase I; Provisional Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>cd06139 DNA_polA_I_Ecoli_like_exo DEDDy 3'-5' exonuclease domain of Escherichia coli DNA polymerase I and similar bacterial family-A DNA polymerases Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>KOG2207|consensus Back     alignment and domain information
>PRK14975 bifunctional 3'-5' exonuclease/DNA polymerase; Provisional Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>PF00570 HRDC: HRDC domain Bloom syndrome Back     alignment and domain information
>KOG2207|consensus Back     alignment and domain information
>smart00341 HRDC Helicase and RNase D C-terminal Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0749 PolA DNA polymerase I - 3'-5' exonuclease and polymerase domains [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>TIGR00593 pola DNA polymerase I Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>cd06128 DNA_polA_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PF02751 TFIIA_gamma_C: Transcription initiation factor IIA, gamma subunit; InterPro: IPR015871 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site Back     alignment and domain information
>cd06128 DNA_polA_exo DEDDy 3'-5' exonuclease domain of family-A DNA polymerases Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>KOG4373|consensus Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>KOG4373|consensus Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06125 DnaQ_like_exo DnaQ-like (or DEDD) 3'-5' exonuclease domain superfamily Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK06310 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06144 REX4_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 4, XPMC2, Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>PRK08517 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK07942 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>cd06137 DEDDh_RNase DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonucleases PAN2, RNA exonuclease (REX)-1,-3, and -4, ISG20, and similar proteins Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>PRK06807 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06149 ISG20 DEDDh 3'-5' exonuclease domain of Interferon Stimulated Gene product of 20 kDa, and similar proteins Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>cd06145 REX1_like DEDDh 3'-5' exonuclease domain of RNA exonuclease 1, -3 and similar eukaryotic proteins Back     alignment and domain information
>PRK06063 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK07740 hypothetical protein; Provisional Back     alignment and domain information
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2 Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>KOG2249|consensus Back     alignment and domain information
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG2249|consensus Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd06131 DNA_pol_III_epsilon_Ecoli_like DEDDh 3'-5' exonuclease domain of the epsilon subunit of Escherichia coli DNA polymerase III and similar proteins Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07883 hypothetical protein; Validated Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR01406 dnaQ_proteo DNA polymerase III, epsilon subunit, Proteobacterial Back     alignment and domain information
>TIGR00573 dnaq exonuclease, DNA polymerase III, epsilon subunit family Back     alignment and domain information
>KOG2405|consensus Back     alignment and domain information
>PRK09145 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>PRK05711 DNA polymerase III subunit epsilon; Provisional Back     alignment and domain information
>TIGR01298 RNaseT ribonuclease T Back     alignment and domain information
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd05160 DEDDy_DNA_polB_exo DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>PRK06309 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK05168 ribonuclease T; Provisional Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>PRK05601 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06134 RNaseT DEDDh 3'-5' exonuclease domain of RNase T Back     alignment and domain information
>PF13482 RNase_H_2: RNase_H superfamily; PDB: 1TKD_A 1TK5_A 2AJQ_F 1T8E_A 1T7P_A 1SKR_A 1X9W_A 1TK8_A 1TK0_A 1SL2_A Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>cd06143 PAN2_exo DEDDh 3'-5' exonuclease domain of the eukaryotic exoribonuclease PAN2 Back     alignment and domain information
>PRK09146 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>cd06127 DEDDh DEDDh 3'-5' exonuclease domain family Back     alignment and domain information
>KOG2405|consensus Back     alignment and domain information
>smart00479 EXOIII exonuclease domain in DNA-polymerase alpha and epsilon chain, ribonuclease T and other exonucleases Back     alignment and domain information
>cd05780 DNA_polB_Kod1_like_exo DEDDy 3'-5' exonuclease domain of Pyrococcus kodakaraensis Kod1 and similar archaeal family-B DNA polymerases Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06136 TREX1_2 DEDDh 3'-5' exonuclease domain of three prime repair exonuclease (TREX)1, TREX2, and similar proteins Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd06130 DNA_pol_III_epsilon_like an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK06195 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>PRK00448 polC DNA polymerase III PolC; Validated Back     alignment and domain information
>PRK07247 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information
>PF09281 Taq-exonuc: Taq polymerase, exonuclease; InterPro: IPR015361 This domain is found in prokaryotic Taq DNA polymerase (thermostable), where it assumes a ribonuclease H-like motif Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>PRK09182 DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>PRK11779 sbcB exonuclease I; Provisional Back     alignment and domain information
>cd05785 DNA_polB_like2_exo Uncharacterized bacterial subgroup of the DEDDy 3'-5' exonuclease domain of family-B DNA polymerases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1973
3saf_A428 Crystal Structure Of The Human Rrp6 Catalytic Domai 1e-104
3saf_A 428 Crystal Structure Of The Human Rrp6 Catalytic Domai 1e-77
3sah_A428 Crystal Structure Of The Human Rrp6 Catalytic Domai 1e-104
3sah_A 428 Crystal Structure Of The Human Rrp6 Catalytic Domai 3e-77
2hbj_A410 Structure Of The Yeast Nuclear Exosome Component, R 5e-80
2hbj_A 410 Structure Of The Yeast Nuclear Exosome Component, R 3e-68
2cpr_A124 Solution Structure Of The Hrdc Domain Of Human Exos 9e-24
3b63_C365 Actin Filament Model In The Extended Form Of Acroms 3e-20
3b63_C365 Actin Filament Model In The Extended Form Of Acroms 2e-08
3a5m_C375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 4e-20
3a5m_C375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 2e-09
1yag_A375 Structure Of The Yeast Actin-human Gelsolin Segment 4e-20
1yag_A375 Structure Of The Yeast Actin-human Gelsolin Segment 2e-08
1d4x_A375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 4e-20
1d4x_A375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 2e-07
3b63_A365 Actin Filament Model In The Extended Form Of Acroms 5e-20
3b63_A365 Actin Filament Model In The Extended Form Of Acroms 2e-08
3a5l_C375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 5e-20
3a5l_C375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 1e-09
2oan_A375 Structure Of Oxidized Beta-Actin Length = 375 6e-20
2oan_A375 Structure Of Oxidized Beta-Actin Length = 375 2e-07
4efh_A375 Acanthamoeba Actin Complex With Spir Domain D Lengt 6e-20
4efh_A375 Acanthamoeba Actin Complex With Spir Domain D Lengt 3e-09
1yvn_A375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 7e-20
1yvn_A375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 2e-08
3u4l_A375 Cryocooled Bovine Profilin:actin Crystal Structure 7e-20
3u4l_A375 Cryocooled Bovine Profilin:actin Crystal Structure 2e-07
3b63_L365 Actin Filament Model In The Extended Form Of Acroms 8e-20
3b63_L365 Actin Filament Model In The Extended Form Of Acroms 2e-07
2btf_A375 The Structure Of Crystalline Profilin-Beta-Actin Le 9e-20
2btf_A375 The Structure Of Crystalline Profilin-Beta-Actin Le 2e-07
3byh_A374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 1e-19
3byh_A374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 2e-07
1dej_A375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 1e-19
1dej_A375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 8e-10
1c0g_A375 Crystal Structure Of 1:1 Complex Between Gelsolin S 1e-19
1c0g_A375 Crystal Structure Of 1:1 Complex Between Gelsolin S 1e-09
3w3d_A374 Crystal Structure Of Smooth Muscle G Actin Dnase I 2e-19
3w3d_A374 Crystal Structure Of Smooth Muscle G Actin Dnase I 4e-07
3ci5_A375 Complex Of Phosphorylated Dictyostelium Discoideum 2e-19
3ci5_A375 Complex Of Phosphorylated Dictyostelium Discoideum 1e-09
1nlv_A375 Crystal Structure Of Dictyostelium Discoideum Actin 2e-19
1nlv_A375 Crystal Structure Of Dictyostelium Discoideum Actin 1e-09
2hf3_A374 Crystal Structure Of Monomeric Actin In The Adp Bou 2e-19
2hf3_A374 Crystal Structure Of Monomeric Actin In The Adp Bou 4e-08
3chw_A375 Complex Of Dictyostelium Discoideum Actin With Prof 3e-19
3chw_A375 Complex Of Dictyostelium Discoideum Actin With Prof 1e-09
3eks_A375 Crystal Structure Of Monomeric Actin Bound To Cytoc 3e-19
3eks_A375 Crystal Structure Of Monomeric Actin Bound To Cytoc 4e-08
1c0f_A368 Crystal Structure Of Dictyostelium Caatp-Actin In C 3e-19
1c0f_A368 Crystal Structure Of Dictyostelium Caatp-Actin In C 1e-09
1atn_A373 Atomic Structure Of The Actin:dnase I Complex Lengt 5e-19
1atn_A373 Atomic Structure Of The Actin:dnase I Complex Lengt 1e-07
2w49_D372 Isometrically Contracting Insect Asynchronous Fligh 5e-19
2w49_D372 Isometrically Contracting Insect Asynchronous Fligh 1e-07
3m6g_A371 Crystal Structure Of Actin In Complex With Lobophor 5e-19
3m6g_A371 Crystal Structure Of Actin In Complex With Lobophor 1e-07
3g37_O376 Cryo-Em Structure Of Actin Filament In The Presence 6e-19
3g37_O376 Cryo-Em Structure Of Actin Filament In The Presence 1e-07
1qz5_A375 Structure Of Rabbit Actin In Complex With Kabiramid 6e-19
1qz5_A375 Structure Of Rabbit Actin In Complex With Kabiramid 1e-07
1kxp_A375 Crystal Structure Of Human Vitamin D-binding Protei 7e-19
1kxp_A375 Crystal Structure Of Human Vitamin D-binding Protei 1e-07
1eqy_A377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 9e-19
1eqy_A377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 1e-07
4b1v_A376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 1e-18
4b1v_A376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 1e-07
1ijj_A377 The X-Ray Crystal Structure Of The Complex Between 1e-18
1ijj_A377 The X-Ray Crystal Structure Of The Complex Between 1e-07
3b63_E365 Actin Filament Model In The Extended Form Of Acroms 2e-18
3b63_E365 Actin Filament Model In The Extended Form Of Acroms 1e-07
2gwj_A371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 3e-18
2gwj_A371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 1e-07
1t44_A370 Structural Basis Of Actin Sequestration By Thymosin 3e-18
1t44_A370 Structural Basis Of Actin Sequestration By Thymosin 1e-07
1nvp_D108 Human TfiiaTBPDNA COMPLEX Length = 108 4e-18
1nvp_D108 Human TfiiaTBPDNA COMPLEX Length = 108 3e-14
1lcu_A371 Polylysine Induces An Antiparallel Actin Dimer That 5e-18
1lcu_A371 Polylysine Induces An Antiparallel Actin Dimer That 1e-07
2p9k_B394 Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta 1e-17
1k8k_B394 Crystal Structure Of Arp23 COMPLEX Length = 394 2e-17
3b63_D357 Actin Filament Model In The Extended Form Of Acroms 4e-17
3b63_D357 Actin Filament Model In The Extended Form Of Acroms 6e-07
3b63_B364 Actin Filament Model In The Extended Form Of Acroms 4e-17
3b63_B364 Actin Filament Model In The Extended Form Of Acroms 1e-07
3b63_F357 Actin Filament Model In The Extended Form Of Acroms 5e-17
3b63_F357 Actin Filament Model In The Extended Form Of Acroms 2e-06
3mn5_A359 Structures Of Actin-Bound Wh2 Domains Of Spire And 5e-16
3mn5_A359 Structures Of Actin-Bound Wh2 Domains Of Spire And 1e-07
1yt3_A375 Crystal Structure Of Escherichia Coli Rnase D, An E 4e-14
1yt3_A 375 Crystal Structure Of Escherichia Coli Rnase D, An E 2e-09
3dwl_A427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 3e-10
3dwl_A427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 1e-04
1k8k_A418 Crystal Structure Of Arp23 COMPLEX Length = 418 1e-09
1k8k_A418 Crystal Structure Of Arp23 COMPLEX Length = 418 1e-04
1rm1_B122 Structure Of A Yeast TfiiaTBPTATA-Box Dna Complex L 2e-08
1ytf_D121 Yeast TfiiaTBPDNA COMPLEX Length = 121 2e-08
3qb0_A498 Crystal Structure Of Actin-Related Protein Arp4 Fro 4e-06
3cym_A440 Crystal Structure Of Protein Bad_0989 From Bifidoba 3e-05
>pdb|3SAF|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With D313n Mutation In The Active Site Length = 428 Back     alignment and structure

Iteration: 1

Score = 377 bits (969), Expect = e-104, Method: Compositional matrix adjust. Identities = 194/405 (47%), Positives = 266/405 (65%), Gaps = 31/405 (7%) Query: 241 IERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEK-------------------Y 281 I RPQL+F+ K+DNS F PK+ KPNA KPL L K Sbjct: 2 IIRPQLKFREKIDNS-NTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALA 60 Query: 282 DAI----------ESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVT 331 D I + F HPY+YEL+ + P + L+ +P+ P+ +TP I+ +++ Sbjct: 61 DFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELV 120 Query: 332 QLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTD 391 +L +L QE A++LE+H+YRS+ G TCLMQISTR +D+I+DTL+LR D+ +LNE LTD Sbjct: 121 ELNEKLLNCQEFAVNLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTD 180 Query: 392 KNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKT 451 IVKVFHGADSDI+WLQKDFGLYVV MFDTHQA + L + R SL +LLK YC+VDS+K Sbjct: 181 PAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQ 240 Query: 452 FQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICK 511 +QL DWR RPLPE + YAR DTHYLLY+YD M+L++ +G+ + + SR+IC Sbjct: 241 YQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICL 300 Query: 512 LKYEKPVFNEEGYMNIFRSH-ALLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLL 570 K+ KP+F +E Y+ ++R LN QQ A + L+ WRD+ AR +DES GYVLPNHM+L Sbjct: 301 KKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMML 360 Query: 571 QMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTK 615 ++A+ +P++ QGI ACCNPVP V++ + ++H +I +AR L K Sbjct: 361 KIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLK 405
>pdb|3SAF|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With D313n Mutation In The Active Site Length = 428 Back     alignment and structure
>pdb|3SAH|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With Y436a Mutation In The Catalytic Site Length = 428 Back     alignment and structure
>pdb|3SAH|A Chain A, Crystal Structure Of The Human Rrp6 Catalytic Domain With Y436a Mutation In The Catalytic Site Length = 428 Back     alignment and structure
>pdb|2HBJ|A Chain A, Structure Of The Yeast Nuclear Exosome Component, Rrp6p, Reveals An Interplay Between The Active Site And The Hrdc Domain Length = 410 Back     alignment and structure
>pdb|2HBJ|A Chain A, Structure Of The Yeast Nuclear Exosome Component, Rrp6p, Reveals An Interplay Between The Active Site And The Hrdc Domain Length = 410 Back     alignment and structure
>pdb|2CPR|A Chain A, Solution Structure Of The Hrdc Domain Of Human Exosome Component 10 Length = 124 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|1NVP|D Chain D, Human TfiiaTBPDNA COMPLEX Length = 108 Back     alignment and structure
>pdb|1NVP|D Chain D, Human TfiiaTBPDNA COMPLEX Length = 108 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 Back     alignment and structure
>pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|1YT3|A Chain A, Crystal Structure Of Escherichia Coli Rnase D, An Exoribonuclease Involved In Structured Rna Processing Length = 375 Back     alignment and structure
>pdb|1YT3|A Chain A, Crystal Structure Of Escherichia Coli Rnase D, An Exoribonuclease Involved In Structured Rna Processing Length = 375 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|1RM1|B Chain B, Structure Of A Yeast TfiiaTBPTATA-Box Dna Complex Length = 122 Back     alignment and structure
>pdb|1YTF|D Chain D, Yeast TfiiaTBPDNA COMPLEX Length = 121 Back     alignment and structure
>pdb|3QB0|A Chain A, Crystal Structure Of Actin-Related Protein Arp4 From S. Cerevisiae Complexed With Atp Length = 498 Back     alignment and structure
>pdb|3CYM|A Chain A, Crystal Structure Of Protein Bad_0989 From Bifidobacterium Adolescentis Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1973
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 1e-135
3saf_A 428 Exosome component 10; exoribonuclease, RNA exosome 1e-103
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 1e-135
2hbj_A 410 Exosome complex exonuclease RRP6; RNA metabolism, 1e-104
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 3e-85
1yt3_A 375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 3e-60
3cym_A440 Uncharacterized protein BAD_0989; structural genom 6e-85
3cym_A 440 Uncharacterized protein BAD_0989; structural genom 6e-60
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 3e-34
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 3e-34
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 4e-34
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 1e-15
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 5e-32
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 9e-14
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 9e-31
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 5e-14
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 3e-29
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 1e-13
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 4e-29
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 9e-14
1nvp_D108 Transcription initiation factor IIA gamma chain; t 1e-25
1nvp_D108 Transcription initiation factor IIA gamma chain; t 5e-18
1nh2_D121 Transcription initiation factor IIA small chain; t 4e-24
1nh2_D121 Transcription initiation factor IIA small chain; t 5e-14
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-13
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 7e-11
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 7e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 6e-04
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Length = 428 Back     alignment and structure
 Score =  429 bits (1105), Expect = e-135
 Identities = 191/406 (47%), Positives = 264/406 (65%), Gaps = 31/406 (7%)

Query: 241 IERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILL---------------------- 278
           I RPQL+F+ K+DNS    F PK+  KPNA KPL   L                      
Sbjct: 2   IIRPQLKFREKIDNS-NTPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALA 60

Query: 279 -------EKYDAIESFCHPYEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVT 331
                   +    + F HPY+YEL+ + P +  L+  +P+   P+ +TP   I+  +++ 
Sbjct: 61  DFIHQQRTQQVEQDMFAHPYQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELV 120

Query: 332 QLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTD 391
           +L  +L   QE A++LE+H+YRS+ G TCLMQISTR +D+I+DTL+LR D+ +LNE LTD
Sbjct: 121 ELNEKLLNCQEFAVNLEHHSYRSFLGLTCLMQISTRTEDFIIDTLELRSDMYILNESLTD 180

Query: 392 KNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKT 451
             IVKVFHGADSDI+WLQKDFGLYVV MFDTHQA + L + R SL +LLK YC+VDS+K 
Sbjct: 181 PAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNKQ 240

Query: 452 FQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICK 511
           +QL DWR RPLPE  + YAR DTHYLLY+YD M+L++    +G+   +   +  SR+IC 
Sbjct: 241 YQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICL 300

Query: 512 LKYEKPVFNEEGYMNIFRSHAL-LNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLL 570
            K+ KP+F +E Y+ ++R     LN QQ  A + L+ WRD+ AR +DES GYVLPNHM+L
Sbjct: 301 KKFIKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMML 360

Query: 571 QMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKARLQSLTKP 616
           ++A+ +P++ QGI ACCNPVP  V++ + ++H +I +AR   L K 
Sbjct: 361 KIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKS 406


>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Length = 428 Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Length = 410 Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Length = 410 Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Length = 375 Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Length = 375 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 440 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Length = 440 Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Length = 208 Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Length = 208 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>1nvp_D Transcription initiation factor IIA gamma chain; transcription regulation, DNA, complex, transcription/DNA complex; 2.10A {Homo sapiens} SCOP: a.32.1.1 b.56.1.1 Length = 108 Back     alignment and structure
>1nvp_D Transcription initiation factor IIA gamma chain; transcription regulation, DNA, complex, transcription/DNA complex; 2.10A {Homo sapiens} SCOP: a.32.1.1 b.56.1.1 Length = 108 Back     alignment and structure
>1nh2_D Transcription initiation factor IIA small chain; transcription/DNA; HET: 5IU; 1.90A {Saccharomyces cerevisiae} SCOP: a.32.1.1 b.56.1.1 PDB: 1ytf_D* 1rm1_B Length = 121 Back     alignment and structure
>1nh2_D Transcription initiation factor IIA small chain; transcription/DNA; HET: 5IU; 1.90A {Saccharomyces cerevisiae} SCOP: a.32.1.1 b.56.1.1 PDB: 1ytf_D* 1rm1_B Length = 121 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Length = 206 Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Length = 206 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1973
3saf_A428 Exosome component 10; exoribonuclease, RNA exosome 100.0
3dwl_A427 Actin-related protein 3; propellor, actin-binding, 100.0
3qb0_A498 Actin-related protein 4; actin fold, ATP binding, 100.0
2hbj_A410 Exosome complex exonuclease RRP6; RNA metabolism, 100.0
4fo0_A593 Actin-related protein 8; chromatin remodeling, nuc 100.0
2fxu_A375 Alpha-actin-1, actin, alpha skeletal muscle; actin 100.0
1k8k_B394 ARP2, actin-like protein 2; beta-propeller, struct 100.0
1k8k_A418 ARP3, actin-like protein 3, actin-2; beta-propelle 100.0
4am6_A655 Actin-like protein ARP8; nuclear protein, chromati 100.0
3saf_A 428 Exosome component 10; exoribonuclease, RNA exosome 100.0
2hbj_A 410 Exosome complex exonuclease RRP6; RNA metabolism, 100.0
1yt3_A375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 100.0
3cym_A440 Uncharacterized protein BAD_0989; structural genom 100.0
1nh2_D121 Transcription initiation factor IIA small chain; t 99.93
1nvp_D108 Transcription initiation factor IIA gamma chain; t 99.93
1jce_A344 ROD shape-determining protein MREB; MBL, actin, HS 99.93
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 99.9
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 99.89
1yt3_A 375 Ribonuclease D, RNAse D; exoribonuclease, exonucle 99.89
3cym_A 440 Uncharacterized protein BAD_0989; structural genom 99.88
2e6m_A208 Werner syndrome ATP-dependent helicase homolog; AP 99.87
1vk0_A206 Hypothetical protein; homohexamer, AT5G06450, stru 99.84
1nvp_D108 Transcription initiation factor IIA gamma chain; t 99.75
1nh2_D121 Transcription initiation factor IIA small chain; t 99.73
2kfn_A605 Klenow fragment of DNA polymerase I; complex (poly 99.65
3h1q_A272 Ethanolamine utilization protein EUTJ; ethanolamin 99.64
2kfn_A 605 Klenow fragment of DNA polymerase I; complex (poly 99.6
3pv8_A592 DNA polymerase I; DNA polymerase I, protein-DNA co 99.59
2v7y_A509 Chaperone protein DNAK; HSP70, heat shock protein, 99.58
3pv8_A 592 DNA polymerase I; DNA polymerase I, protein-DNA co 99.52
1dkg_D383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.52
3qfu_A394 78 kDa glucose-regulated protein homolog; HSP70, K 99.51
3i33_A404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.37
1x9m_A698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 99.27
1x9m_A 698 DNA polymerase; DNA ploymerase, N-2-acetylaminoflu 99.19
4dfk_A540 DNA polymerase I, thermostable; DNA polymerase, tr 99.1
1yuw_A554 Heat shock cognate 71 kDa protein; chaperone; 2.60 99.05
2kho_A605 Heat shock protein 70; molecular chaperone, HSP70, 99.0
1wud_A89 ATP-dependent DNA helicase RECQ; DNA-binding domai 98.99
4gni_A409 Putative heat shock protein; HSP70-type ATPase, AT 98.95
4dfk_A 540 DNA polymerase I, thermostable; DNA polymerase, tr 98.95
2rhf_A77 DNA helicase RECQ; HRDC, D. radiodurans, ATP-bindi 98.9
3d2f_A675 Heat shock protein homolog SSE1; nucleotide exchan 98.9
2ych_A377 Competence protein PILM; cell cycle, type IV pilus 98.86
2kv2_A85 Bloom syndrome protein; HRDC domain, disease mutat 98.77
2rrd_A101 BLM HRDC domain, HRDC domain from bloom syndrome p 98.76
4b9q_A605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 98.65
2fsj_A346 Hypothetical protein TA0583; actin homologs, archa 98.64
2dgz_A113 Werner syndrome protein variant; HRDC domain, stru 98.62
2e1f_A103 Werner syndrome ATP-dependent helicase; HRDC domai 98.62
4a2a_A419 Cell division protein FTSA, putative; cell cycle, 98.49
1bgx_T 832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 98.02
1bgx_T832 TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhi 98.01
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 97.97
3v9w_A235 Ribonuclease T; DEDD nucleases family, EXO-nucleas 97.92
3js6_A355 Uncharacterized PARM protein; partition, segregati 97.67
2zgy_A320 Plasmid segregation protein PARM; plasmid partitio 97.37
4apw_A329 ALP12; actin-like protein; 19.70A {Clostridium tet 97.32
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 96.6
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 96.39
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 96.26
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 96.17
2p1j_A186 POLIII, DNA polymerase III POLC-type; structural g 96.1
3mxm_B242 Three prime repair exonuclease 1; RNAse H-like fol 95.85
1wlj_A189 Interferon stimulated gene 20KDA; exoribonuclease, 95.64
2f96_A224 Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolas 95.62
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 95.31
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 95.04
3u3y_B314 Three prime repair exonuclease 1; RNAse H fold, 3' 94.88
1y97_A238 Three prime repair exonuclease 2; TREX2, hydrolase 94.86
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 93.67
2gui_A194 DNA polymerase III epsilon subunit; DNA polymerase 93.39
2d0o_A610 DIOL dehydratase-reactivating factor large subunit 92.03
1t6c_A315 Exopolyphosphatase; alpha/beta protein, actin-like 91.65
3cer_A343 Possible exopolyphosphatase-like protein; NESG, BL 91.48
1nbw_A607 Glycerol dehydratase reactivase alpha subunit; mol 90.42
2qxf_A482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 90.22
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 89.2
1zbh_A299 3'-5' exonuclease ERI1; histone mRNA 3'-END-specif 88.36
2qxf_A 482 Exodeoxyribonuclease I; alpha-beta domain, DNAQ su 88.18
1d8b_A81 SGS1 RECQ helicase; five helices, three-helical bu 87.54
1u6z_A513 Exopolyphosphatase; alpha/beta protein, askha (ace 87.3
3mdq_A315 Exopolyphosphatase; structural genomics, joint cen 86.56
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 85.8
3hi0_A508 Putative exopolyphosphatase; 17739545, structural 85.5
1w0h_A204 3'-5' exonuclease ERI1; nuclease domain, hydrolase 83.89
2xri_A224 ERI1 exoribonuclease 3; hydrolase, metal binding; 82.91
4ehu_A276 Activator of 2-hydroxyisocaproyl-COA dehydratase; 82.46
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 81.84
1zbu_A349 ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; 80.95
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
Probab=100.00  E-value=7.5e-67  Score=645.08  Aligned_cols=377  Identities=51%  Similarity=0.895  Sum_probs=356.8

Q ss_pred             CCCCcccccCcCCCCCCCCCCcccCCcCCCCCChhhHhhhhcc-----------------------------CCCCCCCC
Q psy15183        240 EIERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYD-----------------------------AIESFCHP  290 (1973)
Q Consensus       240 ~i~kPQ~~f~~~~dn~~~~pf~p~l~~Kp~a~~~l~~~~~~~~-----------------------------~~~~~~hP  290 (1973)
                      .|.|||++|+++||||+ +||+|+|++||||++||+.++....                             ....|+||
T Consensus         1 ~i~~pq~~f~~~~dn~~-~p~~p~~~~kp~a~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~hp   79 (428)
T 3saf_A            1 SIIRPQLKFREKIDNSN-TPFLPKIFIKPNAQKPLPQALSKERRERPQDRPEDLDVPPALADFIHQQRTQQVEQDMFAHP   79 (428)
T ss_dssp             CCCCGGGGCSSCCCCSS-SCCCCCCCCCTTCSSCCCGGGSGGGC-----------------------------CCSSSCT
T ss_pred             CCCCchhccCCCCCCCC-CCCCCccCCCCcccCCHHHHhhhhhhcccccCcccccccchhhhccccccccccCCCCCCCC
Confidence            48999999999999998 8999999999999999998765321                             24579999


Q ss_pred             cHHHhccCCCCccccccCCCCCCCCCCCCCcEEeCCHHHHHHHHHHHhcCCeEEEEeeeccCCccCCcEEEEEEEeCCce
Q psy15183        291 YEYELDLYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKD  370 (1973)
Q Consensus       291 y~~ei~~~~~~~~~~~~~~p~~~~p~~~~~~~~Idt~e~L~~ll~~L~~~~~IavDtE~~~~~s~~g~l~LIQIst~~~~  370 (1973)
                      |++||.+++||+++++..+|.++.|+++++|.+|+|.++|.++++.+..++.+|||+|+++.+++.+.+|+|||++.+++
T Consensus        80 y~~ei~~~~~~~~~~~~~~~~~~~p~~~~~y~~I~t~e~L~~~l~~L~~~~~vavDtE~~~~~~~~~~l~lIQLa~~~~~  159 (428)
T 3saf_A           80 YQYELNHFTPADAVLQKPQPQLYRPIEETPCHFISSLDELVELNEKLLNCQEFAVNLEHHSYRSFLGLTCLMQISTRTED  159 (428)
T ss_dssp             THHHHHTCCCCHHHHSCCCCCCCCCGGGSCEEEECSHHHHHHHHHHHTTCSEEEEEEEEECTTCSSCEEEEEEEECSSCE
T ss_pred             hHHHHhcCCCCHHHhCcCCCCCCCCCCCCCcEEECCHHHHHHHHHHHhcCCeEEEEEEecCCCCCCCeEEEEEEEeCCcE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEccCccccHHHHHHHHcCCCceeeecchhHhHHHHHHHhCCcccceeehhhhhhhcCCCCccHHHHHHHHcCCCCCc
Q psy15183        371 YIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDK  450 (1973)
Q Consensus       371 ~lID~l~l~~~l~~L~~lL~dp~I~KV~H~ak~Dl~~L~r~~Gi~~~nlFDT~lAA~lLg~~~~sLa~Lv~~ylgv~ldK  450 (1973)
                      |+||++.++..+..|+++|+|++|.||+||+++|+.+|++.+|+.+.++||||+|+|+||.+++||++|+++|||+.++|
T Consensus       160 ~lidpl~l~~~l~~L~~lL~dp~i~KV~H~~k~Dl~~L~~~~Gi~~~~~fDT~lAa~lL~~~~~gL~~Lv~~~Lg~~l~K  239 (428)
T 3saf_A          160 FIIDTLELRSDMYILNESLTDPAIVKVFHGADSDIEWLQKDFGLYVVNMFDTHQAARLLNLGRHSLDHLLKLYCNVDSNK  239 (428)
T ss_dssp             EEEETTTTGGGGGGGHHHHTCTTSEEEESSCHHHHHHHHHHHCCCCSSEEEHHHHHHHTTCSCCSHHHHHHHHHCCCCCC
T ss_pred             EEEEeccchhhHHHHHHHHcCCCceEEEeehHHHHHHHHHHcCCCcCceeechhHHHHhCCCCCCHHHHHHHHcCCCCCc
Confidence            99999998667789999999999999999999999999889999999999999999999988899999999999999999


Q ss_pred             ccccccCCCCCCCchhHhHHHHhHHHHHHHHHHHHHHHHHhcCCCcchhHHHHHHHHHHHHhhcCCCCCChHHHHHHHHh
Q psy15183        451 TFQLFDWRHRPLPEPAIQYARTDTHYLLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNEEGYMNIFRS  530 (1973)
Q Consensus       451 ~~q~sDW~~RPLs~eql~YAa~Da~~Ll~L~d~L~~~L~e~g~~~~~~l~~v~~e~e~~~~~~y~~~~~~~~~~~~~~~k  530 (1973)
                      +.+.+||+.|||+++|+.|||.||++++.||+.|..+|.+.|+...+|+.+++++++.+|.++|+++.++.+.|.+++++
T Consensus       240 ~~~~sdW~~rpLs~~q~~YAA~DA~~ll~L~~~L~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (428)
T 3saf_A          240 QYQLADWRIRPLPEEMLSYARDDTHYLLYIYDKMRLEMWERGNGQPVQLQVVWQRSRDICLKKFIKPIFTDESYLELYRK  319 (428)
T ss_dssp             TTTTSCTTCSSCCHHHHHHHHHHHHTHHHHHHHHHHHHHHHTTSCSHHHHHHHHHHHHHTTCCCCCCCCCTTGGGHHHHT
T ss_pred             cccccccccCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCccccHHHHHHHHHHHHHHHhhcCCCCCcccHHHHHHH
Confidence            99999999999999999999999999999999999999999875556999999999999999999888888899999988


Q ss_pred             hc-CCCHHHHHHHHHHHHHHHHHHHHhCCCCcccccchHHHHHHHhCCCCHHHHhhhcCCCchhHHHhHHHHHHHHHHHH
Q psy15183        531 HA-LLNNQQKYALRELYKWRDRIARDKDESTGYVLPNHMLLQMAQSIPRDIQGIFACCNPVPQTVKEHVLDIHAIILKAR  609 (1973)
Q Consensus       531 ~~-~l~~~ql~~l~~L~~WRd~~Ar~~D~s~~~Vl~d~~L~~lA~~~P~~~~~l~~~~~~~~~~vr~~~~~i~~iI~~a~  609 (1973)
                      .+ .++++|+++|++|++||+++||++|+|+++||+|+.|++||+.+|+|.++|.+++++.++.+|+|+++|+++|++|+
T Consensus       320 ~~~~l~~~~l~l~~~L~~wR~~~Ar~~d~p~~~V~~d~~L~~iA~~~P~~~~~L~~i~g~~~~~~r~~g~~~l~~I~~a~  399 (428)
T 3saf_A          320 QKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAR  399 (428)
T ss_dssp             TCCCCCHHHHHHHHHHHHHHHHHHHHHTCCHHHHCCHHHHHHHHHHCCSSHHHHHTTCSSCCHHHHHTHHHHHHHHHHHH
T ss_pred             hccCCChHHHHHHHHHHHHHHHHHHHcCCCcCEEECHHHHHHHHHHCCCCHHHHHhccCCCHHHHHHHHHHHHHHHHHHH
Confidence            76 89999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCc
Q psy15183        610 LQSLTKPV  617 (1973)
Q Consensus       610 ~~~~~~~~  617 (1973)
                      +.|...+.
T Consensus       400 ~~p~~~~~  407 (428)
T 3saf_A          400 EMPLLKSE  407 (428)
T ss_dssp             TSCCCHHH
T ss_pred             hCCCcCcc
Confidence            98887543



>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>3saf_A Exosome component 10; exoribonuclease, RNA exosome, hydrolase; 2.50A {Homo sapiens} PDB: 3sag_A 3sah_A 2cpr_A Back     alignment and structure
>2hbj_A Exosome complex exonuclease RRP6; RNA metabolism, RNA surveillance, RNA processing, hydrolase, gene regulation; 2.10A {Saccharomyces cerevisiae} SCOP: a.60.8.4 c.55.3.5 PDB: 2hbk_A 2hbl_A* 2hbm_A* Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>1nh2_D Transcription initiation factor IIA small chain; transcription/DNA; HET: 5IU; 1.90A {Saccharomyces cerevisiae} SCOP: a.32.1.1 b.56.1.1 PDB: 1ytf_D* 1rm1_B Back     alignment and structure
>1nvp_D Transcription initiation factor IIA gamma chain; transcription regulation, DNA, complex, transcription/DNA complex; 2.10A {Homo sapiens} SCOP: a.32.1.1 b.56.1.1 Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Back     alignment and structure
>1yt3_A Ribonuclease D, RNAse D; exoribonuclease, exonuclease, hydrolase, tRNA processing, hydrolase,translation; 1.60A {Escherichia coli} SCOP: a.60.8.3 a.60.8.3 c.55.3.5 Back     alignment and structure
>3cym_A Uncharacterized protein BAD_0989; structural genomics, unknown function; 2.10A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>2e6m_A Werner syndrome ATP-dependent helicase homolog; APO form, hydrolase; 2.00A {Mus musculus} PDB: 2e6l_A 2fby_A 2fbv_A 2fbx_A 2fbt_A 2fc0_A* Back     alignment and structure
>1vk0_A Hypothetical protein; homohexamer, AT5G06450, struc genomics, protein structure initiative, center for eukaryot structural genomics, CESG; 2.10A {Arabidopsis thaliana} SCOP: c.55.3.5 PDB: 2q3s_A Back     alignment and structure
>1nvp_D Transcription initiation factor IIA gamma chain; transcription regulation, DNA, complex, transcription/DNA complex; 2.10A {Homo sapiens} SCOP: a.32.1.1 b.56.1.1 Back     alignment and structure
>1nh2_D Transcription initiation factor IIA small chain; transcription/DNA; HET: 5IU; 1.90A {Saccharomyces cerevisiae} SCOP: a.32.1.1 b.56.1.1 PDB: 1ytf_D* 1rm1_B Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2kfn_A Klenow fragment of DNA polymerase I; complex (polymerase/DNA), exonuclease, transferase, transferase/DNA complex; HET: US1; 2.03A {Escherichia coli} SCOP: c.55.3.5 e.8.1.1 PDB: 1d9f_A* 1d9d_A* 1krp_A* 1ksp_A* 1qsl_A* 1kfs_A* 2kfz_A* 2kzm_A* 2kzz_A* 1dpi_A* 1kfd_A* 1kln_A* 1d8y_A* Back     alignment and structure
>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ... Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3pv8_A DNA polymerase I; DNA polymerase I, protein-DNA complex, thymine-adenine, CLOS conformation; HET: DNA 2DT D3T; 1.52A {Geobacillus kaustophilus} PDB: 3px0_A* 3px4_A* 3px6_A* 3thv_A* 3ti0_A* 4dse_A* 4dsf_A* 4ds4_A* 4dqp_A* 4dqi_A* 4ds5_A* 4e0d_A* 4dqr_A* 4dqq_A* 3tan_A* 3tap_A* 3taq_A* 3tar_A* 4dqs_A* 3hp6_A* ... Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure
>1x9m_A DNA polymerase; DNA ploymerase, N-2-acetylaminofluorene, replication block, mutagenesis, transferase/electron transport/DNA complex; HET: DNA 2DT 8FG; 2.10A {Enterobacteria phage T7} SCOP: c.55.3.5 e.8.1.1 PDB: 1skr_A* 1skw_A* 1sl0_A* 1sks_A* 1sl2_A* 1t7p_A* 1t8e_A* 1tk0_A* 1tk5_A* 1tk8_A* 1tkd_A* 1sl1_A* 1x9s_A* 1x9w_A* 1zyq_A* 2ajq_A* Back     alignment and structure
>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ... Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>1wud_A ATP-dependent DNA helicase RECQ; DNA-binding domain, HRDC, hydrolase; 2.20A {Escherichia coli} SCOP: a.60.8.1 Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>4dfk_A DNA polymerase I, thermostable; DNA polymerase, transferase-DNA complex; HET: DNA DOC 0L5; 1.65A {Thermus aquaticus} PDB: 1jxe_A* 3ktq_A* 3lwl_A* 3lwm_A* 3m8s_A* 3m8r_A* 3oju_A* 3rr7_A* 3rr8_A* 3rrg_A* 3ojs_A* 3rtv_A* 3sv3_A* 3sv4_A* 3syz_A* 3sz2_A* 3t3f_A* 4df4_A* 4df8_A* 4dfj_A* ... Back     alignment and structure
>2rhf_A DNA helicase RECQ; HRDC, D. radiodurans, ATP-binding, hydrolase nucleotide-binding; HET: DNA; 1.10A {Deinococcus radiodurans} Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2kv2_A Bloom syndrome protein; HRDC domain, disease mutation, DNA replicati binding, nucleotide-binding, nucleus, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>2rrd_A BLM HRDC domain, HRDC domain from bloom syndrome protein; DNA helicase, RECQ family, HRDC DOMA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>2dgz_A Werner syndrome protein variant; HRDC domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.60.8.1 Back     alignment and structure
>2e1f_A Werner syndrome ATP-dependent helicase; HRDC domain, hydrolase; 2.00A {Homo sapiens} SCOP: a.60.8.1 PDB: 2e1e_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>1bgx_T TAQ DNA polymerase; DNA polymerase, FAB, PCR, inhibition, helix-coil dynamics, inhibitor design, complex (polymerase/inhibitor); 2.30A {Thermus aquaticus} SCOP: a.60.7.1 c.120.1.2 c.55.3.5 e.8.1.1 PDB: 1cmw_A 1tau_A* 1taq_A* Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>3v9w_A Ribonuclease T; DEDD nucleases family, EXO-nucleases, hydrolase-DNA complex; HET: DNA; 1.70A {Escherichia coli} PDB: 3ngy_A 3v9u_A* 3ngz_A* 3va3_A* 3v9z_A* 3nh0_A 3nh2_A 3nh1_A* 3v9s_A* 3v9x_A* 3va0_A* 2is3_A Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>2p1j_A POLIII, DNA polymerase III POLC-type; structural genomics, exonuclease, PSI-2, protein structure initiative; HET: DNA; 2.50A {Thermotoga maritima MSB8} Back     alignment and structure
>3mxm_B Three prime repair exonuclease 1; RNAse H-like fold, polyproline type II helix, hydrolase-DNA; HET: DNA; 1.75A {Mus musculus} SCOP: c.55.3.5 PDB: 3mxj_B 2ioc_B 3mxi_B* 3b6o_A* 2o4g_A* 3b6p_A* 2o4i_A 2oa8_A Back     alignment and structure
>1wlj_A Interferon stimulated gene 20KDA; exoribonuclease, hydrolase; HET: U5P; 1.90A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2f96_A Ribonuclease T; RNAse, RNT, RNAse T, tRNA hydrolase, SAD, PS protein structure initiative, midwest center for structural genomics; 2.09A {Pseudomonas aeruginosa} SCOP: c.55.3.5 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>3u3y_B Three prime repair exonuclease 1; RNAse H fold, 3' exonuclease, homodimer, hydrolase-DNA compl; HET: BU1; 2.28A {Mus musculus} PDB: 3u6f_B* Back     alignment and structure
>1y97_A Three prime repair exonuclease 2; TREX2, hydrolase; 2.50A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>2gui_A DNA polymerase III epsilon subunit; DNA polymerase proofreading domain, transferase; HET: DNA U5P; 1.60A {Escherichia coli} SCOP: c.55.3.5 PDB: 1j54_A* 1j53_A* 2ido_A* 2xy8_A* Back     alignment and structure
>2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>2qxf_A Exodeoxyribonuclease I; alpha-beta domain, DNAQ superfamily, SH3-like domain, produc structure, DNA damage, DNA repair, exonuclease; HET: TMP; 1.50A {Escherichia coli} SCOP: c.55.3.5 PDB: 1fxx_A* 3c94_A 3c95_A 3hl8_A* 3hp9_A* Back     alignment and structure
>1d8b_A SGS1 RECQ helicase; five helices, three-helical bundle flanked by two helices, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.60.8.1 Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1w0h_A 3'-5' exonuclease ERI1; nuclease domain, hydrolase; HET: AMP; 1.59A {Homo sapiens} SCOP: c.55.3.5 Back     alignment and structure
>2xri_A ERI1 exoribonuclease 3; hydrolase, metal binding; 2.15A {Homo sapiens} Back     alignment and structure
>4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure
>1zbu_A ERI-1 homolog, 3'-5' exonuclease ERI1; hydrolase; HET: AMP; 3.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1973
d2hbka2292 c.55.3.5 (A:129-420) Exosome complex exonuclease R 5e-63
d2hbka2292 c.55.3.5 (A:129-420) Exosome complex exonuclease R 5e-63
d1vk0a_206 c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thal 1e-33
d1vk0a_206 c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thal 1e-33
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 7e-27
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 7e-27
d1nvpd151 a.32.1.1 (D:3-53) Small chain TOA2, N-terminal dom 4e-24
d2cpra1113 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 3e-23
d2fxua2225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 1e-22
d2fxua2225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 1e-09
d1nvpd246 b.56.1.1 (D:54-99) Small chain TOA2, C-terminal do 5e-22
d1nh2d150 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal dom 3e-21
d1yt3a3193 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domai 3e-21
d1yt3a3193 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domai 3e-21
d1nh2d267 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal d 5e-17
d1kfsa1195 c.55.3.5 (A:324-518) Exonuclease domain of prokary 3e-15
d1kfsa1195 c.55.3.5 (A:324-518) Exonuclease domain of prokary 3e-15
d2hbka196 a.60.8.4 (A:421-516) Exosome complex exonuclease R 1e-13
d1k8kb1190 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 2e-12
d1k8kb1190 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 4e-10
d1k8ka2258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 4e-12
d1k8ka2258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 1e-10
d1yt3a1101 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia c 2e-11
d2hhva1171 c.55.3.5 (A:298-468) Exonuclease domain of prokary 3e-10
d2hhva1171 c.55.3.5 (A:298-468) Exonuclease domain of prokary 3e-10
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 292 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Exosome complex exonuclease RRP6
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  215 bits (548), Expect = 5e-63
 Identities = 131/285 (45%), Positives = 182/285 (63%), Gaps = 9/285 (3%)

Query: 241 IERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYDA----IESFCHPYEYELD 296
           +E+PQL+FK  +DNS    F P LKEKPNALKPL+  L   D        + HPYEYE+D
Sbjct: 1   VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEID 60

Query: 297 LYVPKEDFLKCEEPKQALPLSDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQ 356
                 + L+  E   +    D+  + +    ++  ++ +LK  +EIA+DLE+H+YRSY 
Sbjct: 61  HQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYY 120

Query: 357 GYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVKVFHGADSDIKWLQKDFGLYV 416
           G  CLMQISTR++DY+VDTLKLRE+L +LNEV T+ +IVKVFHGA  DI WLQ+D GLYV
Sbjct: 121 GIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWLQRDLGLYV 180

Query: 417 VGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHY 476
           VG+FDT+ A K + +PR SLAYLL+++ +  + K +QL DWR RPL +P    AR DTH+
Sbjct: 181 VGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAAARADTHF 240

Query: 477 LLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVFNE 521
           LL +YD ++  L      + N +      SRN+ K ++E   +  
Sbjct: 241 LLNIYDQLRNKLI-----ESNKLAGVLYESRNVAKRRFEYSKYRP 280


>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 292 Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 206 Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 206 Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure
>d1nvpd1 a.32.1.1 (D:3-53) Small chain TOA2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1nvpd2 b.56.1.1 (D:54-99) Small chain TOA2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1nh2d1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 50 Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Length = 193 Back     information, alignment and structure
>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Length = 195 Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 96 Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Length = 190 Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1973
d2hbka2292 Exosome complex exonuclease RRP6 {Baker's yeast (S 100.0
d2hbka2292 Exosome complex exonuclease RRP6 {Baker's yeast (S 100.0
d2fxua2225 Actin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1k8ka2258 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 100.0
d1yt3a3193 Ribonuclease D, catalytic domain {Escherichia coli 99.97
d1yt3a3193 Ribonuclease D, catalytic domain {Escherichia coli 99.96
d1k8kb1190 Actin-related protein 2, Arp2 {Cow (Bos taurus) [T 99.95
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 99.94
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1vk0a_206 Hypothetical protein AT5G06450 {Thale-cress (Arabi 99.86
d1nvpd151 Small chain TOA2, N-terminal domain {Human (Homo s 99.84
d1vk0a_206 Hypothetical protein AT5G06450 {Thale-cress (Arabi 99.84
d1nvpd246 Small chain TOA2, C-terminal domain {Human (Homo s 99.84
d1kfsa1195 Exonuclease domain of prokaryotic DNA polymerase { 99.83
d1nh2d267 Small chain TOA2, C-terminal domain {Baker's yeast 99.82
d1nh2d150 Small chain TOA2, N-terminal domain {Baker's yeast 99.81
d1kfsa1195 Exonuclease domain of prokaryotic DNA polymerase { 99.8
d2hhva1171 Exonuclease domain of prokaryotic DNA polymerase { 99.68
d2cpra1113 Exosome component 10, EXOSC10 {Human (Homo sapiens 99.65
d2hhva1171 Exonuclease domain of prokaryotic DNA polymerase { 99.65
d1yt3a1101 Ribonuclease D {Escherichia coli [TaxId: 562]} 99.44
d2hbka196 Exosome complex exonuclease RRP6 domain {Baker's y 99.44
d1wuda177 HRDC domain from RecQ helicase {Escherichia coli [ 98.8
d1nh2d267 Small chain TOA2, C-terminal domain {Baker's yeast 98.49
d2e1fa194 Werner syndrome ATP-dependent helicase, WRN {Human 98.46
d1nvpd246 Small chain TOA2, C-terminal domain {Human (Homo s 98.43
d1e4ft2191 Cell division protein FtsA {Thermotoga maritima [T 98.3
d1jcea2196 Prokaryotic actin homolog MreB {Thermotoga maritim 97.7
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 97.23
d1wlja_173 Interferon-stimulated gene 20 kDa protein, ISG20 { 97.14
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 96.99
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 96.07
d1dkgd2198 Heat shock protein 70kDa, ATPase fragment {Escheri 96.03
d1x9ma1204 Exonuclease domain of T7 DNA polymerase {Bacteriop 95.69
d1bupa2193 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 95.22
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 95.07
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 94.41
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 93.06
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 90.69
d3b6oa1226 Three prime repair exonuclease 1, TREX1 {Mouse (Mu 90.25
d1tgoa1347 Exonuclease domain of family B DNA polymerases {Ar 89.99
d2guia1174 N-terminal exonuclease domain of the epsilon subun 85.9
d2guia1174 N-terminal exonuclease domain of the epsilon subun 85.62
d1y97a1228 Three prime repair exonuclease 2, TREX2 {Human (Ho 85.09
d1tgoa1347 Exonuclease domain of family B DNA polymerases {Ar 84.1
d2fsja1161 Hypothetical protein Ta0583 {Archaeon Thermoplasma 83.22
d2zgya2163 Plasmid segregation protein ParM {Escherichia coli 81.07
>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: DnaQ-like 3'-5' exonuclease
domain: Exosome complex exonuclease RRP6
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=1.4e-55  Score=515.67  Aligned_cols=274  Identities=47%  Similarity=0.800  Sum_probs=262.0

Q ss_pred             CCCcccccCcCCCCCCCCCCcccCCcCCCCCChhhHhhhhcc----CCCCCCCCcHHHhccCCCCccccccCCCCCCCCC
Q psy15183        241 IERPQLQFKVKVDNSYEQLFEPKLKEKPNALKPLAILLEKYD----AIESFCHPYEYELDLYVPKEDFLKCEEPKQALPL  316 (1973)
Q Consensus       241 i~kPQ~~f~~~~dn~~~~pf~p~l~~Kp~a~~~l~~~~~~~~----~~~~~~hPy~~ei~~~~~~~~~~~~~~p~~~~p~  316 (1973)
                      |.|||++|+++||||+++||+|+|++||||++||+..+....    .+..|.|||++||.++++|+++++..+|.++.|+
T Consensus         1 i~~pq~~f~~~~dn~~~~pf~p~l~~k~~a~~~l~~~~~~~~~~~~~~~~~~hpy~~ei~~~~~~~~~~~~~~~~~~~~~   80 (292)
T d2hbka2           1 VEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYPHPYEYEIDHQEYSPEILQIREEIPSKSW   80 (292)
T ss_dssp             CCCGGGGCSSCCCCCCCSCCCCCCSCCSSCSSCHHHHSSCCCCCSSSCSCCCCTTHHHHHHSCCCGGGSSCCCCCCCCCG
T ss_pred             CCChhhhcCCCCCCCCCCCCccccccCCCcCccchhhhcccccccCCCccCCCCCHHHHhcCCCChhhcCcCCCCCCCCC
Confidence            789999999999999988999999999999999998765432    3568999999999999999999999999999999


Q ss_pred             CCCCcEEeCCHHHHHHHHHHHhcCCeEEEEeeeccCCccCCcEEEEEEEeCCceEEEEccCccccHHHHHHHHcCCCcee
Q psy15183        317 SDTPLMMITEPEQVTQLVSELKQQQEIAIDLEYHNYRSYQGYTCLMQISTRDKDYIVDTLKLREDLEVLNEVLTDKNIVK  396 (1973)
Q Consensus       317 ~~~~~~~Idt~e~L~~ll~~L~~~~~IavDtE~~~~~s~~g~l~LIQIst~~~~~lID~l~l~~~l~~L~~lL~dp~I~K  396 (1973)
                      +.++++||+|.++|.++++.|.+++.||||+||+++++|.|.+||||||+++++|+||++.++..+..|+++|+|++|+|
T Consensus        81 ~~t~~~~Vdt~e~L~~li~~L~~~~~iavDtE~~~~~s~~g~l~LiQiat~~~~~iiD~~~l~~~l~~L~~ll~d~~I~K  160 (292)
T d2hbka2          81 DDSVPIWVDTSTELESMLEDLKNTKEIAVDLEHHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVK  160 (292)
T ss_dssp             GGCCCEEECSHHHHHHHHHHHTTCSEEEEEEEEECSSSSSCEEEEEEEECSSCEEEEETTTTTTTGGGGHHHHTCTTSEE
T ss_pred             CCCCcEEeCCHHHHHHHHHHHhcCCcEEEEEEeCcCcccCCeEEEEEEEeCCccEEEEecccccchHHHHHHHhccCeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999878889999999999999


Q ss_pred             eecchhHhHHHHHHHhCCcccceeehhhhhhhcCCCCccHHHHHHHHcCCCCCcccccccCCCCCCCchhHhHHHHhHHH
Q psy15183        397 VFHGADSDIKWLQKDFGLYVVGMFDTHQACKFLPMPRQSLAYLLKHYCDVDSDKTFQLFDWRHRPLPEPAIQYARTDTHY  476 (1973)
Q Consensus       397 V~H~ak~Dl~~L~r~~Gi~~~nlFDT~lAA~lLg~~~~sLa~Lv~~ylgv~ldK~~q~sDW~~RPLs~eql~YAa~Da~~  476 (1973)
                      ||||+++|+.||++++|+.++++|||++|+++||..++||++|+++|||++++|.+|++||+.|||+++|+.|||.||+|
T Consensus       161 V~H~~~~Di~~L~~~~g~~~~n~fDT~~aa~~l~~~~~sL~~L~~~yl~~~ldK~~q~SdW~~RPLs~~qi~YAa~Da~~  240 (292)
T d2hbka2         161 VFHGAFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTAAARADTHF  240 (292)
T ss_dssp             EESSCHHHHHHHHHHHCCCCSSEEEHHHHHHHHTCSCCSHHHHHHHHHCCCCCCTTTTSCTTCSSCCHHHHHHHHHHHHT
T ss_pred             EeechHhhhhhhhhcccccccchHHHHHHHHHhCccccchHHHHHHhhhhcccccccccccccCcCCHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999899999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCcchhHHHHHHHHHHHHhhcCCCCC
Q psy15183        477 LLYVYDCMKLDLSAAAHGKQNLVLSTFTNSRNICKLKYEKPVF  519 (1973)
Q Consensus       477 Ll~L~d~L~~~L~e~g~~~~~~l~~v~~e~e~~~~~~y~~~~~  519 (1973)
                      |++||+.|+++|.+.|     .+.+++++++++|+++|+++.+
T Consensus       241 Ll~ly~~L~~~L~~~~-----~l~~v~~e~~~~~~~~~e~~~~  278 (292)
T d2hbka2         241 LLNIYDQLRNKLIESN-----KLAGVLYESRNVAKRRFEYSKY  278 (292)
T ss_dssp             HHHHHHHHHHHHHHTT-----CHHHHHHHHHHHHHCEECCGGG
T ss_pred             HHHHHHHHHHHHHHcC-----CHHHHHHHHHHHHHHHhccCCC
Confidence            9999999999999987     5899999999999999987644



>d2hbka2 c.55.3.5 (A:129-420) Exosome complex exonuclease RRP6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt3a3 c.55.3.5 (A:1-193) Ribonuclease D, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nvpd1 a.32.1.1 (D:3-53) Small chain TOA2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vk0a_ c.55.3.5 (A:) Hypothetical protein AT5G06450 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nvpd2 b.56.1.1 (D:54-99) Small chain TOA2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nh2d1 a.32.1.1 (D:5-54) Small chain TOA2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kfsa1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d2cpra1 a.60.8.4 (A:483-595) Exosome component 10, EXOSC10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hhva1 c.55.3.5 (A:298-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} Back     information, alignment and structure
>d1yt3a1 a.60.8.3 (A:194-294) Ribonuclease D {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hbka1 a.60.8.4 (A:421-516) Exosome complex exonuclease RRP6 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nh2d2 b.56.1.1 (D:55-121) Small chain TOA2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e1fa1 a.60.8.1 (A:1142-1235) Werner syndrome ATP-dependent helicase, WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvpd2 b.56.1.1 (D:54-99) Small chain TOA2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlja_ c.55.3.5 (A:) Interferon-stimulated gene 20 kDa protein, ISG20 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1x9ma1 c.55.3.5 (A:1-210) Exonuclease domain of T7 DNA polymerase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b6oa1 c.55.3.5 (A:9-234) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]} Back     information, alignment and structure
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y97a1 c.55.3.5 (A:1-228) Three prime repair exonuclease 2, TREX2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tgoa1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Archaeon Thermococcus gorgonarius [TaxId: 71997]} Back     information, alignment and structure
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure