Psyllid ID: psy15221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| 398836335 | 70 | ribosomal protein S21 [Herbaspirillum sp | 1.0 | 1.0 | 0.914 | 2e-28 | |
| 134093710 | 70 | 30S ribosomal protein S21 [Herminiimonas | 1.0 | 1.0 | 0.9 | 3e-28 | |
| 237746703 | 70 | small subunit ribosomal protein S21 [Oxa | 1.0 | 1.0 | 0.9 | 5e-28 | |
| 300310200 | 70 | 30S ribosomal protein S21 [Herbaspirillu | 1.0 | 1.0 | 0.9 | 6e-28 | |
| 340786218 | 70 | 30S ribosomal protein S21 [Collimonas fu | 1.0 | 1.0 | 0.885 | 1e-27 | |
| 329906285 | 70 | SSU ribosomal protein S21p [Oxalobactera | 1.0 | 1.0 | 0.871 | 4e-27 | |
| 53716437 | 70 | 30S ribosomal protein S21 [Burkholderia | 1.0 | 1.0 | 0.871 | 2e-26 | |
| 78063054 | 70 | 30S ribosomal protein S21 [Burkholderia | 1.0 | 1.0 | 0.871 | 2e-26 | |
| 302877606 | 70 | 30S ribosomal protein S21 [Gallionella c | 1.0 | 1.0 | 0.828 | 3e-26 | |
| 121609940 | 70 | 30S ribosomal protein S21 [Verminephroba | 1.0 | 1.0 | 0.857 | 3e-26 |
| >gi|398836335|ref|ZP_10593672.1| ribosomal protein S21 [Herbaspirillum sp. YR522] gi|398211969|gb|EJM98580.1| ribosomal protein S21 [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
Score = 129 bits (324), Expect = 2e-28, Method: Compositional matrix adjust.
Identities = 64/70 (91%), Positives = 67/70 (95%)
Query: 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRI 60
MT IRVKENEPFEVA+RRFKRTIEKTGLLT+LRAREFYEKPT RKRKLAAA+KRHYKRI
Sbjct: 1 MTTIRVKENEPFEVAMRRFKRTIEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHYKRI 60
Query: 61 RSQQLPKKMY 70
RSQQLPKKMY
Sbjct: 61 RSQQLPKKMY 70
|
Source: Herbaspirillum sp. YR522 Species: Herbaspirillum sp. YR522 Genus: Herbaspirillum Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|134093710|ref|YP_001098785.1| 30S ribosomal protein S21 [Herminiimonas arsenicoxydans] gi|152983162|ref|YP_001352180.1| 30S ribosomal protein S21 [Janthinobacterium sp. Marseille] gi|166224034|sp|A4G2B9.1|RS21_HERAR RecName: Full=30S ribosomal protein S21 gi|166224035|sp|A6SV83.1|RS21_JANMA RecName: Full=30S ribosomal protein S21 gi|133737613|emb|CAL60656.1| 30S ribosomal subunit protein S21 [Herminiimonas arsenicoxydans] gi|151283239|gb|ABR91649.1| small subunit ribosomal protein S21 [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
| >gi|237746703|ref|ZP_04577183.1| small subunit ribosomal protein S21 [Oxalobacter formigenes HOxBLS] gi|237748839|ref|ZP_04579319.1| small subunit ribosomal protein S21 [Oxalobacter formigenes OXCC13] gi|229378054|gb|EEO28145.1| small subunit ribosomal protein S21 [Oxalobacter formigenes HOxBLS] gi|229380201|gb|EEO30292.1| small subunit ribosomal protein S21 [Oxalobacter formigenes OXCC13] | Back alignment and taxonomy information |
|---|
| >gi|300310200|ref|YP_003774292.1| 30S ribosomal protein S21 [Herbaspirillum seropedicae SmR1] gi|409404647|ref|ZP_11253126.1| 30S ribosomal protein S21 [Herbaspirillum sp. GW103] gi|300072985|gb|ADJ62384.1| 30S ribosomal subunit S21 protein [Herbaspirillum seropedicae SmR1] gi|386436166|gb|EIJ48989.1| 30S ribosomal protein S21 [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|340786218|ref|YP_004751683.1| 30S ribosomal protein S21 [Collimonas fungivorans Ter331] gi|399017718|ref|ZP_10719907.1| ribosomal protein S21 [Herbaspirillum sp. CF444] gi|427400729|ref|ZP_18891967.1| 30S ribosomal protein S21 [Massilia timonae CCUG 45783] gi|340551485|gb|AEK60860.1| SSU ribosomal protein S21p [Collimonas fungivorans Ter331] gi|398102485|gb|EJL92665.1| ribosomal protein S21 [Herbaspirillum sp. CF444] gi|425720242|gb|EKU83165.1| 30S ribosomal protein S21 [Massilia timonae CCUG 45783] | Back alignment and taxonomy information |
|---|
| >gi|329906285|ref|ZP_08274381.1| SSU ribosomal protein S21p [Oxalobacteraceae bacterium IMCC9480] gi|395763827|ref|ZP_10444496.1| 30S ribosomal protein S21 [Janthinobacterium lividum PAMC 25724] gi|445499117|ref|ZP_21465972.1| 30S ribosomal protein S21 [Janthinobacterium sp. HH01] gi|327547305|gb|EGF32144.1| SSU ribosomal protein S21p [Oxalobacteraceae bacterium IMCC9480] gi|444789112|gb|ELX10660.1| 30S ribosomal protein S21 [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|53716437|ref|YP_105143.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 23344] gi|53722779|ref|YP_111764.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243] gi|67643218|ref|ZP_00441966.1| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4] gi|76817923|ref|YP_335994.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710b] gi|121596528|ref|YP_991112.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1] gi|126443122|ref|YP_001063522.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668] gi|126445629|ref|YP_001077573.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247] gi|126456199|ref|YP_001076419.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a] gi|134278696|ref|ZP_01765410.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 305] gi|161521352|ref|YP_001584779.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616] gi|167000274|ref|ZP_02266093.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20] gi|167566506|ref|ZP_02359422.1| ribosomal protein S21 [Burkholderia oklahomensis EO147] gi|167573587|ref|ZP_02366461.1| ribosomal protein S21 [Burkholderia oklahomensis C6786] gi|167724586|ref|ZP_02407822.1| ribosomal protein S21 [Burkholderia pseudomallei DM98] gi|167743536|ref|ZP_02416310.1| ribosomal protein S21 [Burkholderia pseudomallei 14] gi|167820725|ref|ZP_02452405.1| ribosomal protein S21 [Burkholderia pseudomallei 91] gi|167829084|ref|ZP_02460555.1| ribosomal protein S21 [Burkholderia pseudomallei 9] gi|167842194|ref|ZP_02468878.1| ribosomal protein S21 [Burkholderia thailandensis MSMB43] gi|167850561|ref|ZP_02476069.1| ribosomal protein S21 [Burkholderia pseudomallei B7210] gi|167899154|ref|ZP_02486555.1| ribosomal protein S21 [Burkholderia pseudomallei 7894] gi|167907497|ref|ZP_02494702.1| ribosomal protein S21 [Burkholderia pseudomallei NCTC 13177] gi|167915836|ref|ZP_02502927.1| ribosomal protein S21 [Burkholderia pseudomallei 112] gi|167923675|ref|ZP_02510766.1| ribosomal protein S21 [Burkholderia pseudomallei BCC215] gi|189352481|ref|YP_001948108.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616] gi|217422668|ref|ZP_03454171.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576] gi|221197054|ref|ZP_03570101.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M] gi|221203726|ref|ZP_03576744.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2] gi|221212352|ref|ZP_03585329.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1] gi|226195854|ref|ZP_03791441.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9] gi|237510061|ref|ZP_04522776.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346] gi|242312910|ref|ZP_04811927.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b] gi|254177192|ref|ZP_04883848.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399] gi|254184928|ref|ZP_04891517.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655] gi|254186157|ref|ZP_04892675.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur 52237] gi|254194250|ref|ZP_04900682.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13] gi|254203081|ref|ZP_04909443.1| 30S ribosomal protein S21 [Burkholderia mallei FMH] gi|254208414|ref|ZP_04914763.1| 30S ribosomal protein S21 [Burkholderia mallei JHU] gi|254253606|ref|ZP_04946923.1| Ribosomal protein S21 [Burkholderia dolosa AUO158] gi|254265310|ref|ZP_04956175.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a] gi|254301210|ref|ZP_04968654.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e] gi|254359400|ref|ZP_04975672.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280] gi|386865567|ref|YP_006278515.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1026b] gi|403523634|ref|YP_006659203.1| 30S ribosomal protein S21 [Burkholderia pseudomallei BPC006] gi|416995854|ref|ZP_11939113.1| 30S ribosomal protein S21 [Burkholderia sp. TJI49] gi|418397010|ref|ZP_12970760.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 354a] gi|418536788|ref|ZP_13102457.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1026a] gi|418544099|ref|ZP_13109411.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1258a] gi|418550940|ref|ZP_13115887.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1258b] gi|418556607|ref|ZP_13121231.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 354e] gi|421468321|ref|ZP_15916873.1| ribosomal protein S21 [Burkholderia multivorans ATCC BAA-247] gi|421476928|ref|ZP_15924781.1| ribosomal protein S21 [Burkholderia multivorans CF2] gi|55976309|sp|Q62DT5.1|RS21B_BURMA RecName: Full=30S ribosomal protein S21 B gi|81689982|sp|Q63JF8.1|RS213_BURPS RecName: Full=30S ribosomal protein S21 3 gi|119367226|sp|Q3JKA9.1|RS213_BURP1 RecName: Full=30S ribosomal protein S21 3 gi|52213193|emb|CAH39233.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243] gi|52422407|gb|AAU45977.1| ribosomal protein S21 [Burkholderia mallei ATCC 23344] gi|76582396|gb|ABA51870.1| ribosomal protein S21 [Burkholderia pseudomallei 1710b] gi|121224326|gb|ABM47857.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1] gi|124898251|gb|EAY70094.1| Ribosomal protein S21 [Burkholderia dolosa AUO158] gi|126222613|gb|ABN86118.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668] gi|126229967|gb|ABN93380.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a] gi|126238483|gb|ABO01595.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247] gi|134250480|gb|EBA50560.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 305] gi|147746126|gb|EDK53204.1| 30S ribosomal protein S21 [Burkholderia mallei FMH] gi|147751101|gb|EDK58169.1| 30S ribosomal protein S21 [Burkholderia mallei JHU] gi|148028587|gb|EDK86547.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280] gi|157811005|gb|EDO88175.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e] gi|157933843|gb|EDO89513.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur 52237] gi|160345402|gb|ABX18487.1| ribosomal protein S21 [Burkholderia multivorans ATCC 17616] gi|160698232|gb|EDP88202.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399] gi|169651001|gb|EDS83694.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13] gi|184215520|gb|EDU12501.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655] gi|189336503|dbj|BAG45572.1| small subunit ribosomal protein S21 [Burkholderia multivorans ATCC 17616] gi|217394899|gb|EEC34918.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576] gi|221167451|gb|EED99920.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1] gi|221175892|gb|EEE08321.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2] gi|221183608|gb|EEE16008.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M] gi|225932339|gb|EEH28339.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9] gi|235002266|gb|EEP51690.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346] gi|238524503|gb|EEP87936.1| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4] gi|242136149|gb|EES22552.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b] gi|243063762|gb|EES45948.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20] gi|254216312|gb|EET05697.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a] gi|325518125|gb|EGC97911.1| 30S ribosomal protein S21 [Burkholderia sp. TJI49] gi|385350371|gb|EIF56915.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1258b] gi|385350768|gb|EIF57290.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1258a] gi|385351680|gb|EIF58146.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1026a] gi|385366772|gb|EIF72374.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 354e] gi|385369574|gb|EIF74889.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 354a] gi|385662695|gb|AFI70117.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1026b] gi|400227243|gb|EJO57250.1| ribosomal protein S21 [Burkholderia multivorans CF2] gi|400232176|gb|EJO61812.1| ribosomal protein S21 [Burkholderia multivorans ATCC BAA-247] gi|403078701|gb|AFR20280.1| 30S ribosomal protein S21 [Burkholderia pseudomallei BPC006] | Back alignment and taxonomy information |
|---|
| >gi|78063054|ref|YP_372962.1| 30S ribosomal protein S21 [Burkholderia sp. 383] gi|107026826|ref|YP_624337.1| 30S ribosomal protein S21 [Burkholderia cenocepacia AU 1054] gi|116691980|ref|YP_837513.1| 30S ribosomal protein S21 [Burkholderia cenocepacia HI2424] gi|134292970|ref|YP_001116706.1| 30S ribosomal protein S21 [Burkholderia vietnamiensis G4] gi|170736026|ref|YP_001777286.1| 30S ribosomal protein S21 [Burkholderia cenocepacia MC0-3] gi|206562770|ref|YP_002233533.1| 30S ribosomal protein S21 [Burkholderia cenocepacia J2315] gi|254248775|ref|ZP_04942095.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184] gi|330821207|ref|YP_004350069.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3] gi|387904762|ref|YP_006335100.1| 30S ribosomal protein s21 [Burkholderia sp. KJ006] gi|421866281|ref|ZP_16297953.1| SSU ribosomal protein S21p [Burkholderia cenocepacia H111] gi|444363471|ref|ZP_21163897.1| ribosomal protein S21 [Burkholderia cenocepacia BC7] gi|444369205|ref|ZP_21168974.1| ribosomal protein S21 [Burkholderia cenocepacia K56-2Valvano] gi|119367202|sp|Q1BLZ1.1|RS211_BURCA RecName: Full=30S ribosomal protein S21 1 gi|119367241|sp|Q393P8.1|RS21_BURS3 RecName: Full=30S ribosomal protein S21 gi|77970939|gb|ABB12318.1| SSU ribosomal protein S21P [Burkholderia sp. 383] gi|105896200|gb|ABF79364.1| SSU ribosomal protein S21P [Burkholderia cenocepacia AU 1054] gi|116649980|gb|ABK10620.1| SSU ribosomal protein S21P [Burkholderia cenocepacia HI2424] gi|124875276|gb|EAY65266.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184] gi|134136127|gb|ABO57241.1| SSU ribosomal protein S21P [Burkholderia vietnamiensis G4] gi|169818214|gb|ACA92796.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3] gi|198038810|emb|CAR54772.1| 30S ribosomal protein S21 2 [Burkholderia cenocepacia J2315] gi|327373202|gb|AEA64557.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3] gi|358073864|emb|CCE48831.1| SSU ribosomal protein S21p [Burkholderia cenocepacia H111] gi|387579654|gb|AFJ88369.1| SSU ribosomal protein S21p [Burkholderia sp. KJ006] gi|443594945|gb|ELT63559.1| ribosomal protein S21 [Burkholderia cenocepacia BC7] gi|443599501|gb|ELT67774.1| ribosomal protein S21 [Burkholderia cenocepacia K56-2Valvano] | Back alignment and taxonomy information |
|---|
| >gi|302877606|ref|YP_003846170.1| 30S ribosomal protein S21 [Gallionella capsiferriformans ES-2] gi|302580395|gb|ADL54406.1| ribosomal protein S21 [Gallionella capsiferriformans ES-2] gi|406998936|gb|EKE16756.1| hypothetical protein ACD_10C00819G0001 [uncultured bacterium] | Back alignment and taxonomy information |
|---|
| >gi|121609940|ref|YP_997747.1| 30S ribosomal protein S21 [Verminephrobacter eiseniae EF01-2] gi|241767025|ref|ZP_04764811.1| ribosomal protein S21 [Acidovorax delafieldii 2AN] gi|351729237|ref|ZP_08946928.1| 30S ribosomal protein S21 [Acidovorax radicis N35] gi|365097198|ref|ZP_09331443.1| 30S ribosomal protein S21 [Acidovorax sp. NO-1] gi|166225205|sp|A1WM72.1|RS21_VEREI RecName: Full=30S ribosomal protein S21 gi|121554580|gb|ABM58729.1| SSU ribosomal protein S21P [Verminephrobacter eiseniae EF01-2] gi|241362448|gb|EER58384.1| ribosomal protein S21 [Acidovorax delafieldii 2AN] gi|363413492|gb|EHL20688.1| 30S ribosomal protein S21 [Acidovorax sp. NO-1] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 70 | ||||||
| TIGR_CMR|SO_1288 | 71 | SO_1288 "ribosomal protein S21 | 1.0 | 0.985 | 0.591 | 7.5e-18 | |
| UNIPROTKB|P68679 | 71 | rpsU [Escherichia coli K-12 (t | 1.0 | 0.985 | 0.549 | 2.5e-17 | |
| UNIPROTKB|P66532 | 71 | rpsU "30S ribosomal protein S2 | 1.0 | 0.985 | 0.549 | 5.3e-17 | |
| TIGR_CMR|VC_0520 | 71 | VC_0520 "ribosomal protein S21 | 1.0 | 0.985 | 0.549 | 5.3e-17 | |
| TIGR_CMR|CPS_4337 | 71 | CPS_4337 "ribosomal protein S2 | 1.0 | 0.985 | 0.549 | 2.9e-16 | |
| TIGR_CMR|CBU_1593 | 74 | CBU_1593 "ribosomal protein S2 | 0.914 | 0.864 | 0.546 | 3.8e-14 | |
| TIGR_CMR|GSU_3093 | 65 | GSU_3093 "ribosomal protein S2 | 0.828 | 0.892 | 0.5 | 4.5e-11 | |
| TIGR_CMR|BA_4534 | 57 | BA_4534 "ribosomal protein S21 | 0.742 | 0.912 | 0.557 | 1.2e-10 | |
| TIGR_CMR|CHY_0421 | 59 | CHY_0421 "ribosomal protein S2 | 0.785 | 0.932 | 0.472 | 3.6e-09 | |
| TIGR_CMR|CJE_0419 | 70 | CJE_0419 "ribosomal protein S2 | 0.814 | 0.814 | 0.385 | 1.8e-07 |
| TIGR_CMR|SO_1288 SO_1288 "ribosomal protein S21" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
Score = 217 (81.4 bits), Expect = 7.5e-18, P = 7.5e-18
Identities = 42/71 (59%), Positives = 56/71 (78%)
Query: 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRI 60
M II+V+ENEPF+VA+RRFKR+ EK G+L D+RAREFYEKPTT RKR AAA+KR K++
Sbjct: 1 MPIIKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAVKRLAKKL 60
Query: 61 RSQQLPK-KMY 70
+ + ++Y
Sbjct: 61 SRENARRVRLY 71
|
|
| UNIPROTKB|P68679 rpsU [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P66532 rpsU "30S ribosomal protein S21" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_0520 VC_0520 "ribosomal protein S21" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4337 CPS_4337 "ribosomal protein S21" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_1593 CBU_1593 "ribosomal protein S21" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3093 GSU_3093 "ribosomal protein S21" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_4534 BA_4534 "ribosomal protein S21" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_0421 CHY_0421 "ribosomal protein S21" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CJE_0419 CJE_0419 "ribosomal protein S21" [Campylobacter jejuni RM1221 (taxid:195099)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| PRK00270 | 64 | PRK00270, rpsU, 30S ribosomal protein S21; Reviewe | 7e-17 | |
| COG0828 | 67 | COG0828, RpsU, Ribosomal protein S21 [Translation, | 2e-12 | |
| pfam01165 | 53 | pfam01165, Ribosomal_S21, Ribosomal protein S21 | 2e-11 | |
| TIGR00030 | 58 | TIGR00030, S21p, ribosomal protein S21 | 3e-10 |
| >gnl|CDD|234707 PRK00270, rpsU, 30S ribosomal protein S21; Reviewed | Back alignment and domain information |
|---|
Score = 66.8 bits (164), Expect = 7e-17
Identities = 34/64 (53%), Positives = 47/64 (73%)
Query: 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRI 60
M ++V+ENE + A+RRFKR +EK G+L +LR REFYEKP+ RKRK AAA KR K++
Sbjct: 1 MPQVKVRENESIDKALRRFKRKVEKAGILRELRRREFYEKPSEKRKRKKAAARKRRRKKL 60
Query: 61 RSQQ 64
++
Sbjct: 61 AREE 64
|
Length = 64 |
| >gnl|CDD|223898 COG0828, RpsU, Ribosomal protein S21 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|201634 pfam01165, Ribosomal_S21, Ribosomal protein S21 | Back alignment and domain information |
|---|
| >gnl|CDD|129141 TIGR00030, S21p, ribosomal protein S21 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| PRK00270 | 64 | rpsU 30S ribosomal protein S21; Reviewed | 99.93 | |
| COG0828 | 67 | RpsU Ribosomal protein S21 [Translation, ribosomal | 99.93 | |
| TIGR00030 | 58 | S21p ribosomal protein S21. This model describes b | 99.92 | |
| PF01165 | 57 | Ribosomal_S21: Ribosomal protein S21; InterPro: IP | 99.73 |
| >PRK00270 rpsU 30S ribosomal protein S21; Reviewed | Back alignment and domain information |
|---|
Probab=99.93 E-value=9.6e-26 Score=134.91 Aligned_cols=62 Identities=55% Similarity=0.872 Sum_probs=59.0
Q ss_pred CcEeeccCCCcHHHHHHHHHHHHHhhchHHHHHHHHhccChhHHHHHHHHHHHHHHHHHHHh
Q psy15221 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRIRS 62 (70)
Q Consensus 1 M~~V~V~~~E~ie~Alrrfkr~~~k~Gil~e~rrrr~yeKPs~krkrk~~ea~rR~rk~~r~ 62 (70)
|++|.|++|||||.||++|+++|+++|||.|+++++||||||++++++..+|.++.+++.+.
T Consensus 1 M~~V~V~~~e~ie~Alrrfkr~~~k~gil~e~r~r~~yekPs~krkrk~~~a~rr~~k~~~~ 62 (64)
T PRK00270 1 MPQVKVRENESIDKALRRFKRKVEKAGILRELRRREFYEKPSEKRKRKKAAARKRRRKKLAR 62 (64)
T ss_pred CCeeEeCCCChHHHHHHHHHHHHHHcchHHHHHHHHhhcCHHHHHHHHHHHHHHHHHHHHhh
Confidence 89999999999999999999999999999999999999999999999999999998875543
|
|
| >COG0828 RpsU Ribosomal protein S21 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00030 S21p ribosomal protein S21 | Back alignment and domain information |
|---|
| >PF01165 Ribosomal_S21: Ribosomal protein S21; InterPro: IPR001911 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 70 | ||||
| 2avy_U | 71 | Crystal Structure Of The Bacterial Ribosome From Es | 2e-17 | ||
| 2i2p_U | 70 | Crystal Structure Of Ribosome With Messenger Rna An | 8e-17 | ||
| 3fih_U | 51 | Ternary Complex-Bound E.Coli 70s Ribosome. This Ent | 3e-14 |
| >pdb|2AVY|U Chain U, Crystal Structure Of The Bacterial Ribosome From Escherichia Coli At 3.5 A Resolution. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 71 | Back alignment and structure |
|
| >pdb|2I2P|U Chain U, Crystal Structure Of Ribosome With Messenger Rna And The Anticodon Stem-Loop Of P-Site Trna. This File Contains The 30s Subunit Of One 70s Ribosome. The Entire Crystal Structure Contains Two 70s Ribosomes And Is Described In Remark 400. Length = 70 | Back alignment and structure |
| >pdb|3FIH|U Chain U, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry Consists Of The 30s Subunit, Trnas And The Ternary Complex. Length = 51 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 70 | |||
| 3bbn_U | 190 | Ribosomal protein S21; small ribosomal subunit, sp | 4e-19 | |
| 3i1m_U | 71 | 30S ribosomal protein S21; ribosome structure, pro | 2e-18 | |
| 3r8n_U | 51 | 30S ribosomal protein S21; protein biosynthesis, R | 8e-16 |
| >3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Length = 190 | Back alignment and structure |
|---|
Score = 75.3 bits (184), Expect = 4e-19
Identities = 21/68 (30%), Positives = 36/68 (52%)
Query: 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRI 60
+ V +NEP E + RF+R + + G++ + + R F+E VRKRK A KR+ +R
Sbjct: 96 NVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENTQDVRKRKTREAAKRNRRRR 155
Query: 61 RSQQLPKK 68
+ +
Sbjct: 156 PQARFTPQ 163
|
| >3i1m_U 30S ribosomal protein S21; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_U* 2avy_U 2aw7_U 2vho_U 2vhp_U 3df1_U* 3df3_U* 3e1a_Q 3e1c_Q 1vs5_U 3i1o_U 3i1q_U 3i1s_U 3i1z_U 3i21_U 3izv_Y* 3izw_Y* 3kc4_U 3or9_U 3ora_U ... Length = 71 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 70 | |||
| 3i1m_U | 71 | 30S ribosomal protein S21; ribosome structure, pro | 99.91 | |
| 3r8n_U | 51 | 30S ribosomal protein S21; protein biosynthesis, R | 99.84 | |
| 3bbn_U | 190 | Ribosomal protein S21; small ribosomal subunit, sp | 99.83 |
| >3i1m_U 30S ribosomal protein S21; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_U* 2avy_U 2aw7_U 2vho_U 2vhp_U 3df1_U* 3df3_U* 3e1a_Q 3e1c_Q 1vs5_U 3i1o_U 3i1q_U 3i1s_U 3i1z_U 3i21_U 3izv_Y* 3izw_Y* 3kc4_U 3or9_U 3ora_U ... | Back alignment and structure |
|---|
Probab=99.91 E-value=9.9e-28 Score=145.42 Aligned_cols=65 Identities=58% Similarity=0.981 Sum_probs=50.9
Q ss_pred CcEeeccCCCcHHHHHHHHHHHHHhhchHHHHHHHHhccChhHHHHHHHHHHHHHHHHHHHhhcC
Q psy15221 1 MTIIRVKENEPFEVAIRRFKRTIEKTGLLTDLRAREFYEKPTTVRKRKLAAAIKRHYKRIRSQQL 65 (70)
Q Consensus 1 M~~V~V~~~E~ie~Alrrfkr~~~k~Gil~e~rrrr~yeKPs~krkrk~~ea~rR~rk~~r~~~~ 65 (70)
|++|.|+||||||.||++|+++|+++||+.|+++++||||||++++++..+|+++.++++++++.
T Consensus 1 M~~V~V~enE~ie~ALRrfKR~~~k~Gil~e~Rrr~~yEKPs~kRkrk~~~a~kR~~k~~~~~~~ 65 (71)
T 3i1m_U 1 MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARENA 65 (71)
T ss_dssp ---CEEECCSSCCSCCCTTTTSSSTHHHHTTSSSCCCSSSHHHHHHHHHHTSCC-----------
T ss_pred CCeeEeCCCCCHHHHHHHHHHHHHHccHHHHHHHHHhccCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999887654
|
| >3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00