Psyllid ID: psy15224

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500--
MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGGKSNRPTPISSKEIEEILKQIKKGVEKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQVEKI
ccccccccccEEEEEEccccccccHHHHHHHHHHccccEEEEEEEcccccccHHHHHHHHHHHHHHHHccccccccccEEEcHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEccccEEEEccEEEEEEEcccEEEEEEEccccEEEEEEEEccccccccccccccEEEEcccccccccccccEEEccccccccccEEEEEEEEEccccccccccccccccccEEEcccEEEEEEccccccEEEccccEEEEEEEEEEEccccccEEEEEEccccccccEEEEEEEcccccccccccHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccccEEEcccccEEEccccccccEEccccccEEEEEEEEccccEEEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccccccccEEEcccEEEEccccccccccccEEEEEEcEEEEEEEEEEEcccEEEEEccccccc
HHHccccccEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHHHHHHHHcccccccccEEEccHHHHHccccccccHHHHHHHHHHHHHHccccccccccccEEEccEEEEEcccEEEEEEEccEcEEEcccEEEEEcccccEEEEEEEEEEccEEEcEEEcccEEEEEEccccHHHcccccEEEcccccccEEEEEEEEEEccHHHccccccccccEccEEEEccEEEEEEEEccccccccccccEEEEEEEEEEEEccccccEEEEEEcccEEEEEEEEEEEHcccHHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHccHHcccEEEEcccHEEEHHHcHHHHHHHHccccEEEEEEEEccccHHEEEcccEEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccEEEcccccccccEEEEEEEEccccEEEEEEEEccEEEEEEEEccccEEc
mitgaaqmDGAILVCsaadgpmpqtREHILLARQVGVPYIVVFLnkadmvddeELLELVEIEIRELLnkyefpgndipiikgsaklalegdtgplgeQSILSLSKALdtyiptpnraidgafllpvedvfsisgrgtvvtgRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLdqgqagdniglllrgtkredvergqvlakpgsikphkhftGEIYAlskdeggrhtpffsnyrpqfyfrttdvtgsielpknkemvmpgdnVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLtkeivnsnkinidkGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGmqkkfgrilvpteeIVDVKKNQKsvikkrffpgYVLIEMEMTDESWHLVKNTKKVtgfiggksnrptpissKEIEEILKQIKKgvekprpkilyQLDElvrikdgpftdfsgnieevnyeksRVRVSVTIFgratpvelefnqveki
mitgaaqmdGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLnkyefpgndIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFsisgrgtvvtgrvergivrvgeeleiigikdtvktTCTGVEMFRklldqgqagdniglllrgtkredvergqvlakpgsikphkhfTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSielpknkemvmpgDNVLITVRLINPIAMEEGLRFAIREGVQQFIQdnlltkeivnsnkinidkgkeyiersinnkkRWYVIHSYSGMEKNVQRKLIERINKlgmqkkfgrilvpteeivdvkknqksvikkrfFPGYVLIEMEMTDESWHLVKNTKkvtgfiggksnrptpisskeIEEILKQikkgvekprpkILYQldelvrikdgpftdfsgnieevnyeksrvrVSVTifgratpvelefnqveki
MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMvddeellelveieirellNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGGKSNRPTPisskeieeilkqikkGVEKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQVEKI
*********GAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTK*****************PHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIG****************************RPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELE*******
MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINI****EYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGG**********KE*****KQI****EKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQV***
********DGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGGKSNRPTPISSKEIEEILKQIKKGVEKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQVEKI
MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGGKSNRPTPISSKEIEEILKQIKKGVEKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQVEKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADxxxxxxxxxxxxxxxxxxxxxYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRPQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKEIVNSNKINIDKGKEYIERSINNKKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVKKNQKSVIKKRFFPGYVLIEMEMTDESWHLVKNTKKVTGFIGGKSNRPTPISSKEIEEILKQIKKGVEKPRPKILYQLDELVRIKDGPFTDFSGNIEEVNYEKSRVRVSVTIFGRATPVELEFNQVEKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query502 2.2.26 [Sep-21-2011]
A6T3K6396 Elongation factor Tu OS=J yes N/A 0.579 0.734 0.900 1e-157
Q39KI2396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.879 1e-153
Q0BJ48396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.879 1e-153
A0K3L0396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.879 1e-153
Q1BRT3396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.879 1e-153
A4JAM5396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.876 1e-152
Q0K5Z9396 Elongation factor Tu OS=C yes N/A 0.579 0.734 0.876 1e-152
P33167396 Elongation factor Tu OS=B N/A N/A 0.579 0.734 0.876 1e-152
Q13TF5396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.872 1e-152
Q2SU25396 Elongation factor Tu OS=B yes N/A 0.579 0.734 0.865 1e-151
>sp|A6T3K6|EFTU_JANMA Elongation factor Tu OS=Janthinobacterium sp. (strain Marseille) GN=tuf1 PE=3 SV=1 Back     alignment and function desciption
 Score =  556 bits (1433), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/291 (90%), Positives = 284/291 (97%)

Query: 1   MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVE 60
           MITGAAQMDGAILVCSAADGPMPQTREHILL+RQVGVPYI+VFLNKADMVDD ELLELVE
Sbjct: 92  MITGAAQMDGAILVCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDAELLELVE 151

Query: 61  IEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
           +E+RELL+KYEFPG+D+PI+KGSAKLALEGDTGPLGEQ+IL+L+ ALDTYIPTP RA+DG
Sbjct: 152 MEVRELLSKYEFPGDDLPIVKGSAKLALEGDTGPLGEQAILALANALDTYIPTPERAVDG 211

Query: 121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
           AFLLPVEDVFSISGRGTVVTGR+ERGI++VGEE+EI+GI+DT KTTCTGVEMFRKLLDQG
Sbjct: 212 AFLLPVEDVFSISGRGTVVTGRIERGIIKVGEEIEIVGIRDTQKTTCTGVEMFRKLLDQG 271

Query: 181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
           QAGDN+G+LLRGTKREDVERGQVLAKPGSIKPHKHFTGEIY LSKDEGGRHTPFF+NYRP
Sbjct: 272 QAGDNVGVLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYVLSKDEGGRHTPFFNNYRP 331

Query: 241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
           QFYFRTTDVTGSIELPK+KEMVMPGDNV ITV LINPIAMEEGLRFAIREG
Sbjct: 332 QFYFRTTDVTGSIELPKDKEMVMPGDNVSITVMLINPIAMEEGLRFAIREG 382
This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|Q39KI2|EFTU_BURS3 Elongation factor Tu OS=Burkholderia sp. (strain 383) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|Q0BJ48|EFTU_BURCM Elongation factor Tu OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|A0K3L0|EFTU_BURCH Elongation factor Tu OS=Burkholderia cenocepacia (strain HI2424) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|Q1BRT3|EFTU_BURCA Elongation factor Tu OS=Burkholderia cenocepacia (strain AU 1054) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|A4JAM5|EFTU_BURVG Elongation factor Tu OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|Q0K5Z9|EFTU_CUPNH Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|P33167|EFTU_BURCE Elongation factor Tu OS=Burkholderia cepacia GN=tuf PE=3 SV=1 Back     alignment and function description
>sp|Q13TF5|EFTU_BURXL Elongation factor Tu OS=Burkholderia xenovorans (strain LB400) GN=tuf1 PE=3 SV=1 Back     alignment and function description
>sp|Q2SU25|EFTU_BURTA Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
152981083396 elongation factor Tu [Janthinobacterium 0.579 0.734 0.900 1e-156
300309440396 EF-Tu elongation factor protein [Herbasp 0.579 0.734 0.886 1e-154
445494328396 translation elongation factor Tu [Janthi 0.579 0.734 0.869 1e-153
420257025389 translation elongation factor TU, partia 0.579 0.748 0.879 1e-152
172059326396 elongation factor Tu [Burkholderia ambif 0.579 0.734 0.879 1e-151
78064909396 elongation factor Tu [Burkholderia sp. 3 0.579 0.734 0.879 1e-151
330815225396 Translation elongation factor Tu [Burkho 0.579 0.734 0.879 1e-151
187925618396 elongation factor Tu [Burkholderia phyto 0.579 0.734 0.876 1e-151
134294428396 elongation factor Tu [Burkholderia vietn 0.579 0.734 0.876 1e-151
170704302305 translation elongation factor Tu [Burkho 0.579 0.954 0.879 1e-151
>gi|152981083|ref|YP_001355117.1| elongation factor Tu [Janthinobacterium sp. Marseille] gi|152981101|ref|YP_001355103.1| elongation factor Tu [Janthinobacterium sp. Marseille] gi|189036669|sp|A6T3K6.1|EFTU_JANMA RecName: Full=Elongation factor Tu; Short=EF-Tu gi|151281160|gb|ABR89570.1| EF-Tu elongation factor [Janthinobacterium sp. Marseille] gi|151281178|gb|ABR89588.1| EF-Tu elongation factor [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 262/291 (90%), Positives = 284/291 (97%)

Query: 1   MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVE 60
           MITGAAQMDGAILVCSAADGPMPQTREHILL+RQVGVPYI+VFLNKADMVDD ELLELVE
Sbjct: 92  MITGAAQMDGAILVCSAADGPMPQTREHILLSRQVGVPYIIVFLNKADMVDDAELLELVE 151

Query: 61  IEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
           +E+RELL+KYEFPG+D+PI+KGSAKLALEGDTGPLGEQ+IL+L+ ALDTYIPTP RA+DG
Sbjct: 152 MEVRELLSKYEFPGDDLPIVKGSAKLALEGDTGPLGEQAILALANALDTYIPTPERAVDG 211

Query: 121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
           AFLLPVEDVFSISGRGTVVTGR+ERGI++VGEE+EI+GI+DT KTTCTGVEMFRKLLDQG
Sbjct: 212 AFLLPVEDVFSISGRGTVVTGRIERGIIKVGEEIEIVGIRDTQKTTCTGVEMFRKLLDQG 271

Query: 181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
           QAGDN+G+LLRGTKREDVERGQVLAKPGSIKPHKHFTGEIY LSKDEGGRHTPFF+NYRP
Sbjct: 272 QAGDNVGVLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYVLSKDEGGRHTPFFNNYRP 331

Query: 241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
           QFYFRTTDVTGSIELPK+KEMVMPGDNV ITV LINPIAMEEGLRFAIREG
Sbjct: 332 QFYFRTTDVTGSIELPKDKEMVMPGDNVSITVMLINPIAMEEGLRFAIREG 382

Source: Janthinobacterium sp. Marseille

Species: Janthinobacterium sp. Marseille

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|300309440|ref|YP_003773532.1| EF-Tu elongation factor protein [Herbaspirillum seropedicae SmR1] gi|300309454|ref|YP_003773546.1| GTPase translation elongation factor TU [Herbaspirillum seropedicae SmR1] gi|409408686|ref|ZP_11257121.1| GTPase translation elongation factor TU [Herbaspirillum sp. GW103] gi|409408700|ref|ZP_11257135.1| GTPase translation elongation factor TU [Herbaspirillum sp. GW103] gi|124483434|emb|CAM32590.1| GTPase translation elongation factor TU (E [Herbaspirillum seropedicae] gi|300072225|gb|ADJ61624.1| EF-Tu elongation factor protein [Herbaspirillum seropedicae SmR1] gi|300072239|gb|ADJ61638.1| GTPase translation elongation factor TU (EF-Tu) protein [Herbaspirillum seropedicae SmR1] gi|386432008|gb|EIJ44836.1| GTPase translation elongation factor TU [Herbaspirillum sp. GW103] gi|386432022|gb|EIJ44850.1| GTPase translation elongation factor TU [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|445494328|ref|ZP_21461372.1| translation elongation factor Tu [Janthinobacterium sp. HH01] gi|445494416|ref|ZP_21461460.1| elongation factor Tu [Janthinobacterium sp. HH01] gi|444790489|gb|ELX12036.1| translation elongation factor Tu [Janthinobacterium sp. HH01] gi|444790577|gb|ELX12124.1| elongation factor Tu [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|420257025|ref|ZP_14759812.1| translation elongation factor TU, partial [Burkholderia sp. BT03] gi|398041035|gb|EJL34119.1| translation elongation factor TU, partial [Burkholderia sp. BT03] Back     alignment and taxonomy information
>gi|172059326|ref|YP_001806978.1| elongation factor Tu [Burkholderia ambifaria MC40-6] gi|172059339|ref|YP_001806991.1| elongation factor Tu [Burkholderia ambifaria MC40-6] gi|206558626|ref|YP_002229386.1| elongation factor Tu [Burkholderia cenocepacia J2315] gi|206558639|ref|YP_002229399.1| elongation factor Tu [Burkholderia cenocepacia J2315] gi|444357350|ref|ZP_21158893.1| translation elongation factor Tu [Burkholderia cenocepacia BC7] gi|444357377|ref|ZP_21158920.1| translation elongation factor Tu [Burkholderia cenocepacia BC7] gi|171991843|gb|ACB62762.1| translation elongation factor Tu [Burkholderia ambifaria MC40-6] gi|171991856|gb|ACB62775.1| translation elongation factor Tu [Burkholderia ambifaria MC40-6] gi|198034663|emb|CAR50530.1| elongation factor Tu [Burkholderia cenocepacia J2315] gi|198034676|emb|CAR50543.1| elongation factor Tu (EF-Tu) [Burkholderia cenocepacia J2315] gi|443606459|gb|ELT74239.1| translation elongation factor Tu [Burkholderia cenocepacia BC7] gi|443606486|gb|ELT74266.1| translation elongation factor Tu [Burkholderia cenocepacia BC7] Back     alignment and taxonomy information
>gi|78064909|ref|YP_367678.1| elongation factor Tu [Burkholderia sp. 383] gi|78064922|ref|YP_367691.1| elongation factor Tu [Burkholderia sp. 383] gi|107024305|ref|YP_622632.1| elongation factor Tu [Burkholderia cenocepacia AU 1054] gi|107024318|ref|YP_622645.1| elongation factor Tu [Burkholderia cenocepacia AU 1054] gi|115350307|ref|YP_772146.1| elongation factor Tu [Burkholderia ambifaria AMMD] gi|115350320|ref|YP_772159.1| elongation factor Tu [Burkholderia ambifaria AMMD] gi|116688357|ref|YP_833980.1| elongation factor Tu [Burkholderia cenocepacia HI2424] gi|116688370|ref|YP_833993.1| elongation factor Tu [Burkholderia cenocepacia HI2424] gi|170731667|ref|YP_001763614.1| elongation factor Tu [Burkholderia cenocepacia MC0-3] gi|170731680|ref|YP_001763627.1| elongation factor Tu [Burkholderia cenocepacia MC0-3] gi|122324268|sp|Q0BJ48.1|EFTU_BURCM RecName: Full=Elongation factor Tu; Short=EF-Tu gi|123451836|sp|Q1BRT3.1|EFTU_BURCA RecName: Full=Elongation factor Tu; Short=EF-Tu gi|123776306|sp|Q39KI2.1|EFTU_BURS3 RecName: Full=Elongation factor Tu; Short=EF-Tu gi|189028018|sp|A0K3L0.1|EFTU_BURCH RecName: Full=Elongation factor Tu; Short=EF-Tu gi|77965654|gb|ABB07034.1| translation elongation factor Tu [Burkholderia sp. 383] gi|77965667|gb|ABB07047.1| translation elongation factor 1A (EF-1A/EF-Tu) [Burkholderia sp. 383] gi|105894494|gb|ABF77659.1| translation elongation factor Tu [Burkholderia cenocepacia AU 1054] gi|105894507|gb|ABF77672.1| translation elongation factor 1A (EF-1A/EF-Tu) [Burkholderia cenocepacia AU 1054] gi|115280295|gb|ABI85812.1| translation elongation factor Tu [Burkholderia ambifaria AMMD] gi|115280308|gb|ABI85825.1| translation elongation factor 1A (EF-1A/EF-Tu) [Burkholderia ambifaria AMMD] gi|116646446|gb|ABK07087.1| translation elongation factor Tu [Burkholderia cenocepacia HI2424] gi|116646459|gb|ABK07100.1| translation elongation factor 1A (EF-1A/EF-Tu) [Burkholderia cenocepacia HI2424] gi|169814909|gb|ACA89492.1| translation elongation factor Tu [Burkholderia cenocepacia MC0-3] gi|169814922|gb|ACA89505.1| translation elongation factor Tu [Burkholderia cenocepacia MC0-3] Back     alignment and taxonomy information
>gi|330815225|ref|YP_004358930.1| Translation elongation factor Tu [Burkholderia gladioli BSR3] gi|330815247|ref|YP_004358952.1| Translation elongation factor Tu [Burkholderia gladioli BSR3] gi|327367618|gb|AEA58974.1| Translation elongation factor Tu [Burkholderia gladioli BSR3] gi|327367640|gb|AEA58996.1| Translation elongation factor Tu [Burkholderia gladioli BSR3] Back     alignment and taxonomy information
>gi|187925618|ref|YP_001897260.1| elongation factor Tu [Burkholderia phytofirmans PsJN] gi|187925631|ref|YP_001897273.1| elongation factor Tu [Burkholderia phytofirmans PsJN] gi|187716812|gb|ACD18036.1| translation elongation factor Tu [Burkholderia phytofirmans PsJN] gi|187716825|gb|ACD18049.1| translation elongation factor Tu [Burkholderia phytofirmans PsJN] Back     alignment and taxonomy information
>gi|134294428|ref|YP_001118163.1| elongation factor Tu [Burkholderia vietnamiensis G4] gi|134294441|ref|YP_001118176.1| elongation factor Tu [Burkholderia vietnamiensis G4] gi|387901015|ref|YP_006331354.1| translation elongation factor Tu [Burkholderia sp. KJ006] gi|387901028|ref|YP_006331367.1| translation elongation factor Tu [Burkholderia sp. KJ006] gi|189036643|sp|A4JAM5.1|EFTU_BURVG RecName: Full=Elongation factor Tu; Short=EF-Tu gi|134137585|gb|ABO53328.1| translation elongation factor Tu [Burkholderia vietnamiensis G4] gi|134137598|gb|ABO53341.1| translation elongation factor 1A (EF-1A/EF-Tu) [Burkholderia vietnamiensis G4] gi|387575907|gb|AFJ84623.1| Translation elongation factor Tu [Burkholderia sp. KJ006] gi|387575920|gb|AFJ84636.1| Translation elongation factor Tu [Burkholderia sp. KJ006] Back     alignment and taxonomy information
>gi|170704302|ref|ZP_02894842.1| translation elongation factor Tu [Burkholderia ambifaria IOP40-10] gi|170130789|gb|EDS99576.1| translation elongation factor Tu [Burkholderia ambifaria IOP40-10] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query502
TIGR_CMR|GSU_2859396 GSU_2859 "translation elongati 0.579 0.734 0.731 5.3e-111
TIGR_CMR|GSU_2871396 GSU_2871 "translation elongati 0.579 0.734 0.731 5.3e-111
TIGR_CMR|CBU_0223397 CBU_0223 "translation elongati 0.579 0.732 0.719 2.3e-110
TIGR_CMR|CBU_0236397 CBU_0236 "translation elongati 0.579 0.732 0.719 2.3e-110
UNIPROTKB|P0CE47394 tufA "elongation factor Tu" [E 0.575 0.733 0.704 6.3e-108
UNIPROTKB|P0CE48394 tufB "elongation factor Tu" [E 0.575 0.733 0.704 6.3e-108
TIGR_CMR|CPS_4764394 CPS_4764 "translation elongati 0.575 0.733 0.683 1.3e-107
TIGR_CMR|CPS_4780394 CPS_4780 "translation elongati 0.575 0.733 0.683 1.3e-107
UNIPROTKB|Q9KUZ6394 tufB "Elongation factor Tu-B" 0.575 0.733 0.697 2.1e-107
TIGR_CMR|VC_0362394 VC_0362 "elongation factor TU" 0.575 0.733 0.697 2.1e-107
TIGR_CMR|GSU_2859 GSU_2859 "translation elongation factor Tu" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
 Score = 1096 (390.9 bits), Expect = 5.3e-111, P = 5.3e-111
 Identities = 213/291 (73%), Positives = 236/291 (81%)

Query:     1 MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMXXXXXXXXXXX 60
             MITGAAQMDGAILV SAADGPMPQTREHILLARQVGVPYIVVFLNKADM           
Sbjct:    92 MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVE 151

Query:    61 XXXXXXXNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
                    + Y+FPG+DIPIIKGSA   L GD   LGE++IL L +A+D YIP P RA+D 
Sbjct:   152 LEIRELLSSYDFPGDDIPIIKGSALKGLNGDKDELGEEAILKLMEAVDNYIPEPERAVDK 211

Query:   121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
              FL+PVEDVFSISGRGTV TGRVERGIV+VGEE+EI+GIK T KTT TGVEMFRKLLD+G
Sbjct:   212 PFLMPVEDVFSISGRGTVATGRVERGIVKVGEEVEIVGIKATAKTTVTGVEMFRKLLDEG 271

Query:   181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
             +AGDNIG LLRG KRED+ERGQVLAKPGSI PH  F  E Y L+K+EGGRHTPFF+ YRP
Sbjct:   272 RAGDNIGALLRGVKREDIERGQVLAKPGSITPHTKFKAEAYILTKEEGGRHTPFFNGYRP 331

Query:   241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
             QFYFRTTDVTG ++LP   EMVMPGDNV +T+ LI PIAM+EGLRFAIREG
Sbjct:   332 QFYFRTTDVTGVVDLPAGTEMVMPGDNVAVTINLITPIAMDEGLRFAIREG 382
GO:0003746 "translation elongation factor activity" evidence=ISS
GO:0006414 "translational elongation" evidence=ISS
TIGR_CMR|GSU_2871 GSU_2871 "translation elongation factor Tu" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0223 CBU_0223 "translation elongation factor Tu" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0236 CBU_0236 "translation elongation factor Tu" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|P0CE47 tufA "elongation factor Tu" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|P0CE48 tufB "elongation factor Tu" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4764 CPS_4764 "translation elongation factor Tu" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4780 CPS_4780 "translation elongation factor Tu" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUZ6 tufB "Elongation factor Tu-B" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0362 VC_0362 "elongation factor TU" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3P0B5EFTU_BURP0No assigned EC number0.86590.57960.7348yesN/A
Q13TF5EFTU_BURXLNo assigned EC number0.87280.57960.7348yesN/A
A1V8A5EFTU_BURMSNo assigned EC number0.86590.57960.7348yesN/A
Q3JMP6EFTU_BURP1No assigned EC number0.86590.57960.7348yesN/A
Q39KI2EFTU_BURS3No assigned EC number0.87970.57960.7348yesN/A
Q63PZ6EFTU_BURPSNo assigned EC number0.86590.57960.7348yesN/A
Q1H4N9EFTU2_METFKNo assigned EC number0.82810.57960.7348yesN/A
A2S7F9EFTU_BURM9No assigned EC number0.86590.57960.7348yesN/A
A1KB29EFTU_AZOSBNo assigned EC number0.84870.57960.7348yesN/A
B0RU96EFTU2_XANCBNo assigned EC number0.78690.57960.7348yesN/A
Q46WC7EFTU_CUPPJNo assigned EC number0.86590.57960.7348yesN/A
A1WCN6EFTU2_ACISJNo assigned EC number0.86590.57960.7348yesN/A
Q1BRT3EFTU_BURCANo assigned EC number0.87970.57960.7348yesN/A
Q0BJ48EFTU_BURCMNo assigned EC number0.87970.57960.7348yesN/A
Q62GK3EFTU_BURMANo assigned EC number0.86590.57960.7348yesN/A
Q1LI13EFTU_RALMENo assigned EC number0.86590.57960.7348yesN/A
Q8XGZ0EFTU_RALSONo assigned EC number0.86250.57960.7348yesN/A
A4G9U0EFTU_HERARNo assigned EC number0.89340.57960.7348yesN/A
A3MRT8EFTU_BURM7No assigned EC number0.86590.57960.7348yesN/A
A1W2Q5EFTU1_ACISJNo assigned EC number0.86590.57960.7348yesN/A
Q5P334EFTU_AROAENo assigned EC number0.84870.57960.7348yesN/A
Q605B0EFTU_METCANo assigned EC number0.80750.57960.7348yesN/A
Q7M7F1EFTU_CHRVONo assigned EC number0.81090.57960.7348yesN/A
Q0AF46EFTU2_NITECNo assigned EC number0.80410.57960.7348yesN/A
Q21RV6EFTU2_RHOFDNo assigned EC number0.85560.57960.7348yesN/A
A3NEI1EFTU_BURP6No assigned EC number0.86590.57960.7348yesN/A
Q7TT91EFTU_BORPENo assigned EC number0.84190.57960.7348yesN/A
A6T3K6EFTU_JANMANo assigned EC number0.90030.57960.7348yesN/A
A4JAM5EFTU_BURVGNo assigned EC number0.87620.57960.7348yesN/A
Q123F6EFTU_POLSJNo assigned EC number0.85910.57960.7348yesN/A
B0RU84EFTU1_XANCBNo assigned EC number0.79030.57960.7348yesN/A
A2SLF9EFTU_METPPNo assigned EC number0.84870.57960.7348yesN/A
Q2YAZ9EFTU_NITMUNo assigned EC number0.79720.57960.7348yesN/A
A1TJ05EFTU_ACIACNo assigned EC number0.87280.57960.7348yesN/A
Q3SLQ1EFTU_THIDANo assigned EC number0.81090.57960.7348yesN/A
A1VIP8EFTU_POLNANo assigned EC number0.85560.57960.7348yesN/A
A4SUU7EFTU_POLSQNo assigned EC number0.86590.57960.7348yesN/A
Q79G84EFTU_BORBRNo assigned EC number0.84190.57960.7348yesN/A
Q2SU25EFTU_BURTANo assigned EC number0.86590.57960.7348yesN/A
Q79GC6EFTU_BORPANo assigned EC number0.84190.57960.7348yesN/A
Q21SF0EFTU1_RHOFDNo assigned EC number0.85560.57960.7348yesN/A
Q0AIJ7EFTU1_NITECNo assigned EC number0.80750.57960.7348yesN/A
Q81ZS3EFTU_NITEUNo assigned EC number0.81090.57960.7348yesN/A
A1WHC3EFTU_VEREINo assigned EC number0.86590.57960.7348yesN/A
Q0K5Z9EFTU_CUPNHNo assigned EC number0.87620.57960.7348yesN/A
Q1H4Q1EFTU1_METFKNo assigned EC number0.82810.57960.7348yesN/A
Q2L2G6EFTU_BORA1No assigned EC number0.83840.57960.7348yesN/A
A0K3L0EFTU_BURCHNo assigned EC number0.87970.57960.7348yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
PRK00049396 PRK00049, PRK00049, elongation factor Tu; Reviewed 0.0
PRK12735396 PRK12735, PRK12735, elongation factor Tu; Reviewed 0.0
PRK12736394 PRK12736, PRK12736, elongation factor Tu; Reviewed 0.0
COG0050394 COG0050, TufB, GTPases - translation elongation fa 0.0
TIGR00485394 TIGR00485, EF-Tu, translation elongation factor TU 0.0
PLN03127447 PLN03127, PLN03127, Elongation factor Tu; Provisio 1e-178
CHL00071409 CHL00071, tufA, elongation factor Tu 1e-175
PLN03126478 PLN03126, PLN03126, Elongation factor Tu; Provisio 1e-142
PRK05609181 PRK05609, nusG, transcription antitermination prot 4e-94
cd01884195 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-b 3e-75
TIGR00922172 TIGR00922, nusG, transcription termination/antiter 2e-73
COG0250178 COG0250, NusG, Transcription antiterminator [Trans 8e-69
cd0370790 cd03707, EFTU_III, Domain III of elongation factor 2e-50
cd0369787 cd03697, EFTU_II, EFTU_II: Elongation factor Tu do 4e-50
cd09891107 cd09891, NGN_Bact_1, Bacterial N-Utilization Subst 1e-46
COG5256428 COG5256, TEF1, Translation elongation factor EF-1a 2e-44
PRK12317425 PRK12317, PRK12317, elongation factor 1-alpha; Rev 2e-44
pfam00009184 pfam00009, GTP_EFTU, Elongation factor Tu GTP bind 2e-39
TIGR00483426 TIGR00483, EF-1_alpha, translation elongation fact 6e-36
pfam0314391 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-ter 7e-36
COG3276447 COG3276, SelB, Selenocysteine-specific translation 5e-34
COG5258527 COG5258, GTPBP1, GTPase [General function predicti 7e-32
smart00738106 smart00738, NGN, In Spt5p, this domain may confer 7e-32
TIGR00475581 TIGR00475, selB, selenocysteine-specific elongatio 1e-28
cd0370693 cd03706, mtEFTU_III, Domain III of mitochondrial E 2e-26
TIGR03680406 TIGR03680, eif2g_arch, translation initiation fact 1e-25
PRK10512614 PRK10512, PRK10512, selenocysteinyl-tRNA-specific 1e-23
PTZ00141446 PTZ00141, PTZ00141, elongation factor 1- alpha; Pr 1e-23
cd00881183 cd00881, GTP_translation_factor, GTP translation f 2e-22
PRK04000411 PRK04000, PRK04000, translation initiation factor 5e-21
COG5257415 COG5257, GCD11, Translation initiation factor 2, g 1e-20
cd0369683 cd03696, selB_II, selB_II: this subfamily represen 5e-20
pfam0235790 pfam02357, NusG, Transcription termination factor 1e-19
cd0609156 cd06091, KOW_NusG, NusG contains an NGN domain at 6e-19
COG2895431 COG2895, CysN, GTPases - Sulfate adenylate transfe 3e-18
pfam0314470 pfam03144, GTP_EFTU_D2, Elongation factor Tu domai 9e-18
PLN00043447 PLN00043, PLN00043, elongation factor 1-alpha; Pro 9e-18
cd0134283 cd01342, Translation_Factor_II_like, Translation_F 4e-17
cd0800099 cd08000, NGN, N-Utilization Substance G (NusG) N-t 1e-16
cd04171170 cd04171, SelB, SelB, the dedicated elongation fact 2e-16
cd01883219 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1 5e-16
PRK05124474 PRK05124, cysN, sulfate adenylyltransferase subuni 4e-15
cd0369391 cd03693, EF1_alpha_II, EF1_alpha_II: this family r 1e-14
cd04166209 cd04166, CysN_ATPS, CysN, together with protein Cy 3e-13
PTZ00327460 PTZ00327, PTZ00327, eukaryotic translation initiat 4e-13
TIGR01956258 TIGR01956, NusG_myco, NusG family protein 2e-12
cd01888197 cd01888, eIF2_gamma, Gamma subunit of initiation f 2e-12
TIGR01955159 TIGR01955, RfaH, transcriptional activator RfaH 3e-12
TIGR02034406 TIGR02034, CysN, sulfate adenylyltransferase, larg 4e-12
PRK05506632 PRK05506, PRK05506, bifunctional sulfate adenylylt 7e-12
cd01887169 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ euk 1e-11
TIGR01394594 TIGR01394, TypA_BipA, GTP-binding protein TypA/Bip 2e-10
cd01513102 cd01513, Translation_factor_III, Domain III of Elo 5e-10
COG1217603 COG1217, TypA, Predicted membrane GTPase involved 8e-10
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 2e-08
COG0532509 COG0532, InfB, Translation initiation factor 2 (IF 2e-08
cd0369883 cd03698, eRF3_II_like, eRF3_II_like: domain simila 2e-07
cd01889192 cd01889, SelB_euk, SelB, the dedicated elongation 2e-07
cd0369487 cd03694, GTPBP_II, Domain II of the GP-1 family of 2e-07
cd0369581 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamil 2e-07
cd09890113 cd09890, NGN_plant, Plant N-Utilization Substance 2e-07
TIGR00487587 TIGR00487, IF-2, translation initiation factor IF- 5e-07
cd0989395 cd09893, NGN_SP_TaA, N-Utilization Substance G (Nu 8e-07
cd09889100 cd09889, NGN_Bact_2, Bacterial N-Utilization Subst 2e-06
cd01891194 cd01891, TypA_BipA, Tyrosine phosphorylated protei 2e-06
PRK10218607 PRK10218, PRK10218, GTP-binding protein; Provision 6e-06
cd0408982 cd04089, eRF3_II, eRF3_II: domain II of the eukary 9e-06
PRK05306746 PRK05306, infB, translation initiation factor IF-2 6e-05
cd04168237 cd04168, TetM_like, Tet(M)-like family includes Te 2e-04
PRK13351687 PRK13351, PRK13351, elongation factor G; Reviewed 3e-04
cd00880161 cd00880, Era_like, E 3e-04
cd0989296 cd09892, NGN_SP_RfaH, N-Utilization Substance G (N 4e-04
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 5e-04
COG0480 697 COG0480, FusA, Translation elongation factors (GTP 0.001
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 0.002
>gnl|CDD|234596 PRK00049, PRK00049, elongation factor Tu; Reviewed Back     alignment and domain information 
 Score =  649 bits (1678), Expect = 0.0
 Identities = 234/291 (80%), Positives = 257/291 (88%)

Query: 1   MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVE 60
           MITGAAQMDGAILV SAADGPMPQTREHILLARQVGVPYIVVFLNK DMVDDEELLELVE
Sbjct: 92  MITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVE 151

Query: 61  IEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
           +E+RELL+KY+FPG+D PII+GSA  ALEGD     E+ IL L  A+D+YIPTP RAID 
Sbjct: 152 MEVRELLSKYDFPGDDTPIIRGSALKALEGDDDEEWEKKILELMDAVDSYIPTPERAIDK 211

Query: 121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
            FL+P+EDVFSISGRGTVVTGRVERGI++VGEE+EI+GI+DT KTT TGVEMFRKLLD+G
Sbjct: 212 PFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIRDTQKTTVTGVEMFRKLLDEG 271

Query: 181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
           QAGDN+G LLRG KREDVERGQVLAKPGSI PH  F  E+Y LSK+EGGRHTPFF+ YRP
Sbjct: 272 QAGDNVGALLRGIKREDVERGQVLAKPGSITPHTKFEAEVYVLSKEEGGRHTPFFNGYRP 331

Query: 241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
           QFYFRTTDVTG IELP+  EMVMPGDNV +TV LI PIAMEEGLRFAIREG
Sbjct: 332 QFYFRTTDVTGVIELPEGVEMVMPGDNVEMTVELIAPIAMEEGLRFAIREG 382

Length = 396
>gnl|CDD|183708 PRK12735, PRK12735, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|237184 PRK12736, PRK12736, elongation factor Tu; Reviewed Back     alignment and domain information
>gnl|CDD|223128 COG0050, TufB, GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129576 TIGR00485, EF-Tu, translation elongation factor TU Back     alignment and domain information
>gnl|CDD|178673 PLN03127, PLN03127, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|177010 CHL00071, tufA, elongation factor Tu Back     alignment and domain information
>gnl|CDD|215592 PLN03126, PLN03126, Elongation factor Tu; Provisional Back     alignment and domain information
>gnl|CDD|180161 PRK05609, nusG, transcription antitermination protein NusG; Validated Back     alignment and domain information
>gnl|CDD|206671 cd01884, EF_Tu, Elongation Factor Tu (EF-Tu) GTP-binding proteins Back     alignment and domain information
>gnl|CDD|233188 TIGR00922, nusG, transcription termination/antitermination factor NusG Back     alignment and domain information
>gnl|CDD|223328 COG0250, NusG, Transcription antiterminator [Transcription] Back     alignment and domain information
>gnl|CDD|239678 cd03707, EFTU_III, Domain III of elongation factor (EF) Tu Back     alignment and domain information
>gnl|CDD|239668 cd03697, EFTU_II, EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>gnl|CDD|193580 cd09891, NGN_Bact_1, Bacterial N-Utilization Substance G (NusG) N-terminal (NGN) domain, subgroup 1 Back     alignment and domain information
>gnl|CDD|227581 COG5256, TEF1, Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237055 PRK12317, PRK12317, elongation factor 1-alpha; Reviewed Back     alignment and domain information
>gnl|CDD|215653 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|129574 TIGR00483, EF-1_alpha, translation elongation factor EF-1 alpha Back     alignment and domain information
>gnl|CDD|217387 pfam03143, GTP_EFTU_D3, Elongation factor Tu C-terminal domain Back     alignment and domain information
>gnl|CDD|225815 COG3276, SelB, Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|227583 COG5258, GTPBP1, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|197850 smart00738, NGN, In Spt5p, this domain may confer affinity for Spt4p Back     alignment and domain information
>gnl|CDD|129567 TIGR00475, selB, selenocysteine-specific elongation factor SelB Back     alignment and domain information
>gnl|CDD|239677 cd03706, mtEFTU_III, Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>gnl|CDD|211860 TIGR03680, eif2g_arch, translation initiation factor 2 subunit gamma Back     alignment and domain information
>gnl|CDD|182508 PRK10512, PRK10512, selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>gnl|CDD|185474 PTZ00141, PTZ00141, elongation factor 1- alpha; Provisional Back     alignment and domain information
>gnl|CDD|206647 cd00881, GTP_translation_factor, GTP translation factor family primarily contains translation initiation, elongation and release factors Back     alignment and domain information
>gnl|CDD|235194 PRK04000, PRK04000, translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>gnl|CDD|227582 COG5257, GCD11, Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239667 cd03696, selB_II, selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|216991 pfam02357, NusG, Transcription termination factor nusG Back     alignment and domain information
>gnl|CDD|240515 cd06091, KOW_NusG, NusG contains an NGN domain at its N-terminus and KOW motif at its C-terminus Back     alignment and domain information
>gnl|CDD|225448 COG2895, CysN, GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|217388 pfam03144, GTP_EFTU_D2, Elongation factor Tu domain 2 Back     alignment and domain information
>gnl|CDD|165621 PLN00043, PLN00043, elongation factor 1-alpha; Provisional Back     alignment and domain information
>gnl|CDD|238652 cd01342, Translation_Factor_II_like, Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>gnl|CDD|193574 cd08000, NGN, N-Utilization Substance G (NusG) N-terminal (NGN) domain Superfamily Back     alignment and domain information
>gnl|CDD|206734 cd04171, SelB, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|206670 cd01883, EF1_alpha, Elongation Factor 1-alpha (EF1-alpha) protein family Back     alignment and domain information
>gnl|CDD|235349 PRK05124, cysN, sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|239664 cd03693, EF1_alpha_II, EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>gnl|CDD|206729 cd04166, CysN_ATPS, CysN, together with protein CysD, forms the ATP sulfurylase (ATPS) complex Back     alignment and domain information
>gnl|CDD|240362 PTZ00327, PTZ00327, eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>gnl|CDD|233655 TIGR01956, NusG_myco, NusG family protein Back     alignment and domain information
>gnl|CDD|206675 cd01888, eIF2_gamma, Gamma subunit of initiation factor 2 (eIF2 gamma) Back     alignment and domain information
>gnl|CDD|131010 TIGR01955, RfaH, transcriptional activator RfaH Back     alignment and domain information
>gnl|CDD|213679 TIGR02034, CysN, sulfate adenylyltransferase, large subunit Back     alignment and domain information
>gnl|CDD|180120 PRK05506, PRK05506, bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>gnl|CDD|206674 cd01887, IF2_eIF5B, Initiation Factor 2 (IF2)/ eukaryotic Initiation Factor 5B (eIF5B) family Back     alignment and domain information
>gnl|CDD|233394 TIGR01394, TypA_BipA, GTP-binding protein TypA/BipA Back     alignment and domain information
>gnl|CDD|238771 cd01513, Translation_factor_III, Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>gnl|CDD|224138 COG1217, TypA, Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|223606 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|239669 cd03698, eRF3_II_like, eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|206676 cd01889, SelB_euk, SelB, the dedicated elongation factor for delivery of selenocysteinyl-tRNA to the ribosome Back     alignment and domain information
>gnl|CDD|239665 cd03694, GTPBP_II, Domain II of the GP-1 family of GTPase Back     alignment and domain information
>gnl|CDD|239666 cd03695, CysN_NodQ_II, CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>gnl|CDD|193579 cd09890, NGN_plant, Plant N-Utilization Substance G (NusG) N-terminal (NGN) domain Back     alignment and domain information
>gnl|CDD|232995 TIGR00487, IF-2, translation initiation factor IF-2 Back     alignment and domain information
>gnl|CDD|193582 cd09893, NGN_SP_TaA, N-Utilization Substance G (NusG) N-terminal domain in the NusG Specialized Paralog (SP), TaA Back     alignment and domain information
>gnl|CDD|193578 cd09889, NGN_Bact_2, Bacterial N-Utilization Substance G (NusG) N-terminal (NGN) domain, subgroup 2 Back     alignment and domain information
>gnl|CDD|206678 cd01891, TypA_BipA, Tyrosine phosphorylated protein A (TypA)/BipA family belongs to ribosome-binding GTPases Back     alignment and domain information
>gnl|CDD|104396 PRK10218, PRK10218, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|239756 cd04089, eRF3_II, eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|206731 cd04168, TetM_like, Tet(M)-like family includes Tet(M), Tet(O), Tet(W), and OtrA, containing tetracycline resistant proteins Back     alignment and domain information
>gnl|CDD|237358 PRK13351, PRK13351, elongation factor G; Reviewed Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|193581 cd09892, NGN_SP_RfaH, N-Utilization Substance G (NusG) N-terminal domain in the NusG Specialized Paralog (SP), RfaH Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|223556 COG0480, FusA, Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 502
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 100.0
COG0050394 TufB GTPases - translation elongation factors [Tra 100.0
KOG0460|consensus449 100.0
PRK12736394 elongation factor Tu; Reviewed 100.0
TIGR00485394 EF-Tu translation elongation factor TU. This align 100.0
PLN03126478 Elongation factor Tu; Provisional 100.0
PLN03127447 Elongation factor Tu; Provisional 100.0
PRK12735396 elongation factor Tu; Reviewed 100.0
PRK00049396 elongation factor Tu; Reviewed 100.0
CHL00071409 tufA elongation factor Tu 100.0
PLN00043447 elongation factor 1-alpha; Provisional 100.0
PTZ00141446 elongation factor 1- alpha; Provisional 100.0
COG2895431 CysN GTPases - Sulfate adenylate transferase subun 100.0
PRK12317425 elongation factor 1-alpha; Reviewed 100.0
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 100.0
KOG0458|consensus603 100.0
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 100.0
KOG0459|consensus501 100.0
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 100.0
PTZ00327460 eukaryotic translation initiation factor 2 gamma s 100.0
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 100.0
COG5258527 GTPBP1 GTPase [General function prediction only] 100.0
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 100.0
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 100.0
PRK04000411 translation initiation factor IF-2 subunit gamma; 100.0
COG3276447 SelB Selenocysteine-specific translation elongatio 100.0
TIGR00475581 selB selenocysteine-specific elongation factor Sel 100.0
PRK05609181 nusG transcription antitermination protein NusG; V 100.0
TIGR00922172 nusG transcription termination/antitermination fac 100.0
KOG0463|consensus641 100.0
COG0250178 NusG Transcription antiterminator [Transcription] 100.0
KOG1143|consensus591 100.0
PRK09014162 rfaH transcriptional activator RfaH; Provisional 100.0
TIGR01955159 RfaH transcriptional activator RfaH. This model re 100.0
TIGR01956258 NusG_myco NusG family protein. This model represen 100.0
COG5257415 GCD11 Translation initiation factor 2, gamma subun 100.0
PRK08559153 nusG transcription antitermination protein NusG; V 99.95
KOG0461|consensus522 99.94
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.93
TIGR00405145 L26e_arch ribosomal protein L24p/L26e, archaeal. T 99.93
COG1217603 TypA Predicted membrane GTPase involved in stress 99.92
PRK10218607 GTP-binding protein; Provisional 99.91
KOG0466|consensus466 99.9
smart00738106 NGN In Spt5p, this domain may confer affinity for 99.88
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.88
PRK05433600 GTP-binding protein LepA; Provisional 99.87
COG0481603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.87
KOG0462|consensus650 99.86
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 99.81
PF0235792 NusG: Transcription termination factor nusG; Inter 99.81
PRK05306787 infB translation initiation factor IF-2; Validated 99.8
PRK00007693 elongation factor G; Reviewed 99.8
PRK07560731 elongation factor EF-2; Reviewed 99.79
KOG0052|consensus391 99.78
PRK12739691 elongation factor G; Reviewed 99.78
PRK04004586 translation initiation factor IF-2; Validated 99.78
PRK00741526 prfC peptide chain release factor 3; Provisional 99.76
CHL00189742 infB translation initiation factor 2; Provisional 99.75
TIGR00484689 EF-G translation elongation factor EF-G. After pep 99.75
PRK148451049 translation initiation factor IF-2; Provisional 99.75
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.75
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.75
PRK12740668 elongation factor G; Reviewed 99.74
cd0369391 EF1_alpha_II EF1_alpha_II: this family represents 99.74
PRK13351687 elongation factor G; Reviewed 99.74
TIGR00503527 prfC peptide chain release factor 3. This translat 99.73
COG0480697 FusA Translation elongation factors (GTPases) [Tra 99.73
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 99.73
KOG1145|consensus683 99.72
TIGR00490720 aEF-2 translation elongation factor aEF-2. This mo 99.7
cd0369883 eRF3_II_like eRF3_II_like: domain similar to domai 99.69
cd0369487 GTPBP_II Domain II of the GP-1 family of GTPase. T 99.68
KOG0465|consensus721 99.67
COG4108528 PrfC Peptide chain release factor RF-3 [Translatio 99.67
cd0369787 EFTU_II EFTU_II: Elongation factor Tu domain II. E 99.67
cd0408982 eRF3_II eRF3_II: domain II of the eukaryotic class 99.65
PLN00116843 translation elongation factor EF-2 subunit; Provis 99.63
PF0314399 GTP_EFTU_D3: Elongation factor Tu C-terminal domai 99.62
cd0369683 selB_II selB_II: this subfamily represents the dom 99.6
cd0370693 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF 99.6
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.59
PTZ00416836 elongation factor 2; Provisional 99.59
cd0369581 CysN_NodQ_II CysN_NodQ_II: This subfamily represen 99.57
cd0370790 EFTU_III Domain III of elongation factor (EF) Tu. 99.55
cd03704108 eRF3c_III This family represents eEF1alpha-like C- 99.53
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.52
cd03705104 EF1_alpha_III Domain III of EF-1. Eukaryotic elong 99.5
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.48
cd04093107 HBS1_C HBS1_C: this family represents the C-termin 99.47
KOG1144|consensus1064 99.46
cd0370887 GTPBP_III Domain III of the GP-1 family of GTPase. 99.46
cd01513102 Translation_factor_III Domain III of Elongation fa 99.42
cd0409497 selB_III This family represents the domain of elon 99.42
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.29
cd04095103 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily repres 99.27
cd03688113 eIF2_gamma_II eIF2_gamma_II: this subfamily repres 99.26
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.26
KOG0469|consensus842 99.21
cd0369284 mtIF2_IVc mtIF2_IVc: this family represents the C2 99.16
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.11
KOG0468|consensus 971 99.06
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.06
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.05
COG1160444 Predicted GTPases [General function prediction onl 99.02
COG1159298 Era GTPase [General function prediction only] 99.0
PF0314474 GTP_EFTU_D2: Elongation factor Tu domain 2; InterP 98.99
cd04171164 SelB SelB subfamily. SelB is an elongation factor 98.95
cd0134283 Translation_Factor_II_like Translation_Factor_II_l 98.95
cd00881189 GTP_translation_factor GTP translation factor fami 98.87
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 98.86
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 98.85
KOG0464|consensus753 98.84
cd0369085 Tet_II Tet_II: This subfamily represents domain II 98.84
COG1160444 Predicted GTPases [General function prediction onl 98.83
cd0409283 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondri 98.82
KOG0467|consensus 887 98.8
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.78
cd0369186 BipA_TypA_II BipA_TypA_II: domain II of BipA (also 98.76
cd0408883 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represen 98.76
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.74
TIGR00436270 era GTP-binding protein Era. Era is an essential G 98.74
cd0369986 lepA_II lepA_II: This subfamily represents the dom 98.72
PRK00093435 GTP-binding protein Der; Reviewed 98.71
PRK15494339 era GTPase Era; Provisional 98.7
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 98.7
cd0368985 RF3_II RF3_II: this subfamily represents the domai 98.68
PF1457881 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1 98.68
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 98.67
cd0409181 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondri 98.64
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 98.59
PRK00089292 era GTPase Era; Reviewed 98.55
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 98.54
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 98.5
PRK03003472 GTP-binding protein Der; Reviewed 98.47
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 98.46
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 98.44
PRK15467158 ethanolamine utilization protein EutP; Provisional 98.44
cd0370093 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfami 98.44
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.43
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.42
cd0409094 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C termina 98.4
PRK09866741 hypothetical protein; Provisional 98.38
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.35
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 98.32
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 98.32
PF0046732 KOW: KOW motif; InterPro: IPR005824 Ribosomes are 98.3
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 98.25
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 98.23
PRK12298390 obgE GTPase CgtA; Reviewed 98.22
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.2
COG0218200 Predicted GTPase [General function prediction only 98.18
PRK04213201 GTP-binding protein; Provisional 98.17
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.14
PRK00454196 engB GTP-binding protein YsxC; Reviewed 98.14
PF0343984 Spt5-NGN: Early transcription elongation factor of 98.06
PRK03003472 GTP-binding protein Der; Reviewed 98.04
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 98.01
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 98.01
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.0
PRK00093435 GTP-binding protein Der; Reviewed 98.0
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.0
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.99
PRK12289352 GTPase RsgA; Reviewed 97.99
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 97.98
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 97.97
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.97
PRK00098298 GTPase RsgA; Reviewed 97.96
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 97.96
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 97.95
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 97.93
PRK01889356 GTPase RsgA; Reviewed 97.9
PRK13768253 GTPase; Provisional 97.89
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 97.85
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 97.84
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 97.84
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 97.8
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 97.79
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 97.77
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif i 97.76
PRK09563287 rbgA GTPase YlqF; Reviewed 97.75
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.72
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 97.71
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 97.71
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 97.71
PF0917388 eIF2_C: Initiation factor eIF2 gamma, C terminal; 97.7
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 97.7
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 97.68
PRK12288347 GTPase RsgA; Reviewed 97.68
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.66
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 97.66
PRK12299335 obgE GTPase CgtA; Reviewed 97.66
cd01881176 Obg_like The Obg-like subfamily consists of five w 97.64
COG2229187 Predicted GTPase [General function prediction only 97.64
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 97.62
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 97.6
COG1162301 Predicted GTPases [General function prediction onl 97.6
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 97.59
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 97.59
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 97.59
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.58
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 97.57
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.56
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 97.56
PRK12296500 obgE GTPase CgtA; Reviewed 97.54
smart00178184 SAR Sar1p-like members of the Ras-family of small 97.54
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 97.54
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 97.53
COG0486454 ThdF Predicted GTPase [General function prediction 97.52
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 97.51
PRK12297424 obgE GTPase CgtA; Reviewed 97.49
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 97.49
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 97.48
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 97.47
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 97.47
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 97.47
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 97.46
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 97.45
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 97.45
PLN00223181 ADP-ribosylation factor; Provisional 97.44
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 97.43
PRK09435332 membrane ATPase/protein kinase; Provisional 97.43
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 97.43
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 97.43
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 97.42
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 97.41
KOG1999|consensus 1024 97.38
PRK13796365 GTPase YqeH; Provisional 97.37
TIGR00437591 feoB ferrous iron transporter FeoB. FeoB (773 amin 97.37
cd03703110 aeIF5B_II aeIF5B_II: This family represents the do 97.37
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 97.37
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 97.35
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 97.35
PTZ00099176 rab6; Provisional 97.35
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 97.33
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 97.33
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 97.33
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 97.33
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 97.31
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 97.3
cd0370295 IF2_mtIF2_II This family represents the domain II 97.29
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 97.28
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 97.28
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 97.28
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 97.27
cd00154159 Rab Rab family. Rab GTPases form the largest famil 97.27
PTZ00133182 ADP-ribosylation factor; Provisional 97.26
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 97.26
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 97.25
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 97.25
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 97.25
CHL0014183 rpl24 ribosomal protein L24; Validated 97.24
COG2262411 HflX GTPases [General function prediction only] 97.23
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 97.23
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 97.23
PRK05306787 infB translation initiation factor IF-2; Validated 97.22
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.21
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 97.2
PRK1228176 rplX 50S ribosomal protein L24; Reviewed 97.2
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.19
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 97.19
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 97.19
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 97.18
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 97.17
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 97.16
PRK11058426 GTPase HflX; Provisional 97.15
KOG1489|consensus366 97.15
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 97.15
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 97.14
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 97.14
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 97.14
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 97.12
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 97.12
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 97.11
PTZ00369189 Ras-like protein; Provisional 97.1
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 97.1
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 97.1
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 97.09
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 97.09
cd04123162 Rab21 Rab21 subfamily. The localization and functi 97.09
PF00025175 Arf: ADP-ribosylation factor family The prints ent 97.08
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.08
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 97.07
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 97.04
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 97.04
cd00876160 Ras Ras family. The Ras family of the Ras superfam 97.04
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 97.04
CHL00189742 infB translation initiation factor 2; Provisional 97.03
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 96.99
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 96.99
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 96.96
PRK01191120 rpl24p 50S ribosomal protein L24P; Validated 96.95
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 96.93
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 96.91
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 96.9
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 96.9
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 96.86
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 96.85
cd0370195 IF2_IF5B_II IF2_IF5B_II: This family represents th 96.84
KOG0092|consensus200 96.82
COG0532509 InfB Translation initiation factor 2 (IF-2; GTPase 96.79
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 96.77
TIGR00101199 ureG urease accessory protein UreG. This model rep 96.77
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 96.76
PLN03110216 Rab GTPase; Provisional 96.7
PRK00004105 rplX 50S ribosomal protein L24; Reviewed 96.69
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 96.69
TIGR01080114 rplX_A_E ribosomal protein L24p/L26e, archaeal/euk 96.69
KOG1423|consensus379 96.69
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 96.68
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 96.68
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 96.64
PLN03118211 Rab family protein; Provisional 96.6
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 96.54
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 96.53
TIGR01079104 rplX_bact ribosomal protein L24, bacterial/organel 96.53
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 96.44
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 96.43
PLN03108210 Rab family protein; Provisional 96.41
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 96.37
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 96.36
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 96.34
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 96.34
PLN03071219 GTP-binding nuclear protein Ran; Provisional 96.29
cd01896233 DRG The developmentally regulated GTP-binding prot 96.27
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 96.13
PTZ00194143 60S ribosomal protein L26; Provisional 96.12
KOG0072|consensus182 96.12
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 96.01
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 95.84
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.82
PRK04004586 translation initiation factor IF-2; Validated 95.78
KOG0076|consensus197 95.71
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 95.67
COG0536369 Obg Predicted GTPase [General function prediction 95.62
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 95.6
COG0370653 FeoB Fe2+ transport system protein B [Inorganic io 95.55
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 95.55
PRK148451049 translation initiation factor IF-2; Provisional 95.46
KOG0094|consensus221 95.16
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 95.14
KOG1191|consensus531 95.14
KOG0070|consensus181 95.12
COG0198104 RplX Ribosomal protein L24 [Translation, ribosomal 95.02
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 94.98
PF1162353 DUF3252: Protein of unknown function (DUF3252); In 94.87
COG4917148 EutP Ethanolamine utilization protein [Amino acid 94.66
COG1163365 DRG Predicted GTPase [General function prediction 94.58
KOG0075|consensus186 94.55
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 94.47
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 94.45
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 94.32
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 94.3
KOG0073|consensus185 94.06
COG1149284 MinD superfamily P-loop ATPase containing an inser 93.63
COG3596296 Predicted GTPase [General function prediction only 93.55
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 93.52
cd04105203 SR_beta Signal recognition particle receptor, beta 93.42
KOG2486|consensus320 93.36
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 93.3
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 93.21
KOG1424|consensus562 92.77
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 92.42
KOG2484|consensus435 92.25
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.7
KOG0078|consensus207 91.57
KOG1532|consensus366 91.04
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 91.03
COG1084346 Predicted GTPase [General function prediction only 90.86
cd03110179 Fer4_NifH_child This protein family's function is 90.81
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 90.12
KOG0071|consensus180 90.08
KOG0084|consensus205 90.03
KOG0088|consensus218 89.21
KOG0093|consensus193 88.78
KOG0090|consensus238 87.8
KOG0448|consensus749 87.06
COG1161322 Predicted GTPases [General function prediction onl 87.03
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 87.0
PF09439181 SRPRB: Signal recognition particle receptor beta s 86.88
PRK09602396 translation-associated GTPase; Reviewed 86.76
COG213998 RPL21A Ribosomal protein L21E [Translation, riboso 86.61
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 86.55
KOG1954|consensus532 86.23
KOG1999|consensus 1024 85.93
KOG0098|consensus216 85.68
KOG1145|consensus683 84.82
COG5164 607 SPT5 Transcription elongation factor [Transcriptio 83.97
PLN00023334 GTP-binding protein; Provisional 82.57
KOG0083|consensus192 81.43
KOG2423|consensus572 81.08
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=8.6e-56  Score=426.78  Aligned_cols=292  Identities=33%  Similarity=0.509  Sum_probs=268.4

Q ss_pred             CccccccCCEEEEEEECCCC-------CCcchHHHHHHHHHhCCCeEEEEEEcCCCCCh-HHHHHHHHHHHHHHHhhcCC
Q psy15224          1 MITGAAQMDGAILVCSAADG-------PMPQTREHILLARQVGVPYIVVFLNKADMVDD-EELLELVEIEIRELLNKYEF   72 (502)
Q Consensus         1 mi~g~~~~D~ailvVda~~g-------~~~qt~e~l~~~~~~~i~~iiv~iNK~D~~~~-~~~~~~i~~~i~~~l~~~~~   72 (502)
                      ||+|+++||+|||||||..|       ..+||+||+.+++.+|+.++||||||||+++| +++|++++++++.+++.+||
T Consensus       102 mItGasqAD~aVLVV~a~~~efE~g~~~~gQtrEH~~La~tlGi~~lIVavNKMD~v~wde~rf~ei~~~v~~l~k~~G~  181 (428)
T COG5256         102 MITGASQADVAVLVVDARDGEFEAGFGVGGQTREHAFLARTLGIKQLIVAVNKMDLVSWDEERFEEIVSEVSKLLKMVGY  181 (428)
T ss_pred             hhcchhhccEEEEEEECCCCccccccccCCchhHHHHHHHhcCCceEEEEEEcccccccCHHHHHHHHHHHHHHHHHcCC
Confidence            89999999999999999998       88999999999999999999999999999999 88999999999999999999


Q ss_pred             CCCCCeEEEccccccccC-----CCCCCCcccHHHHHHHHhhcCCCCCCCCCCCeeEEEeEEEeeCCCeEEEEEEEEEee
Q psy15224         73 PGNDIPIIKGSAKLALEG-----DTGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGI  147 (502)
Q Consensus        73 ~~~~~~ii~iSa~~g~~~-----~~~w~~~~~i~~Ll~~l~~~~p~~~~~~~~p~~~~v~~~~~~~~~G~v~~g~v~sG~  147 (502)
                      +..+++|||+||.+|.|.     .++||+|+   +|+++|+. +..|.+..+.||+++|++++++.+.|++..|||++|.
T Consensus       182 ~~~~v~FIPiSg~~G~Nl~~~s~~~pWY~Gp---TLleaLd~-~~~p~~~~d~Plr~pI~~v~~i~~~gtv~vGrVEsG~  257 (428)
T COG5256         182 NPKDVPFIPISGFKGDNLTKKSENMPWYKGP---TLLEALDQ-LEPPERPLDKPLRLPIQDVYSISGIGTVPVGRVESGV  257 (428)
T ss_pred             CccCCeEEecccccCCcccccCcCCcCccCC---hHHHHHhc-cCCCCCCCCCCeEeEeeeEEEecCCceEEEEEEeeee
Confidence            988899999999999982     46999877   56777773 6677888999999999999999999999999999999


Q ss_pred             eecCCEEEEeecCCCeeEEEEEEEEcceecceeecCCeEEEEecCCCccCcccceEEeCCCCCC-cccEEEEEEEEeecC
Q psy15224        148 VRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIK-PHKHFTGEIYALSKD  226 (502)
Q Consensus       148 l~~gd~v~i~p~~~~~~~~V~~i~~~~~~v~~a~aG~~v~l~l~~~~~~~i~~G~vl~~~~~~~-~~~~f~a~v~~l~~~  226 (502)
                      |++||++++.|.  +...+|+||++++++.+.|.+||.|+++++++...+|++|++++++++++ .+..|.|++.+++++
T Consensus       258 i~~g~~v~~~p~--~~~~evksie~~~~~~~~a~~GD~i~~~vrgv~~~dI~~Gdv~~~~~n~~t~s~~f~a~i~vl~~p  335 (428)
T COG5256         258 IKPGQKVTFMPA--GVVGEVKSIEMHHEEISQAEPGDNVGFNVRGVEKNDIRRGDVIGHSDNPPTVSPEFTAQIIVLWHP  335 (428)
T ss_pred             eccCCEEEEecC--cceEEEeeeeecccccccCCCCCeEEEEecCCchhccCCccEeccCCCCcccccceEEEEEEEecC
Confidence            999999999984  47889999999999999999999999999999999999999999998764 447999999999997


Q ss_pred             CCCCCcccccCCeeEEEeeeeeEEEEEE-------------ccCCCccccCCCEEEEEEEeCceEecccC------CeEE
Q psy15224        227 EGGRHTPFFSNYRPQFYFRTTDVTGSIE-------------LPKNKEMVMPGDNVLITVRLINPIAMEEG------LRFA  287 (502)
Q Consensus       227 ~~~~~~~i~~g~~~~~~~~~~~~~~~i~-------------~~~~~~~~~~~~~~~v~~~~~~pi~~~~~------~r~i  287 (502)
                           +.+.+||++.+|+++..++|++.             ..+.+.+++.|+.+.+++++.+|+|++..      +||+
T Consensus       336 -----~~i~~Gyt~vlh~hta~~a~~~~~l~~k~d~~t~k~~~~~p~f~k~g~~~iv~i~~~kP~~~e~~~~~~~Lgrfa  410 (428)
T COG5256         336 -----GIITSGYTPVLHAHTAQVACRIAELLSKLDPRTGKKLEENPQFLKRGDAAIVKIEPEKPLCLEKVSEIPQLGRFA  410 (428)
T ss_pred             -----ccccCCCccEEEecccceeeeHHHHHHhhCcccccccccChhhhhcCceEEEEEEecCceEeeecccCCccceEE
Confidence                 68999999999999999999883             12346789999999999999999999964      6999


Q ss_pred             EEeCCeEEEEEEEeec
Q psy15224        288 IREGVQQFIQDNLLTK  303 (502)
Q Consensus       288 lr~~~~~ig~G~i~~~  303 (502)
                      |||.|+|||+|.|++.
T Consensus       411 lrd~g~tIA~G~v~~v  426 (428)
T COG5256         411 LRDMGQTIAAGKVLEV  426 (428)
T ss_pred             EEeCCCeEEeEEEEec
Confidence            9999999999999864

>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0460|consensus Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>KOG0458|consensus Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>KOG0459|consensus Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK05609 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>TIGR00922 nusG transcription termination/antitermination factor NusG Back     alignment and domain information
>KOG0463|consensus Back     alignment and domain information
>COG0250 NusG Transcription antiterminator [Transcription] Back     alignment and domain information
>KOG1143|consensus Back     alignment and domain information
>PRK09014 rfaH transcriptional activator RfaH; Provisional Back     alignment and domain information
>TIGR01955 RfaH transcriptional activator RfaH Back     alignment and domain information
>TIGR01956 NusG_myco NusG family protein Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08559 nusG transcription antitermination protein NusG; Validated Back     alignment and domain information
>KOG0461|consensus Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR00405 L26e_arch ribosomal protein L24p/L26e, archaeal Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0466|consensus Back     alignment and domain information
>smart00738 NGN In Spt5p, this domain may confer affinity for Spt4p Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0462|consensus Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF02357 NusG: Transcription termination factor nusG; InterPro: IPR006645 This sequence is identified by the NGN domain and is represented by the bacterial antitermination protein NusG Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>KOG0052|consensus Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>cd03698 eRF3_II_like eRF3_II_like: domain similar to domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>cd03694 GTPBP_II Domain II of the GP-1 family of GTPase Back     alignment and domain information
>KOG0465|consensus Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03697 EFTU_II EFTU_II: Elongation factor Tu domain II Back     alignment and domain information
>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3) Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>PF03143 GTP_EFTU_D3: Elongation factor Tu C-terminal domain; InterPro: IPR004160 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd03696 selB_II selB_II: this subfamily represents the domain of elongation factor SelB, homologous to domain II of EF-Tu Back     alignment and domain information
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU) Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>cd03695 CysN_NodQ_II CysN_NodQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03707 EFTU_III Domain III of elongation factor (EF) Tu Back     alignment and domain information
>cd03704 eRF3c_III This family represents eEF1alpha-like C-terminal region of eRF3 homologous to the domain III of EF-Tu Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd03705 EF1_alpha_III Domain III of EF-1 Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04093 HBS1_C HBS1_C: this family represents the C-terminal domain of Hsp70 subfamily B suppressor 1 (HBS1) which is homologous to the domain III of EF-1alpha Back     alignment and domain information
>KOG1144|consensus Back     alignment and domain information
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase Back     alignment and domain information
>cd01513 Translation_factor_III Domain III of Elongation factor (EF) Tu (EF-TU) and EF-G Back     alignment and domain information
>cd04094 selB_III This family represents the domain of elongation factor SelB, homologous to domain III of EF-Tu Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>cd04095 CysN_NoDQ_III TCysN_NoDQ_II: This subfamily represents the domain II of the large subunit of ATP sulfurylase (ATPS): CysN or the N-terminal portion of NodQ, found mainly in proteobacteria and homologous to the domain II of EF-Tu Back     alignment and domain information
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>KOG0469|consensus Back     alignment and domain information
>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>KOG0468|consensus Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PF03144 GTP_EFTU_D2: Elongation factor Tu domain 2; InterPro: IPR004161 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>KOG0464|consensus Back     alignment and domain information
>cd03690 Tet_II Tet_II: This subfamily represents domain II of ribosomal protection proteins Tet(M) and Tet(O) Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04092 mtEFG2_II_like mtEFG2_C: C-terminus of mitochondrial Elongation factor G2 (mtEFG2)-like proteins found in eukaryotes Back     alignment and domain information
>KOG0467|consensus Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu Back     alignment and domain information
>cd04088 EFG_mtEFG_II EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd03699 lepA_II lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>cd03689 RF3_II RF3_II: this subfamily represents the domain II of bacterial Release Factor 3 (RF3) Back     alignment and domain information
>PF14578 GTP_EFTU_D4: Elongation factor Tu domain 4; PDB: 1G7R_A 1G7S_A 1G7T_A 1XE1_A Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd03700 eEF2_snRNP_like_II EF2_snRNP_like_II: this subfamily represents domain II of elongation factor (EF) EF-2 found eukaryotes and archaea and, the C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>cd04090 eEF2_II_snRNP Loc2 eEF2_C_snRNP, cd01514/C terminal domain:eEF2_C_snRNP: This family includes C-terminal portion of the spliceosomal human 116kD U5 small nuclear ribonucleoprotein (snRNP) protein (U5-116 kD) and, its yeast counterpart Snu114p Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF00467 KOW: KOW motif; InterPro: IPR005824 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PF03439 Spt5-NGN: Early transcription elongation factor of RNA pol II, NGN section; InterPro: IPR005100 Spt5p and prokaryotic NusG are shown to contain a novel 'NGN' domain Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PF09173 eIF2_C: Initiation factor eIF2 gamma, C terminal; InterPro: IPR015256 This entry represents a domain which is found in the initiation factors eIF2 and EF-Tu, adopting a beta barrel structure with Greek key topology Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG1999|consensus Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2 Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>KOG1489|consensus Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK01191 rpl24p 50S ribosomal protein L24P; Validated Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>PRK00004 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>TIGR01080 rplX_A_E ribosomal protein L24p/L26e, archaeal/eukaryotic Back     alignment and domain information
>KOG1423|consensus Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>TIGR01079 rplX_bact ribosomal protein L24, bacterial/organelle Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>PTZ00194 60S ribosomal protein L26; Provisional Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>COG0198 RplX Ribosomal protein L24 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PF11623 DUF3252: Protein of unknown function (DUF3252); InterPro: IPR021659 This family of proteins has no known function Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>KOG2486|consensus Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG1424|consensus Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>KOG2484|consensus Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>KOG1532|consensus Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>KOG0088|consensus Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>KOG0448|consensus Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>KOG1954|consensus Back     alignment and domain information
>KOG1999|consensus Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>KOG1145|consensus Back     alignment and domain information
>COG5164 SPT5 Transcription elongation factor [Transcription] Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0083|consensus Back     alignment and domain information
>KOG2423|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
3mmp_A678 Structure Of The Qb Replicase, An Rna-Dependent Rna 1e-120
3agp_A 1289 Structure Of Viral Polymerase Form I Length = 1289 1e-120
1dg1_G394 Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Len 1e-119
1ob2_A393 E. Coli Elongation Factor Ef-Tu Complexed With The 1e-119
1efc_A393 Intact Elongation Factor From E.Coli Length = 393 1e-119
1d8t_A393 Crystal Structure Of Elongation Factor, Tu (Ef-Tu-M 1e-119
3u6b_A394 Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 1e-119
1efm_A379 Structure Of The Gdp Domain Of Ef-Tu And Location O 1e-119
1efu_A385 Elongation Factor Complex Ef-TuEF-Ts From Escherich 1e-118
2hcj_B335 "trypsin-Modified Elongation Factor Tu In Complex W 1e-118
2hdn_B335 Trypsin-Modified Elongation Factor Tu In Complex Wi 1e-118
1eft_A405 The Crystal Structure Of Elongation Factor Ef-Tu Fr 1e-106
4abr_Z405 Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kir 1e-106
1ttt_A405 Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Com 1e-106
2c77_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 1e-106
2y0u_Z405 The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bou 1e-106
2c78_A405 Ef-Tu Complexed With A Gtp Analog And The Antibioti 1e-106
1exm_A405 Crystal Structure Of Thermus Thermophilus Elongatio 1e-106
1aip_A405 Ef-Tu Ef-Ts Complex From Thermus Thermophilus Lengt 1e-105
2y0y_Z405 The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bo 1e-105
2wrn_Z406 The Crystal Structure Of The 70s Ribosome Bound To 1e-105
1mj1_A405 Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIB 3e-95
1d2e_A397 Crystal Structure Of Mitochondrial Ef-Tu In Complex 2e-80
1xb2_A409 Crystal Structure Of Bos Taurus Mitochondrial Elong 2e-76
2jvv_A181 Solution Structure Of E. Coli Nusg Carboxyterminal 6e-50
2k06_A123 Solution Structure Of The Aminoterminal Domain Of E 4e-25
3agj_A437 Crystal Structure Of Archaeal Pelota And Gtp-bound 4e-25
3vmf_A440 Archaeal Protein Length = 440 4e-25
1jny_A435 Crystal Structure Of Sulfolobus Solfataricus Elonga 2e-23
2lq8_A177 Domain Interaction In Thermotoga Maritima Nusg Leng 4e-22
2kvq_G63 Solution Structure Of Nuse:nusg-Ctd Complex Length 3e-18
1nz8_A119 Solution Structure Of The N-Utilisation Substance G 7e-17
1m1g_A248 Crystal Structure Of Aquifex Aeolicus N-Utilization 3e-16
2xhc_A352 Crystal Structure Of Thermotoga Maritima N-utilizat 8e-16
4ac9_A482 Crystal Structure Of Translation Elongation Factor 2e-15
1f60_A458 Crystal Structure Of The Yeast Elongation Factor Co 2e-14
3j2k_7439 Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associ 3e-12
1s0u_A408 Eif2gamma Apo Length = 408 7e-11
1nz9_A58 Solution Structure Of The N-Utilisation Substance G 2e-10
2aho_A414 Structure Of The Archaeal Initiation Factor Eif2 Al 4e-09
2pmd_A415 The Structures Of Aif2gamma Subunit From The Archae 4e-09
3sjz_A409 The Structure Of Aif2gamma Subunit Delta 41-45 From 4e-09
3pen_A403 Structure Of Archaeal Initiation Factor Aif2gamma S 4e-09
2d74_A419 Crystal Structure Of Translation Initiation Factor 5e-09
1kjz_A410 Structure Of The Large Gamma Subunit Of Initiation 8e-09
1kk3_A410 Structure Of The Wild-Type Large Gamma Subunit Of I 1e-08
1kk0_A410 Structure Of The Large Gamma Subunit Of Initiation 1e-06
1r5b_A467 Crystal Structure Analysis Of Sup35 Length = 467 6e-06
3mca_A592 Structure Of The Dom34-Hbs1 Complex And Implication 8e-06
3izy_P537 Mammalian Mitochondrial Translation Initiation Fact 2e-04
>pdb|3MMP|A Chain A, Structure Of The Qb Replicase, An Rna-Dependent Rna Polymerase Consisting Of Viral And Host Proteins Length = 678 Back     alignment and structure 
Iteration: 1

 Score =  429 bits (1103), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/291 (70%), Positives = 238/291 (81%), Gaps = 2/291 (0%)
Query: 1   MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMXXXXXXXXXXX 60
           MITGAAQMDGAILV +A DGPMPQTREHILL RQVGVPYI+VFLNK DM           
Sbjct: 376 MITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVE 435
Query: 61  XXXXXXXNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
                  ++Y+FPG+D PI++GSA  ALEGD     E  IL L+  LD+YIP P RAID 
Sbjct: 436 MEVRELLSQYDFPGDDTPIVRGSALKALEGDAE--WEAKILELAGFLDSYIPEPERAIDK 493
Query: 121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
            FLLP+EDVFSISGRGTVVTGRVERGI++VGEE+EI+GIK+T K+TCTGVEMFRKLLD+G
Sbjct: 494 PFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKLLDEG 553
Query: 181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
           +AG+N+G+LLRG KRE++ERGQVLAKPG+IKPH  F  E+Y LSKDEGGRHTPFF  YRP
Sbjct: 554 RAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEVYILSKDEGGRHTPFFKGYRP 613
Query: 241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
           QFYFRTTDVTG+IELP+  EMVMPGDN+ + V LI+PIAM++GLRFAIREG
Sbjct: 614 QFYFRTTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREG 664
>pdb|3AGP|A Chain A, Structure Of Viral Polymerase Form I Length = 1289 Back     alignment and structure
>pdb|1DG1|G Chain G, Whole, Unmodified, Ef-Tu(Elongation Factor Tu). Length = 394 Back     alignment and structure
>pdb|1OB2|A Chain A, E. Coli Elongation Factor Ef-Tu Complexed With The Antibiotic Kirromycin, A Gtp Analog, And Phe-Trna Length = 393 Back     alignment and structure
>pdb|1EFC|A Chain A, Intact Elongation Factor From E.Coli Length = 393 Back     alignment and structure
>pdb|1D8T|A Chain A, Crystal Structure Of Elongation Factor, Tu (Ef-Tu-Mggdp) Complexed With Ge2270a, A Thiazolyl Peptide Antibiotic Length = 393 Back     alignment and structure
>pdb|3U6B|A Chain A, Ef-Tu (Escherichia Coli) In Complex With Nvp-Ldi028 Length = 394 Back     alignment and structure
>pdb|1EFM|A Chain A, Structure Of The Gdp Domain Of Ef-Tu And Location Of The Amino Acids Homologous To Ras Oncogene Proteins Length = 379 Back     alignment and structure
>pdb|1EFU|A Chain A, Elongation Factor Complex Ef-TuEF-Ts From Escherichia Coli Length = 385 Back     alignment and structure
>pdb|2HCJ|B Chain B, "trypsin-Modified Elongation Factor Tu In Complex With Tetracycline" Length = 335 Back     alignment and structure
>pdb|2HDN|B Chain B, Trypsin-Modified Elongation Factor Tu In Complex With Tetracycline At 2.8 Angstrom Resolution Length = 335 Back     alignment and structure
>pdb|1EFT|A Chain A, The Crystal Structure Of Elongation Factor Ef-Tu From Thermus Aquaticus In The Gtp Conformation Length = 405 Back     alignment and structure
>pdb|4ABR|Z Chain Z, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin With The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1TTT|A Chain A, Phe-Trna, Elongation Factor Ef-Tu:gdpnp Ternary Complex Length = 405 Back     alignment and structure
>pdb|2C77|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Ge2270 A Length = 405 Back     alignment and structure
>pdb|2Y0U|Z Chain Z, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2C78|A Chain A, Ef-Tu Complexed With A Gtp Analog And The Antibiotic Pulvomycin Length = 405 Back     alignment and structure
>pdb|1EXM|A Chain A, Crystal Structure Of Thermus Thermophilus Elongation Factor Tu (Ef-Tu) In Complex With The Gtp Analogue Gppnhp. Length = 405 Back     alignment and structure
>pdb|1AIP|A Chain A, Ef-Tu Ef-Ts Complex From Thermus Thermophilus Length = 405 Back     alignment and structure
>pdb|2Y0Y|Z Chain Z, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To A Near-Cognate Codon On The 70s Ribosome Length = 405 Back     alignment and structure
>pdb|2WRN|Z Chain Z, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu And Trna (Part 1 Of 4). Length = 406 Back     alignment and structure
>pdb|1MJ1|A Chain A, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s Ribosome Length = 405 Back     alignment and structure
>pdb|1D2E|A Chain A, Crystal Structure Of Mitochondrial Ef-Tu In Complex With Gdp Length = 397 Back     alignment and structure
>pdb|1XB2|A Chain A, Crystal Structure Of Bos Taurus Mitochondrial Elongation Factor TuTS COMPLEX Length = 409 Back     alignment and structure
>pdb|2JVV|A Chain A, Solution Structure Of E. Coli Nusg Carboxyterminal Domain Length = 181 Back     alignment and structure
>pdb|2K06|A Chain A, Solution Structure Of The Aminoterminal Domain Of E. Coli Nusg Length = 123 Back     alignment and structure
>pdb|3AGJ|A Chain A, Crystal Structure Of Archaeal Pelota And Gtp-bound Ef1 Alpha Complex Length = 437 Back     alignment and structure
>pdb|3VMF|A Chain A, Archaeal Protein Length = 440 Back     alignment and structure
>pdb|1JNY|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Elongation Factor 1 Alpha In Complex With Gdp Length = 435 Back     alignment and structure
>pdb|2LQ8|A Chain A, Domain Interaction In Thermotoga Maritima Nusg Length = 177 Back     alignment and structure
>pdb|2KVQ|G Chain G, Solution Structure Of Nuse:nusg-Ctd Complex Length = 63 Back     alignment and structure
>pdb|1NZ8|A Chain A, Solution Structure Of The N-Utilisation Substance G (Nusg) N-Terminal (Ngn) Domain From Thermus Thermophilus Length = 119 Back     alignment and structure
>pdb|1M1G|A Chain A, Crystal Structure Of Aquifex Aeolicus N-Utilization Substance G (Nusg), Space Group P2(1) Length = 248 Back     alignment and structure
>pdb|2XHC|A Chain A, Crystal Structure Of Thermotoga Maritima N-utilization Substance G (nusg) Length = 352 Back     alignment and structure
>pdb|4AC9|A Chain A, Crystal Structure Of Translation Elongation Factor Selb From Methanococcus Maripaludis In Complex With Gdp Length = 482 Back     alignment and structure
>pdb|1F60|A Chain A, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 458 Back     alignment and structure
>pdb|3J2K|7 Chain 7, Cryo-Em Structure Of The Mammalian Erf1-Erf3-Associated Termination Complex Length = 439 Back     alignment and structure
>pdb|1S0U|A Chain A, Eif2gamma Apo Length = 408 Back     alignment and structure
>pdb|1NZ9|A Chain A, Solution Structure Of The N-Utilisation Substance G (Nusg) C-Terminal (Ngc) Domain From Thermus Thermophilus Length = 58 Back     alignment and structure
>pdb|2AHO|A Chain A, Structure Of The Archaeal Initiation Factor Eif2 Alpha- Gamma Heterodimer From Sulfolobus Solfataricus Complexed With Gdpnp Length = 414 Back     alignment and structure
>pdb|2PMD|A Chain A, The Structures Of Aif2gamma Subunit From The Archaeon Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 415 Back     alignment and structure
>pdb|3SJZ|A Chain A, The Structure Of Aif2gamma Subunit Delta 41-45 From Archaeon Sulfolobus Solfataricus Complexed With Gdp And Gdpnp Length = 409 Back     alignment and structure
>pdb|3PEN|A Chain A, Structure Of Archaeal Initiation Factor Aif2gamma Subunit Delta 37-47 From Sulfolobus Solfataricus In The Gdp-Bound Form. Length = 403 Back     alignment and structure
>pdb|2D74|A Chain A, Crystal Structure Of Translation Initiation Factor Aif2betagamma Heterodimer Length = 419 Back     alignment and structure
>pdb|1KJZ|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi-G235d Mutant Length = 410 Back     alignment and structure
>pdb|1KK3|A Chain A, Structure Of The Wild-Type Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Complexed With Gdp-Mg2+ Length = 410 Back     alignment and structure
>pdb|1KK0|A Chain A, Structure Of The Large Gamma Subunit Of Initiation Factor Eif2 From Pyrococcus Abyssi Length = 410 Back     alignment and structure
>pdb|1R5B|A Chain A, Crystal Structure Analysis Of Sup35 Length = 467 Back     alignment and structure
>pdb|3MCA|A Chain A, Structure Of The Dom34-Hbs1 Complex And Implications For Its Role In No-Go Decay Length = 592 Back     alignment and structure
>pdb|3IZY|P Chain P, Mammalian Mitochondrial Translation Initiation Factor 2 Length = 537 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query502
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 0.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 0.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 0.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 1e-159
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 1e-145
1wb1_A482 Translation elongation factor SELB; selenocysteine 1e-143
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 1e-141
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 1e-140
2jvv_A181 Transcription antitermination protein NUSG; transc 1e-101
1m1h_A248 Transcription antitermination protein NUSG; transc 2e-85
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 1e-79
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 3e-27
2oug_A162 Transcriptional activator RFAH; transcription fact 4e-61
1nz8_A119 Transcription antitermination protein NUSG; transc 5e-52
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 1e-40
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 2e-39
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 3e-38
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 7e-37
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 2e-36
1f60_A458 Elongation factor EEF1A; protein-protein complex, 2e-36
3p8b_B152 Transcription antitermination protein NUSG; transc 2e-30
1xe1_A116 Hypothetical protein PF0907; structural genomics, 3e-28
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 6e-28
1nz9_A58 Transcription antitermination protein NUSG; transc 1e-27
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-10
3izy_P537 Translation initiation factor IF-2, mitochondrial; 2e-08
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 2e-07
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 3e-06
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 5e-06
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Length = 397 Back     alignment and structure
 Score =  621 bits (1603), Expect = 0.0
 Identities = 157/291 (53%), Positives = 213/291 (73%)

Query: 1   MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVE 60
           MITG A +DG ILV +A DGPMPQTREH+LLARQ+GV ++VV++NKAD V D E++ELVE
Sbjct: 83  MITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVE 142

Query: 61  IEIRELLNKYEFPGNDIPIIKGSAKLALEGDTGPLGEQSILSLSKALDTYIPTPNRAIDG 120
           +EIRELL ++ + G + PII GSA  ALE     LG +S+  L  A+DTYIP P R ++ 
Sbjct: 143 LEIRELLTEFGYKGEETPIIVGSALCALEQRDPELGLKSVQKLLDAVDTYIPVPTRDLEK 202

Query: 121 AFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKLLDQG 180
            FLLPVE V+SI GRGTVVTG +ERGI++ G+E E +G    ++T  TG+EMF K LD+ 
Sbjct: 203 PFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHSKNIRTVVTGIEMFHKSLDRA 262

Query: 181 QAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYRP 240
           +AGDN+G L+RG KRED+ RG V+AKPGSI+PH+    ++Y L+K+EGGRH PF S++ P
Sbjct: 263 EAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILTKEEGGRHKPFVSHFMP 322

Query: 241 QFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREG 291
             +  T D+   I LP  KE+ MPG+++ +T+ L  P+ +E+G RF +R+G
Sbjct: 323 VMFSLTWDMACRIILPPGKELAMPGEDLKLTLILRQPMILEKGQRFTLRDG 373
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Length = 405 Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Length = 1289 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Length = 370 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Length = 410 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Length = 482 Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 408 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Length = 403 Back     alignment and structure
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Length = 181 Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Length = 248 Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Length = 352 Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Length = 352 Back     alignment and structure
>2oug_A Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli} Length = 162 Back     alignment and structure
>1nz8_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: d.58.42.1 Length = 119 Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Length = 435 Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Length = 592 Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Length = 467 Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Length = 483 Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Length = 611 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Length = 458 Back     alignment and structure
>3p8b_B Transcription antitermination protein NUSG; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} PDB: 3qqc_D Length = 152 Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Length = 116 Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Length = 434 Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Length = 58 Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Length = 204 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Length = 537 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Length = 178 Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Length = 594 Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Length = 501 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 100.0
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 100.0
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 100.0
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 100.0
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 100.0
1f60_A458 Elongation factor EEF1A; protein-protein complex, 100.0
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 100.0
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 100.0
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 100.0
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 100.0
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 100.0
2elf_A370 Protein translation elongation factor 1A; tRNA, py 100.0
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 100.0
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 100.0
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 100.0
1wb1_A482 Translation elongation factor SELB; selenocysteine 100.0
2jvv_A181 Transcription antitermination protein NUSG; transc 100.0
1m1h_A248 Transcription antitermination protein NUSG; transc 100.0
2oug_A162 Transcriptional activator RFAH; transcription fact 100.0
3e1y_E204 Eukaryotic peptide chain release factor GTP-bindi 100.0
3p8b_B152 Transcription antitermination protein NUSG; transc 99.97
2xhc_A352 Transcription antitermination protein NUSG; 2.45A 99.94
1nz8_A119 Transcription antitermination protein NUSG; transc 99.93
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.87
3vqt_A548 RF-3, peptide chain release factor 3; translation, 99.86
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.85
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 99.83
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 99.83
4fn5_A709 EF-G 1, elongation factor G 1; translation, transl 99.82
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 99.81
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 99.81
3izy_P537 Translation initiation factor IF-2, mitochondrial; 99.81
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 99.8
2dy1_A665 Elongation factor G; translocation, GTP complex, s 99.8
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 99.79
2xex_A693 Elongation factor G; GTPase, translation, biosynth 99.78
3j25_A638 Tetracycline resistance protein TETM; antibiotic r 99.77
3lpe_A92 Putative transcription antitermination protein NU; 99.75
1n0u_A842 EF-2, elongation factor 2; G-protein, CIS-proline, 99.65
1nz9_A58 Transcription antitermination protein NUSG; transc 99.5
2e6z_A59 Transcription elongation factor SPT5; KOW motif, s 99.29
1xe1_A116 Hypothetical protein PF0907; structural genomics, 98.99
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.7
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.63
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.61
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 98.6
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.58
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.47
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 98.46
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 98.45
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.41
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.33
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.17
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.13
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 98.11
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 98.09
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 98.07
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.06
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.05
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.03
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 98.01
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.01
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.01
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 98.0
3llu_A196 RAS-related GTP-binding protein C; structural geno 97.99
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 97.98
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 97.98
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 97.96
1d1n_A99 Initiation factor 2; beta-barrel, gene regulation; 97.96
2xhc_A 352 Transcription antitermination protein NUSG; 2.45A 97.96
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 97.95
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 97.92
3h7h_B106 Transcription elongation factor SPT5; helices surr 97.92
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.91
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 97.89
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 97.88
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 97.88
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 97.87
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 97.87
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 97.87
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 97.86
2crv_A120 IF-2MT, translation initiation factor IF-2; riboso 97.85
2fh5_B214 SR-beta, signal recognition particle receptor beta 97.84
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 97.84
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 97.82
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 97.79
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 97.78
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 97.78
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 97.77
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.77
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 97.77
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 97.76
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 97.76
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.76
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.76
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 97.76
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 97.75
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 97.74
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 97.74
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 97.74
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.73
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.72
3iby_A256 Ferrous iron transport protein B; G protein, G dom 97.71
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 97.71
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 97.7
3o47_A329 ADP-ribosylation factor GTPase-activating protein 97.7
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 97.7
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.7
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 97.69
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.69
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 97.69
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 97.69
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 97.69
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 97.68
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 97.67
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 97.66
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.66
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 97.65
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 97.65
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 97.65
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 97.64
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 97.63
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 97.63
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 97.63
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 97.62
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.62
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 97.62
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.62
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 97.61
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.61
2wji_A165 Ferrous iron transport protein B homolog; membrane 97.61
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 97.61
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 97.6
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 97.6
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 97.6
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 97.59
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 97.59
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.58
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 97.57
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 97.57
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 97.57
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 97.56
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 97.56
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 97.56
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 97.56
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 97.54
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 97.53
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.53
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 97.52
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 97.52
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 97.52
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 97.51
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 97.5
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 97.5
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 97.5
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 97.49
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.62
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 97.48
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 97.48
3cnl_A262 YLQF, putative uncharacterized protein; circular p 97.48
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 97.47
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 97.46
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 97.46
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 97.46
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 97.45
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 97.45
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 97.44
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 97.44
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.42
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 97.41
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 97.38
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 97.37
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 97.37
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 97.37
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 97.36
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 97.36
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 97.35
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.35
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.33
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 97.33
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 97.31
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 97.3
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.29
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 97.28
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.28
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 97.27
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 97.27
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 97.26
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 97.26
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 97.26
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 97.22
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 97.18
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 97.18
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 97.14
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 97.11
2www_A349 Methylmalonic aciduria type A protein, mitochondri 97.09
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 97.08
2e70_A71 Transcription elongation factor SPT5; KOW motif, s 97.03
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 97.01
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 97.0
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.98
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 96.94
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.92
3lxw_A247 GTPase IMAP family member 1; immunity, structural 96.86
2exu_A200 Transcription initiation protein SPT4/SPT5; helixs 96.82
1vq8_T120 50S ribosomal protein L24P; ribosome 50S, protein- 96.77
3izy_P537 Translation initiation factor IF-2, mitochondrial; 96.77
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 96.69
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 96.54
2do3_A69 Transcription elongation factor SPT5; KOW motif, s 96.51
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 96.51
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 96.48
2zjr_R115 50S ribosomal protein L24; ribosome, large ribosom 96.45
1wxq_A397 GTP-binding protein; structural genomics, riken st 96.43
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 96.39
2zkr_t145 60S ribosomal protein L26; protein-RNA complex, 60 96.34
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 96.34
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 96.18
3j21_U121 50S ribosomal protein L24P; archaea, archaeal, KIN 96.17
3lxx_A239 GTPase IMAP family member 4; structural genomics c 96.09
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.07
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.03
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.98
3v2d_Y110 50S ribosomal protein L24; ribosome associated inh 95.96
3u5e_Y127 L33, YL33, 60S ribosomal protein L26-A; translatio 95.8
2ckk_A127 KIN17; beta barrel, ribosomal protein, ribonucleop 95.67
3r8s_U102 50S ribosomal protein L24; protein biosynthesis, R 95.62
3iz5_Y150 60S ribosomal protein L26 (L24P); eukaryotic ribos 95.51
2ftc_N96 Mitochondrial ribosomal protein L24; mitochondrial 95.47
4a17_S135 RPL26, 60S ribosomal protein L21; eukaryotic ribos 95.45
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 95.24
2jz2_A66 SSL0352 protein; SH3-like, synechocystis SP. PCC 6 95.17
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 95.07
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 95.02
2hf9_A226 Probable hydrogenase nickel incorporation protein 94.99
2ged_A193 SR-beta, signal recognition particle receptor beta 94.92
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 94.71
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 94.37
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 93.9
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 93.61
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.51
3bbo_W191 Ribosomal protein L24; large ribosomal subunit, sp 93.15
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 93.11
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.24
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 90.95
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 90.02
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 89.34
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 87.92
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 87.15
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 86.87
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 86.87
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 86.12
4he6_A89 Peptidase family U32; ultra-tight crystal packing, 84.89
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 83.29
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
Probab=100.00  E-value=5e-49  Score=402.02  Aligned_cols=303  Identities=51%  Similarity=0.871  Sum_probs=273.4

Q ss_pred             CccccccCCEEEEEEECCCCCCcchHHHHHHHHHhCCCeEEEEEEcCCCCChHHHHHHHHHHHHHHHhhcCCCCCCCeEE
Q psy15224          1 MITGAAQMDGAILVCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDEELLELVEIEIRELLNKYEFPGNDIPII   80 (502)
Q Consensus         1 mi~g~~~~D~ailvVda~~g~~~qt~e~l~~~~~~~i~~iiv~iNK~D~~~~~~~~~~i~~~i~~~l~~~~~~~~~~~ii   80 (502)
                      |+.+++.+|++|||+||++|.++||++|+.++..+++|++|+++||||+.+.++.++.+.+++.++++.+++....+|++
T Consensus        83 ~~~~~~~aD~~ilVvda~~g~~~qt~e~l~~~~~~~vp~iivviNK~Dl~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~i  162 (397)
T 1d2e_A           83 MITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPII  162 (397)
T ss_dssp             HHHTSSCCSEEEEEEETTTCSCHHHHHHHHHHHHTTCCCEEEEEECGGGCSCHHHHHHHHHHHHHHHHHTTSCTTTSCEE
T ss_pred             HHhhHhhCCEEEEEEECCCCCCHHHHHHHHHHHHcCCCeEEEEEECcccCCCHHHHHHHHHHHHHHHHHcCCCcccCcEE
Confidence            46789999999999999999999999999999999999877779999998644666777788999999888866678999


Q ss_pred             EccccccccCC-CCCCCcccHHHHHHHHhhcCCCCCCCCCCCeeEEEeEEEeeCCCeEEEEEEEEEeeeecCCEEEEeec
Q psy15224         81 KGSAKLALEGD-TGPLGEQSILSLSKALDTYIPTPNRAIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGI  159 (502)
Q Consensus        81 ~iSa~~g~~~~-~~w~~~~~i~~Ll~~l~~~~p~~~~~~~~p~~~~v~~~~~~~~~G~v~~g~v~sG~l~~gd~v~i~p~  159 (502)
                      ++||++|.|+. ++||.+ ++.+|++.|.+.+|+|.+..+.|++++|+++|.++|.|++++|+|.+|+|++||+|.+.|.
T Consensus       163 ~~SA~~g~n~~~~~~~~g-~i~~Ll~~l~~~~p~p~~~~~~p~~~~v~~v~~~~~~G~v~~g~v~~G~l~~gd~v~~~~~  241 (397)
T 1d2e_A          163 VGSALCALEQRDPELGLK-SVQKLLDAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGH  241 (397)
T ss_dssp             ECCHHHHHTTCCTTTTHH-HHHHHHHHHHHHSCCCCCCTTSCCEEECCEEEEETTTEEEEEEECCBSEEETTCEEEEEET
T ss_pred             EeehhhcccccCCCccCC-cHHHHHHHHHHhCCCCCCCCCCcEEEEEEEEEEeCCceEEEEEEEeeceEeCCCEEEEeCC
Confidence            99999998754 578742 2899999999999988888899999999999999999999999999999999999999986


Q ss_pred             CCCeeEEEEEEEEcceecceeecCCeEEEEecCCCccCcccceEEeCCCCCCcccEEEEEEEEeecCCCCCCcccccCCe
Q psy15224        160 KDTVKTTCTGVEMFRKLLDQGQAGDNIGLLLRGTKREDVERGQVLAKPGSIKPHKHFTGEIYALSKDEGGRHTPFFSNYR  239 (502)
Q Consensus       160 ~~~~~~~V~~i~~~~~~v~~a~aG~~v~l~l~~~~~~~i~~G~vl~~~~~~~~~~~f~a~v~~l~~~~~~~~~~i~~g~~  239 (502)
                      +++..++|++|++++.++++|.|||+|+++|+|++..++++|++|++++.+.+...|+|++.|++++++++++++..||+
T Consensus       242 ~~~~~~~V~~i~~~~~~~~~a~aG~~v~~~l~~i~~~~i~~G~~l~~~~~~~~~~~f~a~v~~l~~~~~~~~~~~~~g~~  321 (397)
T 1d2e_A          242 SKNIRTVVTGIEMFHKSLDRAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILTKEEGGRHKPFVSHFM  321 (397)
T ss_dssp             TEEEEEEEEEEEETTEEESEEETTCEEEEEESSCCGGGCCTTCEEESTTSCCCEEEEEEEEEECCGGGTSCSSCBCTTCC
T ss_pred             CCCeEEEEEEEEECCcccCEecCCCceEEEecccchhccCceeEEeCCCCCCcccEEEEEEEEeccccccCccccCCCCE
Confidence            43478899999999999999999999999999999999999999999887778899999999999865555678999999


Q ss_pred             eEEEeeeeeEEEEEEccCCCccccCCCEEEEEEEeCceEecccCCeEEEEeCCeEEEEEEEeece
Q psy15224        240 PQFYFRTTDVTGSIELPKNKEMVMPGDNVLITVRLINPIAMEEGLRFAIREGVQQFIQDNLLTKE  304 (502)
Q Consensus       240 ~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~v~~~~~~pi~~~~~~r~ilr~~~~~ig~G~i~~~~  304 (502)
                      +.+|+++.+++|++.+..++..+++||.+.|+|++.+|+|+++|+||+||++++|+|+|.|++..
T Consensus       322 ~~~~~~t~~~~~~i~l~~~~~~l~~~~~~~v~~~~~~p~~~~~~~r~~lr~~~~ti~~G~i~~~~  386 (397)
T 1d2e_A          322 PVMFSLTWDMACRIILPPGKELAMPGEDLKLTLILRQPMILEKGQRFTLRDGNRTIGTGLVTDTP  386 (397)
T ss_dssp             CEEEETTEEEEEEEECCSSCCCBCTTCEEEEEEEEEEEECCCTTCEEEEEETTEEEEEEEEEECC
T ss_pred             EEEEEecCEEEEEEEEcCCcccccCCCEEEEEEEECCeEEEccCCeEEEEeCCeEEEEEEEeecc
Confidence            99999999999999855566789999999999999999999999999999999999999998664
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2jvv_A Transcription antitermination protein NUSG; transcription factor, transcription regulation, transcription termination; NMR {Escherichia coli} PDB: 2k06_A 2kvq_G Back     alignment and structure
>1m1h_A Transcription antitermination protein NUSG; transcription termination, RNP motif, immunoglobulin fold, nucleic acid interaction; 1.95A {Aquifex aeolicus} SCOP: b.114.1.1 d.58.42.1 PDB: 1m1g_A 1npp_A 1npr_A Back     alignment and structure
>2oug_A Transcriptional activator RFAH; transcription factor, virulence, transcription pausing, transcription elongation; 2.10A {Escherichia coli} Back     alignment and structure
>3e1y_E Eukaryotic peptide chain release factor GTP-bindi ERF3A; translation termination, peptide release, PTC, P biosynthesis, GTP-binding; HET: ATP; 3.80A {Homo sapiens} Back     alignment and structure
>3p8b_B Transcription antitermination protein NUSG; transcription elongation factor, RNA polymerase, transferase transcription complex; 1.80A {Pyrococcus furiosus} PDB: 3qqc_D Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>1nz8_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: d.58.42.1 Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>3lpe_A Putative transcription antitermination protein NU; transcription regulation, SPT4, SPT5, NUSG, archaea, evoluti directed RNA polymerase; 1.90A {Methanocaldococcus jannaschii} PDB: 3ewg_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>1nz9_A Transcription antitermination protein NUSG; transcription elongation, riken structural genomics/proteomics initiative, RSGI; NMR {Thermus thermophilus} SCOP: b.34.5.4 Back     alignment and structure
>2e6z_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xe1_A Hypothetical protein PF0907; structural genomics, unknown function, protein structure INI secsg, conserved hypothetical protein; HET: MSE; 2.00A {Pyrococcus furiosus} SCOP: b.43.3.1 Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1d1n_A Initiation factor 2; beta-barrel, gene regulation; NMR {Geobacillus stearothermophilus} SCOP: b.43.3.1 Back     alignment and structure
>2xhc_A Transcription antitermination protein NUSG; 2.45A {Thermotoga maritima} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>3h7h_B Transcription elongation factor SPT5; helices surrounding beta sheet, activator, ME binding, nucleus, repressor, transcription regulation; 1.55A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2crv_A IF-2MT, translation initiation factor IF-2; ribosome, beta barrel, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2e70_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2exu_A Transcription initiation protein SPT4/SPT5; helixs surrounding beta sheet; 2.23A {Saccharomyces cerevisiae} Back     alignment and structure
>1vq8_T 50S ribosomal protein L24P; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: b.34.5.1 PDB: 1vq4_T* 1vq5_T* 1vq6_T* 1vq7_T* 1s72_T* 1vq9_T* 1vqk_T* 1vql_T* 1vqm_T* 1vqn_T* 1vqo_T* 1vqp_T* 1yhq_T* 1yi2_T* 1yij_T* 1yit_T* 1yj9_T* 1yjn_T* 1yjw_T* 2otj_T* ... Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>2do3_A Transcription elongation factor SPT5; KOW motif, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.34.5.5 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2zjr_R 50S ribosomal protein L24; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans} SCOP: b.34.5.1 PDB: 1nwx_S* 1nwy_S* 1sm1_S* 1xbp_S* 2d3o_S 2zjp_R* 2zjq_R 1nkw_S 3cf5_R* 3dll_R* 3pio_R* 3pip_R* 1pnu_S 1pny_S 1vor_V 1vou_V 1vow_V 1voy_V 1vp0_V Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2zkr_t 60S ribosomal protein L26; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3j21_U 50S ribosomal protein L24P; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3v2d_Y 50S ribosomal protein L24; ribosome associated inhibitor A, RAIA, protein Y, stress RES stationary phase, ribosome hibernation, ribosome; 2.70A {Thermus thermophilus} PDB: 1vsp_S 2hgj_X 2hgq_X 2hgu_X 1vsa_S 2j03_Y 2jl6_Y 2jl8_Y 2v47_Y 2v49_Y 2wdi_Y 2wdj_Y 2wdl_Y 2wdn_Y 2wh2_Y 2wh4_Y 2wrj_Y 2wrl_Y 2wro_Y 2wrr_Y ... Back     alignment and structure
>3u5e_Y L33, YL33, 60S ribosomal protein L26-A; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 2wwa_L 2ww9_L 2wwb_L 3o5h_X 3o58_X 3u5i_Y 4b6a_Y 1s1i_U 3izc_Y 3izs_Y 3jyw_U Back     alignment and structure
>2ckk_A KIN17; beta barrel, ribosomal protein, ribonucleoprotein, nuclear protein; 1.45A {Homo sapiens} Back     alignment and structure
>3r8s_U 50S ribosomal protein L24; protein biosynthesis, RNA, tRNA, transfer RNA, 23S ribosomal subunit, ribosome recycling factor, RRF, ribosome; 3.00A {Escherichia coli} PDB: 2j28_U* 3fik_U 3j19_U 2wwq_U 3oat_U* 3oas_U* 3ofd_U 3ofc_U 3ofr_U* 3ofz_U* 3og0_U 3ofq_U 3r8t_U 3i1n_U 1vs8_U 1vs6_U 1vt2_U 3i1p_U 3i1r_U 3i1t_U ... Back     alignment and structure
>2ftc_N Mitochondrial ribosomal protein L24; mitochondrial ribosome, large ribosomal subunit, ribosomal R ribosome; 12.10A {Bos taurus} PDB: 3iy9_N Back     alignment and structure
>4a17_S RPL26, 60S ribosomal protein L21; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_S 4a1c_S 4a1e_S Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2jz2_A SSL0352 protein; SH3-like, synechocystis SP. PCC 6803, targe PSI, protein structure initiative, northeast structural GEN consortium, NESG; NMR {Synechocystis SP} PDB: 3c4s_A Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3bbo_W Ribosomal protein L24; large ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Spinacea oleracea} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>4he6_A Peptidase family U32; ultra-tight crystal packing, unknown function; 1.10A {Geobacillus thermoleovorans} PDB: 4he5_A Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 502
d1efca192 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), 2e-38
d1d2ea198 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), 2e-37
d1d2ea3196 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), 3e-37
d2c78a3204 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N 2e-36
d2c78a1100 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), 2e-34
d1nz8a_119 d.58.42.1 (A:) N-utilization substance G protein N 2e-30
d1d2ea2103 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) 1e-29
d1wb1a192 b.43.3.1 (A:180-271) Elongation factor SelB, domai 4e-29
d1m1ha2101 d.58.42.1 (A:5-50,A:132-186) N-utilization substan 4e-28
d1f60a194 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, 2e-27
d2c78a293 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) 2e-26
d1jnya195 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, 7e-26
d1f60a3239 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N 5e-25
d1r5ba195 b.43.3.1 (A:460-554) Eukaryotic peptide chain rele 8e-24
d1s0ua1118 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma 4e-23
d1kk1a1121 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma 7e-23
d1nppa258 b.34.5.4 (A:191-248) N-utilization substance G pro 2e-21
d1nz9a_58 b.34.5.4 (A:) N-utilization substance G protein Nu 2e-21
d1xe1a_91 b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococ 1e-18
d1zunb192 b.43.3.1 (B:238-329) Sulfate adenylate transferase 2e-18
d2qn6a1114 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma 3e-18
d1jnya3224 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N 1e-17
d2qn6a3205 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma su 1e-12
d1zunb3222 c.37.1.8 (B:16-237) Sulfate adenylate transferase 2e-11
d2bv3a2276 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-t 4e-11
d1r5ba3245 c.37.1.8 (A:215-459) Eukaryotic peptide chain rele 5e-10
d1kk1a3195 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma su 6e-07
d1n0ua2341 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N- 4e-06
d1g7sa2128 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, 5e-06
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 2e-05
d1g7sa4227 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N- 7e-04
d1t9ha2231 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C 0.003
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Translation proteins
family: Elongation factors
domain: Elongation factor Tu (EF-Tu), domain 2
species: Escherichia coli [TaxId: 562]

 Score =  132 bits (335), Expect = 2e-38
 Identities = 74/92 (80%), Positives = 88/92 (95%)

Query: 117 AIDGAFLLPVEDVFSISGRGTVVTGRVERGIVRVGEELEIIGIKDTVKTTCTGVEMFRKL 176
           AID  FLLP+EDVFSISGRGTVVTGRVERGI++VGEE+EI+GIK+T K+TCTGVEMFRKL
Sbjct: 1   AIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGVEMFRKL 60

Query: 177 LDQGQAGDNIGLLLRGTKREDVERGQVLAKPG 208
           LD+G+AG+N+G+LLRG KRE++ERGQVLAKPG
Sbjct: 61  LDEGRAGENVGVLLRGIKREEIERGQVLAKPG 92
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 196 Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 204 Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Length = 100 Back     information, alignment and structure
>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 119 Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Length = 103 Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Length = 92 Back     information, alignment and structure
>d1m1ha2 d.58.42.1 (A:5-50,A:132-186) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 101 Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Length = 93 Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 95 Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 239 Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 95 Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 118 Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 121 Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 58 Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 58 Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Length = 91 Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 92 Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Length = 114 Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 224 Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 205 Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 222 Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Length = 276 Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 245 Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 195 Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 341 Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 128 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 227 Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Length = 231 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query502
d1nz8a_119 N-utilization substance G protein NusG, N-terminal 99.94
d1m1ha2101 N-utilization substance G protein NusG, N-terminal 99.9
d1f60a194 Elongation factor eEF-1alpha, domain 2 {Baker's ye 99.84
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.84
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.84
d1efca192 Elongation factor Tu (EF-Tu), domain 2 {Escherichi 99.84
d1d2ea198 Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos t 99.84
d2c78a1100 Elongation factor Tu (EF-Tu), domain 2 {Thermus th 99.83
d1jnya195 Elongation factor eEF-1alpha, domain 2 {Archaeon S 99.81
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.8
d1d2ea2103 Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mi 99.77
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.76
d1wb1a192 Elongation factor SelB, domains 2 and 4 {Methanoco 99.75
d1xe1a_91 Hypothetical protein PF0907 {Pyrococcus furiosus [ 99.74
d1kk1a1121 Initiation factor eIF2 gamma subunit, domain II {A 99.73
d2c78a293 Elongation factor Tu (EF-Tu) {Thermus thermophilus 99.73
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.72
d1r5ba195 Eukaryotic peptide chain release factor ERF2, post 99.71
d1zunb192 Sulfate adenylate transferase subunit cysN/C, EF-T 99.71
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.7
d1s0ua1118 Initiation factor eIF2 gamma subunit, domain II {A 99.69
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.69
d1jnya2107 Elongation factor eEF-1alpha, C-terminal domain {A 99.64
d1nppa258 N-utilization substance G protein NusG, C-terminal 99.63
d1nz9a_58 N-utilization substance G protein NusG, C-terminal 99.62
d1f60a2107 Elongation factor eEF-1alpha, C-terminal domain {B 99.61
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.61
d2qn6a1114 Initiation factor eIF2 gamma subunit, domain II {S 99.54
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.42
d1zunb2105 Sulfate adenylate transferase subunit cysN/C, EF-T 99.34
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.25
d2bv3a1121 Elongation factor G (EF-G), domain II {Thermus the 99.2
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.16
d2dy1a1103 Elongation factor G (EF-G), domain II {Thermus the 99.15
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.13
d1n0ua1138 Elongation factor 2 (eEF-2), domain II {Baker's ye 99.13
d1g7sa2128 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 99.09
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 98.92
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 98.92
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 98.84
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 98.77
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.66
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 98.62
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 98.22
d1r5ba268 Eukaryotic peptide chain release factor ERF2, C-te 98.16
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 98.16
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 98.14
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 98.11
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 97.99
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.95
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.85
d1d1na_99 Initiation factor IF2/eIF5b, domains 2 and 4 {Baci 97.83
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.81
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.8
d1kk1a289 Initiation factor eIF2 gamma subunit {Archaeon Pyr 97.68
d2qn6a295 Initiation factor eIF2 gamma subunit {Sulfolobus s 97.67
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.65
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 97.64
d1s0ua290 Initiation factor eIF2 gamma subunit {Archaeon Met 97.59
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.52
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 97.51
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 97.47
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 97.44
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.42
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 97.38
d1g7sa1101 Initiation factor IF2/eIF5b, domains 2 and 4 {Arch 97.36
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 97.34
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 97.26
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.14
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 97.13
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 97.1
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 97.05
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 97.04
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 97.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 97.02
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 97.01
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 96.91
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.89
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.89
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.89
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 96.88
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.87
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 96.82
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 96.82
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 96.79
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.79
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 96.78
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 96.75
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 96.75
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 96.72
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 96.71
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.69
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 96.64
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 96.59
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.59
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 96.54
d2do3a162 Transcription elongation factor SPT5 {Human (Homo 96.52
d1wb1a3116 Elongation factor SelB, domain 3 {Methanococcus ma 96.42
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.42
d1vqot1119 Ribosomal proteins L24 (L24p) {Archaeon Haloarcula 96.25
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.17
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.15
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.13
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 96.04
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 95.97
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 95.73
d2zjrr1110 Ribosomal proteins L24 (L24p) {Deinococcus radiodu 95.66
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.62
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.23
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.0
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.45
d2j01y1101 Ribosomal proteins L24 (L24p) {Thermus thermophilu 93.24
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.97
d2gycs199 Ribosomal proteins L24 (L24p) {Escherichia coli [T 92.91
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.72
d1ib8a174 Hypothetical protein SP14.3 (SP0552) {Streptococcu 87.01
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.52
>d1nz8a_ d.58.42.1 (A:) N-utilization substance G protein NusG, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: N-utilization substance G protein NusG, N-terminal domain
family: N-utilization substance G protein NusG, N-terminal domain
domain: N-utilization substance G protein NusG, N-terminal domain
species: Thermus thermophilus [TaxId: 274]

Probab=99.94  E-value=5.4e-27  Score=193.36  Aligned_cols=110  Identities=38%  Similarity=0.843  Sum_probs=99.8

Q ss_pred             ccceEEEeeccCchHHHHHHHHHHHHhcCCCcceeEEEEeeEEEEEee-cCcEEEEEecccCcEEEEEEEeCc-----cc
Q psy15224        327 KKRWYVIHSYSGMEKNVQRKLIERINKLGMQKKFGRILVPTEEIVDVK-KNQKSVIKKRFFPGYVLIEMEMTD-----ES  400 (502)
Q Consensus       327 ~~~WYvl~t~~~~E~~v~~~L~~~~~~~~~~~~~~~~~~P~~~~~~~~-~g~~~~~~~plfpgYvFv~~~~~~-----~~  400 (502)
                      .|+||||||+||+|++|+++|++++...++++.++++|+|+++..+.+ +|+++.+.+|+|||||||++++++     +.
T Consensus         1 ~mkWYvl~t~sg~E~~v~~~L~~~i~~~~l~~~~~~v~vP~e~~~~~k~~gkk~~~~~~lFPGYvfV~~~~~d~~~~~~~   80 (119)
T d1nz8a_           1 SIEWYAVHTLVGQEEKAKANLEKRIKAFGLQDKIFQVLIPTEEVVELREGGKKEVVRKKLFPGYLFIQMDLGDEEEPNEA   80 (119)
T ss_dssp             CCEEEEEECCTTTHHHHHHHHHHHHHHHTCTTTCCEEECSEEEEEEECSSSCEEEEEEESSTTEEEEEECCCSSSSCCHH
T ss_pred             CceEEEEEeECCcHHHHHHHHHHHHHHhcccccccccccCceeEEEEEeccceEEeeeecCCcEEEEEEecCccccchhh
Confidence            489999999999999999999999999999999999999998876655 788888999999999999999875     56


Q ss_pred             eeeeeccCCeeEeccCCCCcceeCCHHHHHHHHHHHh
Q psy15224        401 WHLVKNTKKVTGFIGGKSNRPTPISSKEIEEILKQIK  437 (502)
Q Consensus       401 ~~~i~~~~~v~~~l~~~~~~p~~v~~~ei~~~~~~~~  437 (502)
                      |+.|+++|||.+|+++ +++|.||+++|++.|....+
T Consensus        81 ~~~Ir~t~gV~~fvg~-~~~P~pv~~~Ei~~il~~~g  116 (119)
T d1nz8a_          81 WEVVRGTPGITGFVGA-GMRPVPLSPDEVRHILEVSG  116 (119)
T ss_dssp             HHHHHHSTTCCCCCCS-SSSSCBCCHHHHHHHHHHHT
T ss_pred             HHHHhcCCCeeEEcCC-CCccccCCHHHHHHHHHHhC
Confidence            8889999999999997 78999999999999987653
>d1m1ha2 d.58.42.1 (A:5-50,A:132-186) N-utilization substance G protein NusG, N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1efca1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2ea1 b.43.3.1 (A:251-348) Elongation factor Tu (EF-Tu), domain 2 {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a1 b.43.3.1 (A:213-312) Elongation factor Tu (EF-Tu), domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jnya1 b.43.3.1 (A:228-322) Elongation factor eEF-1alpha, domain 2 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea2 b.44.1.1 (A:349-451) Elongation factor Tu (EF-Tu) {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a1 b.43.3.1 (A:180-271) Elongation factor SelB, domains 2 and 4 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1xe1a_ b.43.3.1 (A:) Hypothetical protein PF0907 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kk1a1 b.43.3.1 (A:201-321) Initiation factor eIF2 gamma subunit, domain II {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2c78a2 b.44.1.1 (A:313-405) Elongation factor Tu (EF-Tu) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1r5ba1 b.43.3.1 (A:460-554) Eukaryotic peptide chain release factor ERF2, post-G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1zunb1 b.43.3.1 (B:238-329) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 2-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1s0ua1 b.43.3.1 (A:230-347) Initiation factor eIF2 gamma subunit, domain II {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1nppa2 b.34.5.4 (A:191-248) N-utilization substance G protein NusG, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f60a2 b.44.1.1 (A:335-441) Elongation factor eEF-1alpha, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a1 b.43.3.1 (A:207-320) Initiation factor eIF2 gamma subunit, domain II {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1zunb2 b.44.1.1 (B:330-434) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain 3-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a1 b.43.3.1 (A:275-377) Elongation factor G (EF-G), domain II {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g7sa2 b.43.3.1 (A:460-587) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r5ba2 b.44.1.1 (A:555-622) Eukaryotic peptide chain release factor ERF2, C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kk1a2 b.44.1.1 (A:322-410) Initiation factor eIF2 gamma subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qn6a2 b.44.1.1 (A:321-415) Initiation factor eIF2 gamma subunit {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1s0ua2 b.44.1.1 (A:348-437) Initiation factor eIF2 gamma subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1g7sa1 b.43.3.1 (A:228-328) Initiation factor IF2/eIF5b, domains 2 and 4 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a3 b.44.1.1 (A:272-387) Elongation factor SelB, domain 3 {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vqot1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zjrr1 b.34.5.1 (R:4-113) Ribosomal proteins L24 (L24p) {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j01y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gycs1 b.34.5.1 (S:3-101) Ribosomal proteins L24 (L24p) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure