Psyllid ID: psy15240
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 155 | ||||||
| 326368299 | 275 | 3,2-trans-enoyl-CoA isomerase, mitochond | 0.993 | 0.56 | 0.558 | 1e-45 | |
| 270004200 | 281 | hypothetical protein TcasGA2_TC003524 [T | 0.993 | 0.548 | 0.522 | 6e-42 | |
| 189235323 | 814 | PREDICTED: similar to AGAP012407-PA [Tri | 0.993 | 0.189 | 0.522 | 2e-41 | |
| 357612578 | 241 | enoyl-CoA isomerase [Danaus plexippus] | 1.0 | 0.643 | 0.483 | 3e-41 | |
| 289741943 | 285 | hydroxyacyl-CoA dehydrogenase/enoyl-CoA | 0.993 | 0.540 | 0.535 | 4e-41 | |
| 263173376 | 245 | hydroxyacyl-CoA dehydrogenase/enoyl-CoA | 0.993 | 0.628 | 0.529 | 4e-41 | |
| 239792253 | 153 | ACYPI007651 [Acyrthosiphon pisum] | 0.909 | 0.921 | 0.560 | 9e-40 | |
| 242019641 | 290 | 3,2-trans-enoyl-CoA isomerase, putative | 1.0 | 0.534 | 0.483 | 2e-39 | |
| 332373080 | 280 | unknown [Dendroctonus ponderosae] | 0.993 | 0.55 | 0.522 | 2e-39 | |
| 225708238 | 303 | 3,2-trans-enoyl-CoA isomerase, mitochond | 0.993 | 0.508 | 0.493 | 3e-39 |
| >gi|326368299|ref|NP_001191928.1| 3,2-trans-enoyl-CoA isomerase, mitochondrial-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 187 bits (476), Expect = 1e-45, Method: Compositional matrix adjust.
Identities = 86/154 (55%), Positives = 114/154 (74%)
Query: 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELAL 60
+ GH+P GC FAMSC+YR+MVGPKYTIGLNETK+GI+AP WF DTMV +G R+ E++L
Sbjct: 122 INGHSPAGGCLFAMSCDYRVMVGPKYTIGLNETKLGIVAPKWFQDTMVAVIGQRKAEVSL 181
Query: 61 TSGKMFTSAEALKVGLIDEEVTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISN 120
T+GKM+T+ EAL+VGLIDE + + A+ + FL + I A K+TK + R+ T+
Sbjct: 182 TTGKMYTTDEALQVGLIDESLPDADSALKKGTQFLNNFQRISPWAFKMTKDISRQPTVQW 241
Query: 121 LMENKEKDLKNVVDLITSPQVQKGLGLYLQSLKK 154
L++NK+KDL V+ + SP VQK LGLYLQSLKK
Sbjct: 242 LIDNKQKDLDFVLKFMQSPDVQKSLGLYLQSLKK 275
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270004200|gb|EFA00648.1| hypothetical protein TcasGA2_TC003524 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189235323|ref|XP_975184.2| PREDICTED: similar to AGAP012407-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357612578|gb|EHJ68073.1| enoyl-CoA isomerase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|289741943|gb|ADD19719.1| hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Glossina morsitans morsitans] | Back alignment and taxonomy information |
|---|
| >gi|263173376|gb|ACY69926.1| hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Cimex lectularius] | Back alignment and taxonomy information |
|---|
| >gi|239792253|dbj|BAH72489.1| ACYPI007651 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|242019641|ref|XP_002430268.1| 3,2-trans-enoyl-CoA isomerase, putative [Pediculus humanus corporis] gi|212515375|gb|EEB17530.1| 3,2-trans-enoyl-CoA isomerase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|332373080|gb|AEE61681.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|225708238|gb|ACO09965.1| 3,2-trans-enoyl-CoA isomerase, mitochondrial precursor [Osmerus mordax] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 155 | ||||||
| ZFIN|ZDB-GENE-030131-6033 | 329 | eci1 "enoyl-CoA delta isomeras | 0.993 | 0.468 | 0.461 | 7.2e-36 | |
| FB|FBgn0032160 | 281 | CG4598 [Drosophila melanogaste | 0.993 | 0.548 | 0.477 | 9.2e-36 | |
| MGI|MGI:94871 | 289 | Eci1 "enoyl-Coenzyme A delta i | 0.993 | 0.532 | 0.448 | 8.3e-35 | |
| RGD|61892 | 289 | Eci1 "enoyl-CoA delta isomeras | 0.993 | 0.532 | 0.461 | 2.8e-34 | |
| UNIPROTKB|H3BP91 | 294 | ECI1 "Enoyl-CoA delta isomeras | 0.993 | 0.523 | 0.448 | 6.7e-33 | |
| UNIPROTKB|P42126 | 302 | ECI1 "Enoyl-CoA delta isomeras | 0.993 | 0.509 | 0.448 | 6.7e-33 | |
| UNIPROTKB|Q96DC0 | 243 | DCI "Dodecenoyl-Coenzyme A del | 0.993 | 0.633 | 0.448 | 6.7e-33 | |
| UNIPROTKB|I3LLH8 | 172 | ECI1 "Uncharacterized protein" | 0.993 | 0.895 | 0.410 | 1.8e-32 | |
| FB|FBgn0032161 | 280 | CG4594 [Drosophila melanogaste | 0.993 | 0.55 | 0.464 | 6e-32 | |
| UNIPROTKB|E1C3T6 | 294 | ECI1 "Uncharacterized protein" | 0.993 | 0.523 | 0.423 | 6e-32 |
| ZFIN|ZDB-GENE-030131-6033 eci1 "enoyl-CoA delta isomerase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 387 (141.3 bits), Expect = 7.2e-36, P = 7.2e-36
Identities = 72/156 (46%), Positives = 106/156 (67%)
Query: 1 MKGHAPGAGCQFAMSCEYRIMV-GPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELA 59
+ G++P GC AM C+YRIM P+Y+IGLNET++GI+APFWF DTM++ +G R+TE
Sbjct: 173 INGNSPAGGCLLAMCCDYRIMADNPRYSIGLNETQLGIVAPFWFKDTMLNVVGHRETEKG 232
Query: 60 LTSGKMFTSAEALKVGLIDEEVTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTIS 119
L G ++ + ALK+GL+DE V ++ T AET + ++ IP AR+++K M+R+ T+
Sbjct: 233 LQLGLLYNTPNALKIGLVDELVPEDKVLSTAAET-MTKWLAIPDHARQISKSMMRKPTVD 291
Query: 120 NLMENKEKDLKNVVDLITSPQVQKGLGLYLQSLKKK 155
L+ N+E D N V IT +QK LG+Y+ LKKK
Sbjct: 292 KLLANREADTTNFVSFITKDSIQKSLGMYMAMLKKK 327
|
|
| FB|FBgn0032160 CG4598 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:94871 Eci1 "enoyl-Coenzyme A delta isomerase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|61892 Eci1 "enoyl-CoA delta isomerase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BP91 ECI1 "Enoyl-CoA delta isomerase 1, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42126 ECI1 "Enoyl-CoA delta isomerase 1, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96DC0 DCI "Dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase), isoform CRA_a" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLH8 ECI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032161 CG4594 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C3T6 ECI1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 155 | |||
| pfam00378 | 245 | pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami | 3e-30 | |
| cd06558 | 195 | cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme | 4e-21 | |
| PLN03214 | 278 | PLN03214, PLN03214, probable enoyl-CoA hydratase/i | 3e-20 | |
| COG1024 | 257 | COG1024, CaiD, Enoyl-CoA hydratase/carnithine race | 4e-18 | |
| PRK06213 | 229 | PRK06213, PRK06213, enoyl-CoA hydratase; Provision | 4e-12 | |
| PRK11730 | 715 | PRK11730, fadB, multifunctional fatty acid oxidati | 1e-10 | |
| TIGR02437 | 714 | TIGR02437, FadB, fatty oxidation complex, alpha su | 8e-10 | |
| PRK06127 | 269 | PRK06127, PRK06127, enoyl-CoA hydratase; Provision | 2e-08 | |
| PLN02267 | 239 | PLN02267, PLN02267, enoyl-CoA hydratase/isomerase | 4e-08 | |
| PRK08138 | 261 | PRK08138, PRK08138, enoyl-CoA hydratase; Provision | 2e-07 | |
| PRK07658 | 257 | PRK07658, PRK07658, enoyl-CoA hydratase; Provision | 3e-07 | |
| PRK09245 | 266 | PRK09245, PRK09245, enoyl-CoA hydratase; Provision | 3e-07 | |
| PRK05809 | 260 | PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata | 1e-06 | |
| PRK06688 | 259 | PRK06688, PRK06688, enoyl-CoA hydratase; Provision | 2e-06 | |
| PRK05870 | 249 | PRK05870, PRK05870, enoyl-CoA hydratase; Provision | 2e-04 | |
| PRK09674 | 255 | PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; | 4e-04 | |
| PRK06494 | 259 | PRK06494, PRK06494, enoyl-CoA hydratase; Provision | 4e-04 | |
| PRK05995 | 262 | PRK05995, PRK05995, enoyl-CoA hydratase; Provision | 5e-04 | |
| PRK05869 | 222 | PRK05869, PRK05869, enoyl-CoA hydratase; Validated | 0.001 | |
| PRK07659 | 260 | PRK07659, PRK07659, enoyl-CoA hydratase; Provision | 0.001 | |
| PRK07657 | 260 | PRK07657, PRK07657, enoyl-CoA hydratase; Provision | 0.002 | |
| PRK07468 | 262 | PRK07468, PRK07468, enoyl-CoA hydratase; Provision | 0.002 | |
| PRK06143 | 256 | PRK06143, PRK06143, enoyl-CoA hydratase; Provision | 0.004 |
| >gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family | Back alignment and domain information |
|---|
Score = 109 bits (274), Expect = 3e-30
Identities = 44/154 (28%), Positives = 72/154 (46%), Gaps = 8/154 (5%)
Query: 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELAL 60
+ G+A G G + A++C+YRI GL E K+GII + +G L
Sbjct: 97 VNGYALGGGLELALACDYRIA-ADNAKFGLPEVKLGIIPGAGGTQRLPRIIGVSAALEML 155
Query: 61 TSGKMFTSAEALKVGLIDEEVTSE---EEAITRAETFLAQYATIPGAARKLTKLMLREKT 117
+G+ + EALK+GL+D+ V E EEAI A+ + A P A K +R
Sbjct: 156 LTGRRIRAQEALKMGLVDKVVPEEQLVEEAIELAQ----RLADKPPLALAALKAAMRAAL 211
Query: 118 ISNLMENKEKDLKNVVDLITSPQVQKGLGLYLQS 151
L E + + L+ ++ V++G+ +L+
Sbjct: 212 EDALPEVRAQALRLYPAPFSTDDVKEGIQAFLEK 245
|
This family contains a diverse set of enzymes including: Enoyl-CoA hydratase. Napthoate synthase. Carnitate racemase. 3-hydoxybutyryl-CoA dehydratase. Dodecanoyl-CoA delta-isomerase. Length = 245 |
| >gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215635 PLN03214, PLN03214, probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235744 PRK06213, PRK06213, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215151 PLN02267, PLN02267, enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235632 PRK05869, PRK05869, enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 100.0 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 100.0 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 100.0 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 100.0 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 100.0 | |
| KOG1680|consensus | 290 | 100.0 | ||
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 100.0 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 100.0 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 100.0 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 100.0 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 100.0 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 100.0 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 100.0 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 100.0 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 100.0 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 100.0 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 100.0 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PLN02921 | 327 | naphthoate synthase | 100.0 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 100.0 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 100.0 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 100.0 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 100.0 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 100.0 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 100.0 | |
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 100.0 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 100.0 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 100.0 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 100.0 | |
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 100.0 | |
| KOG0016|consensus | 266 | 100.0 | ||
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 100.0 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 99.98 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 99.98 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 99.98 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 99.97 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 99.97 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 99.97 | |
| KOG1679|consensus | 291 | 99.97 | ||
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.97 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 99.97 | |
| KOG1681|consensus | 292 | 99.97 | ||
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 99.96 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 99.96 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 99.95 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 99.95 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 99.95 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 99.93 | |
| KOG1682|consensus | 287 | 99.93 | ||
| COG0447 | 282 | MenB Dihydroxynaphthoic acid synthase [Coenzyme me | 99.92 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 99.91 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 99.91 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 99.9 | |
| KOG1684|consensus | 401 | 99.71 | ||
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 99.7 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 99.51 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.33 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 98.94 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 98.87 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 98.8 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 98.65 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 98.62 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 98.55 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 98.53 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 98.41 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 98.18 | |
| PRK12319 | 256 | acetyl-CoA carboxylase subunit alpha; Provisional | 98.17 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 98.13 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 98.12 | |
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 98.02 | |
| CHL00198 | 322 | accA acetyl-CoA carboxylase carboxyltransferase al | 97.92 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 97.91 | |
| PLN03230 | 431 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.85 | |
| PRK05724 | 319 | acetyl-CoA carboxylase carboxyltransferase subunit | 97.81 | |
| TIGR00513 | 316 | accA acetyl-CoA carboxylase, carboxyl transferase, | 97.76 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 97.76 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 97.73 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 97.62 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 97.54 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 97.53 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 97.5 | |
| PRK05654 | 292 | acetyl-CoA carboxylase subunit beta; Validated | 97.4 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 97.38 | |
| PF13766 | 118 | ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PD | 97.33 | |
| TIGR03133 | 274 | malonate_beta malonate decarboxylase, beta subunit | 97.29 | |
| TIGR00515 | 285 | accD acetyl-CoA carboxylase, carboxyl transferase, | 97.24 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 97.18 | |
| PRK07189 | 301 | malonate decarboxylase subunit beta; Reviewed | 97.14 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 97.06 | |
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 97.03 | |
| CHL00174 | 296 | accD acetyl-CoA carboxylase beta subunit; Reviewed | 97.0 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 96.99 | |
| PRK10949 | 618 | protease 4; Provisional | 96.97 | |
| KOG1683|consensus | 380 | 96.78 | ||
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 96.64 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 96.56 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 96.56 | |
| TIGR03134 | 238 | malonate_gamma malonate decarboxylase, gamma subun | 96.26 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 96.23 | |
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 95.81 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 95.5 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 95.43 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 94.95 | |
| COG0825 | 317 | AccA Acetyl-CoA carboxylase alpha subunit [Lipid m | 94.74 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 94.68 | |
| COG0777 | 294 | AccD Acetyl-CoA carboxylase beta subunit [Lipid me | 94.38 | |
| COG4799 | 526 | Acetyl-CoA carboxylase, carboxyltransferase compon | 89.25 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 87.89 | |
| smart00250 | 38 | PLEC Plectin repeat. | 87.12 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 86.23 | |
| PF00681 | 45 | Plectin: Plectin repeat; InterPro: IPR001101 Plect | 84.46 | |
| PRK10949 | 618 | protease 4; Provisional | 84.4 |
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.3e-39 Score=242.98 Aligned_cols=153 Identities=16% Similarity=0.147 Sum_probs=146.6
Q ss_pred CCcccchHHHHHHhhcceeeeecCceeeecccccccccCChhHHHHHHHhhCHHHHHHHHhcCCCCCHHHHHHcCcccee
Q psy15240 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELALTSGKMFTSAEALKVGLIDEE 80 (155)
Q Consensus 1 v~G~a~GgG~~la~~cD~~ia~~~~a~~~~~e~~~Gl~~~~~~~~~l~~~~g~~~a~~l~l~g~~~~a~eA~~~Glv~~v 80 (155)
|||+|+|||++|+++||+||++ ++++|++||+++|++|+++++++|++++|..++++++++|++++++||+++||||+|
T Consensus 99 v~G~a~GgG~~lalacD~~ia~-~~a~f~~pe~~~Gl~p~~g~~~~l~~~iG~~~a~~l~ltg~~~~a~eA~~~Glv~~v 177 (255)
T PRK08150 99 LHGAVVGGGLELASAAHIRVAD-ESTYFALPEGQRGIFVGGGGSVRVPRLIGVARMTDMMLTGRVYDAQEGERLGLAQYL 177 (255)
T ss_pred ECCEEEcHHHHHHHhCCEEEEe-CCCEEeccccccCCCCCccHHHHHHHHhCHHHHHHHHHcCCcCCHHHHHHcCCccEe
Confidence 7999999999999999999999 999999999999999999999999999999999999999999999999999999999
Q ss_pred cCChhHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhccCC
Q psy15240 81 VTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISNLMENKEKDLKNVVDLITSPQVQKGLGLYLQSLKKK 155 (155)
Q Consensus 81 ~~~~~~~~~~~~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~k 155 (155)
++ .+++.+.+.+++++|+..+|.+++.+|+.++.....++++.++.|...+..++.+++.++++.+|++||+|+
T Consensus 178 v~-~~~l~~~a~~~a~~la~~~~~a~~~~K~~l~~~~~~~~~~~~~~e~~~~~~~~~s~d~~eg~~af~~kr~p~ 251 (255)
T PRK08150 178 VP-AGEALDKAMELARRIAQNAPLTNFAVLNALPRIADMSADDGLFVESLMAAVAQSAPEAKERLRAFLEKKAAK 251 (255)
T ss_pred eC-chHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhcCHHHHHHHHHHhccCCCC
Confidence 99 799999999999999999999999999999988777788888888888888999999999999999998875
|
|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1680|consensus | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >KOG0016|consensus | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >KOG1679|consensus | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1681|consensus | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >KOG1682|consensus | Back alignment and domain information |
|---|
| >COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >KOG1684|consensus | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional | Back alignment and domain information |
|---|
| >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >PRK05654 acetyl-CoA carboxylase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PF13766 ECH_C: 2-enoyl-CoA Hydratase C-terminal region; PDB: 3JU1_A 3BPT_A | Back alignment and domain information |
|---|
| >TIGR03133 malonate_beta malonate decarboxylase, beta subunit | Back alignment and domain information |
|---|
| >TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK07189 malonate decarboxylase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >KOG1683|consensus | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >smart00250 PLEC Plectin repeat | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
| >PF00681 Plectin: Plectin repeat; InterPro: IPR001101 Plectin may have a role in cross-linking intermediate filaments, in inter-linking intermediate filaments with microtubules and microfilaments and in anchoring intermediate filaments to the plasma and nuclear membranes | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 155 | ||||
| 1xx4_A | 261 | Crystal Structure Of Rat Mitochondrial 3,2-Enoyl-Co | 4e-38 | ||
| 1sg4_A | 260 | Crystal Structure Of Human Mitochondrial Delta3-del | 2e-36 | ||
| 3lke_A | 263 | Crystal Structure Of Enoyl-Coa Hydratase From Bacil | 2e-08 | ||
| 3ot6_A | 232 | Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS | 2e-06 | ||
| 2ppy_A | 265 | Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) F | 1e-05 | ||
| 3pea_A | 261 | Crystal Structure Of Enoyl-Coa Hydratase From Bacil | 2e-05 | ||
| 3r6h_A | 233 | Crystal Structure Of An Enoyl-Coa Hydratase (Echa3) | 3e-05 | ||
| 4di1_A | 277 | Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro | 5e-05 | ||
| 2pbp_A | 258 | Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( | 1e-04 | ||
| 4fzw_A | 258 | Crystal Structure Of The Paaf-paag Hydratase-isomer | 1e-04 | ||
| 4hc8_A | 255 | Crystal Structure Of Probable Enoyl-Coa Hydratase E | 4e-04 | ||
| 3zw8_A | 742 | Crystal Structure Of Rat Peroxisomal Multifunctiona | 7e-04 | ||
| 2x58_A | 727 | The Crystal Structure Of Mfe1 Liganded With Coa Len | 7e-04 | ||
| 1wdk_A | 715 | Fatty Acid Beta-Oxidation Multienzyme Complex From | 7e-04 |
| >pdb|1XX4|A Chain A, Crystal Structure Of Rat Mitochondrial 3,2-Enoyl-Coa Length = 261 | Back alignment and structure |
|
| >pdb|1SG4|A Chain A, Crystal Structure Of Human Mitochondrial Delta3-delta2- Enoyl-coa Isomerase Length = 260 | Back alignment and structure |
| >pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 | Back alignment and structure |
| >pdb|3OT6|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FAMILY PROTEIN From Psudomonas Syringae Length = 232 | Back alignment and structure |
| >pdb|2PPY|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates (Gk_1992) From Geobacillus Kaustophilus Hta426 Length = 265 | Back alignment and structure |
| >pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 | Back alignment and structure |
| >pdb|3R6H|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase (Echa3) From Mycobacterium Marinum Length = 233 | Back alignment and structure |
| >pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 | Back alignment and structure |
| >pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 | Back alignment and structure |
| >pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 | Back alignment and structure |
| >pdb|4HC8|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase Echa3 (Rv0632c, Nysgrc-019494) From Mycobacterium Tuberculosis H37rv Length = 255 | Back alignment and structure |
| >pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 | Back alignment and structure |
| >pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 | Back alignment and structure |
| >pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 155 | |||
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 2e-35 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 3e-31 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 1e-19 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 2e-14 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 7e-13 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 7e-12 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 9e-12 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 1e-11 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 11251J, struct | 2e-11 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 2e-11 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 3e-11 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 4e-11 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 5e-11 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 6e-11 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 6e-11 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 7e-11 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 7e-11 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 1e-10 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 1e-10 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 1e-10 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 1e-10 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 2e-10 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 3e-10 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 3e-10 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 4e-10 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 9e-10 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 2e-09 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 2e-09 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 2e-09 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 3e-09 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 3e-09 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 3e-09 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 5e-09 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 5e-09 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 5e-09 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 8e-09 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 8e-09 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 1e-08 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 3e-08 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 3e-08 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 5e-08 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 6e-08 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 9e-08 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 2e-07 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 2e-07 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 2e-07 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 2e-07 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 2e-07 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 2e-07 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 3e-07 | |
| 3t3w_A | 279 | Probable enoyl-COA hydratase; ssgcid, structural g | 4e-07 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 4e-07 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 4e-07 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 4e-07 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 5e-07 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 5e-07 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 6e-07 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 6e-07 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 7e-07 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 7e-07 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 9e-07 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 1e-06 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 2e-06 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 2e-06 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 2e-06 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 2e-06 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 2e-06 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 6e-06 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 7e-06 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 8e-06 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 5e-05 |
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 | Back alignment and structure |
|---|
Score = 122 bits (309), Expect = 2e-35
Identities = 70/154 (45%), Positives = 104/154 (67%), Gaps = 2/154 (1%)
Query: 3 GHAPGAGCQFAMSCEYRIMV-GPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELALT 61
G P GC A++C+YRI+ P+Y IGLNET++GIIAPFW DT+ +T+G R E AL
Sbjct: 106 GACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQ 165
Query: 62 SGKMFTSAEALKVGLIDEEVTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISNL 121
G +F AEAL+VG++D +V EE+ + A + +AQ+ IP AR+LTK M+R+ T S L
Sbjct: 166 LGLLFPPAEALQVGIVD-QVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRL 224
Query: 122 MENKEKDLKNVVDLITSPQVQKGLGLYLQSLKKK 155
+ ++ D++N V I+ +QK L +YL+ LK++
Sbjct: 225 VTQRDADVQNFVSFISKDSIQKSLQMYLERLKEE 258
|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 | Back alignment and structure |
|---|
| >3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 100.0 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 100.0 | |
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 100.0 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 100.0 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 100.0 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 100.0 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 100.0 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 100.0 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 100.0 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 100.0 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 100.0 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 100.0 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 100.0 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 100.0 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 100.0 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 100.0 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 100.0 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 100.0 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 100.0 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 100.0 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 100.0 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 100.0 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 100.0 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 100.0 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 100.0 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 100.0 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 100.0 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 100.0 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 100.0 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 100.0 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 100.0 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 100.0 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 100.0 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 100.0 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 100.0 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 100.0 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 100.0 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 100.0 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 100.0 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 100.0 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 100.0 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 100.0 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 100.0 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 100.0 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 100.0 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 100.0 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 100.0 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 100.0 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 100.0 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 100.0 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 100.0 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 100.0 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 100.0 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 100.0 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 100.0 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 100.0 | |
| 3ju1_A | 407 | Enoyl-COA hydratase/isomerase family protein; alph | 100.0 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 100.0 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 100.0 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 100.0 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 100.0 | |
| 2np9_A | 440 | DPGC; protein inhibitor complex, oxidoreductase; H | 100.0 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 100.0 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 100.0 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 100.0 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 100.0 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 100.0 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 99.97 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 99.94 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 99.53 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.5 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 99.46 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 99.31 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 99.3 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 99.24 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 99.18 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 98.96 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 98.55 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 97.9 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 97.89 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 97.88 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 97.85 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 97.72 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 97.63 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 97.61 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 97.52 | |
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 97.39 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 97.36 | |
| 2f9i_B | 285 | Acetyl-coenzyme A carboxylase carboxyl transferase | 97.19 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 97.12 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 97.12 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 97.11 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 96.71 | |
| 3k8x_A | 758 | Acetyl-COA carboxylase; transferase, carboxyltrans | 96.18 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 96.18 | |
| 2x24_A | 793 | Acetyl-COA carboxylase; fatty acid biosynthesis, l | 95.56 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 95.24 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 94.91 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 93.98 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 91.42 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 91.16 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 88.33 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 85.77 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 84.46 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 82.44 |
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-42 Score=260.51 Aligned_cols=153 Identities=19% Similarity=0.211 Sum_probs=149.9
Q ss_pred CCcccchHHHHHHhhcceeeeecCceeeecccccccccCChhHHHHHHHhhCHHHHHHHHhcCCCCCHHHHHHcCcccee
Q psy15240 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELALTSGKMFTSAEALKVGLIDEE 80 (155)
Q Consensus 1 v~G~a~GgG~~la~~cD~~ia~~~~a~~~~~e~~~Gl~~~~~~~~~l~~~~g~~~a~~l~l~g~~~~a~eA~~~Glv~~v 80 (155)
|||+|+|||++|+++||+||++ ++++|++||+++|++|+++++++|++++|.++|++++++|++|+++||+++||||+|
T Consensus 98 v~G~a~GgG~~lalacD~ria~-~~a~f~~pe~~lGl~p~~g~~~~L~r~vG~~~A~~llltg~~i~A~eA~~~GLv~~v 176 (254)
T 3hrx_A 98 VNGVAAGAGMSLALWGDLRLAA-VGASFTTAFVRIGLVPDSGLSFLLPRLVGLAKAQELLLLSPRLSAEEALALGLVHRV 176 (254)
T ss_dssp ECSEEETHHHHHHTTCSEEEEE-TTCEEECCGGGGTCCCCTTHHHHHHHHHCHHHHHHHHHHCCCEEHHHHHHHTSCSEE
T ss_pred ECCEeeehhhhhhhccceeeEc-CCCEEEchhhCcCcCCcccHHHHHHHHhCcchHHHHhhcCcccCHHHHHHCCCeEEe
Confidence 6999999999999999999999 999999999999999999999999999999999999999999999999999999999
Q ss_pred cCChhHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhccCC
Q psy15240 81 VTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISNLMENKEKDLKNVVDLITSPQVQKGLGLYLQSLKKK 155 (155)
Q Consensus 81 ~~~~~~~~~~~~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~k 155 (155)
+| ++++++.+.+++++++..+|.+++.+|++++.....++++.++.|...+..++.++|.+|++++|++||+|+
T Consensus 177 v~-~~~l~~~a~~~a~~la~~~~~a~~~~K~~~~~~~~~~~~~~l~~e~~~~~~~~~s~d~~Eg~~AF~eKR~P~ 250 (254)
T 3hrx_A 177 VP-AEKLMEEALSLAKELAQGPTRAYALTKKLLLETYRLSLTEALALEAVLQGQAGQTQDHEEGVRAFREKRPPR 250 (254)
T ss_dssp EC-GGGHHHHHHHHHHHHHTSCHHHHHHHHHHHHHGGGSCHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTTSCCC
T ss_pred cC-cHHHHHHHHHHHHHhhccchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhCCHHHHHHHHHHhCCCCCC
Confidence 99 899999999999999999999999999999999988999999999999999999999999999999999985
|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 155 | ||||
| d1mj3a_ | 260 | c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat | 1e-12 | |
| d1pjha_ | 266 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 2e-06 | |
| d1sg4a1 | 249 | c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-d | 9e-06 | |
| d1dcia_ | 275 | c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 | 0.002 |
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Enoyl-CoA hydratase (crotonase) species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 61.3 bits (148), Expect = 1e-12
Identities = 26/145 (17%), Positives = 52/145 (35%), Gaps = 2/145 (1%)
Query: 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELAL 60
+ G+A G GC+ AM C+ G K G E +G I + +G +
Sbjct: 104 VNGYALGGGCELAMMCDIIYA-GEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMV 162
Query: 61 TSGKMFTSAEALKVGLIDEEVTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISN 120
+G ++ +A + G + ++ E + A + A + K +
Sbjct: 163 LTGDRISAQDAKQAG-LVSKIFPVETLVEEAIQCAEKIANNSKIIVAMAKESVNAAFEMT 221
Query: 121 LMENKEKDLKNVVDLITSPQVQKGL 145
L E + + K + ++G+
Sbjct: 222 LTEGNKLEKKLFYSTFATDDRREGM 246
|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 155 | |||
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 100.0 | |
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 100.0 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 100.0 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 100.0 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 100.0 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 100.0 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 100.0 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 100.0 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 100.0 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 100.0 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 100.0 | |
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 100.0 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 99.97 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 99.96 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 97.48 | |
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 97.46 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 97.42 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 97.4 | |
| d1vrga1 | 251 | Propionyl-CoA carboxylase complex B subunit, PccB | 97.38 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 97.34 | |
| d2a7sa1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 97.28 | |
| d1on3a1 | 253 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 97.25 | |
| d1xnya1 | 258 | Propionyl-CoA carboxylase complex B subunit, PccB | 97.15 | |
| d2f9ya1 | 316 | Acetyl-coenzyme A carboxylase carboxyl transferase | 96.55 | |
| d2f9yb1 | 263 | Acetyl-coenzyme A carboxylase carboxyl transferase | 96.5 | |
| d1pixa2 | 287 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 96.29 | |
| d1uyra1 | 333 | Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc | 96.13 | |
| d1vrga2 | 264 | Propionyl-CoA carboxylase complex B subunit, PccB | 87.73 | |
| d2a7sa2 | 271 | Propionyl-CoA carboxylase complex B subunit, PccB | 86.4 | |
| d1on3a2 | 264 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 85.87 | |
| d1xnya2 | 263 | Propionyl-CoA carboxylase complex B subunit, PccB | 80.66 |
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Crotonase-like domain: Chromodomain protein CDY2A species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.5e-40 Score=248.93 Aligned_cols=153 Identities=16% Similarity=0.153 Sum_probs=149.6
Q ss_pred CCcccchHHHHHHhhcceeeeecCceeeecccccccccCChhHHHHHHHhhCHHHHHHHHhcCCCCCHHHHHHcCcccee
Q psy15240 1 MKGHAPGAGCQFAMSCEYRIMVGPKYTIGLNETKMGIIAPFWFVDTMVHTLGPRQTELALTSGKMFTSAEALKVGLIDEE 80 (155)
Q Consensus 1 v~G~a~GgG~~la~~cD~~ia~~~~a~~~~~e~~~Gl~~~~~~~~~l~~~~g~~~a~~l~l~g~~~~a~eA~~~Glv~~v 80 (155)
|||+|+|||++|+++||+||++ ++++|++||+++|++|++++++++++++|.+++++++++|+++++++|+++||||+|
T Consensus 105 v~G~a~GgG~~lal~~D~~ia~-~~a~f~~pe~~~Gl~p~~g~~~~l~r~ig~~~a~~l~l~g~~~~a~eA~~~Glv~~v 183 (258)
T d2fw2a1 105 VNGPAIGLGASILPLCDLVWAN-EKAWFQTPYTTFGQSPDGCSSITFPKMMGKASANEMLIAGRKLTAREACAKGLVSQV 183 (258)
T ss_dssp ECSCEETHHHHTGGGSSEEEEE-TTCEEECCHHHHTCCCCTTHHHHHHHHHCHHHHHHHHTTCCEEEHHHHHHTTSCSEE
T ss_pred ccccccccccccccccccccee-cccceeeccccccccccccccccchhhcCccccchhhccCccccccccccccccccc
Confidence 6999999999999999999999 999999999999999999999999999999999999999999999999999999999
Q ss_pred cCChhHHHHHHHHHHHHHhcCChHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHhcCHHHHHHHHHHHhhccCC
Q psy15240 81 VTSEEEAITRAETFLAQYATIPGAARKLTKLMLREKTISNLMENKEKDLKNVVDLITSPQVQKGLGLYLQSLKKK 155 (155)
Q Consensus 81 ~~~~~~~~~~~~~~a~~l~~~~~~a~~~~K~~l~~~~~~~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~k 155 (155)
++ ++++.+++.+++++|++.|+.+++.+|+.++.....++++.++.|...+..++.++|.+|++++|++||+|+
T Consensus 184 v~-~~~l~~~a~~~a~~i~~~~~~a~~~~K~~~~~~~~~~l~~~~~~e~~~~~~~~~s~d~~Egi~af~EKR~p~ 257 (258)
T d2fw2a1 184 FL-TGTFTQEVMIQIKELASYNAIVLEECKALVRCNIKLELEQANERECEVLRKIWSSAQGIESMLKYVENKIDE 257 (258)
T ss_dssp EC-STTHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHHSSCCC
T ss_pred cc-ccccccccchhhhhhhhhhHHHHHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhCCHHHHHHHHHHhCCCCCC
Confidence 99 899999999999999999999999999999999888999999999999999999999999999999999986
|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|