Psyllid ID: psy15259

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKLN
ccEEEEEccccccccHHHHHHHcccccccccccccccccEEEccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHccEEEEEEccccEEEEEEccccccccc
ccEEEEEEcccEcccHHHHHHHEEcccccccccccccccEEEcccccccccccccccccccccccccEEEEEEccccccccccccccccccccEccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHcccEEEEEcccccEEEEEEcccccccc
MDVLFDlkdqgipltpervcgtvlensncsvkngpqvdwqvdtnygtkvdritapsesrylasgdeisiiqltdihydpkylagktahciaplccrvdqpnassetdratkyghydncdmPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYlgdipvipiignhethpvnvfspyfvqgptstsWVYESFIQYWgwslpesarqtflkggyysfltekNLRIIVLNTNVYQKLN
mdvlfdlkdqgipltperVCGTVLEnsncsvkngpqvdwqVDTNYGtkvdritapsesrylasgDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSflteknlriivlntnvyqkln
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKLN
****FDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVD***********TKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVY****
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNY**********************SIIQLTDIHYDPKYLAGKTAHCIAPLC***************TKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKLN
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKLN
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQ*NAS******TKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVLFDLKDQGIPLTPERVCGTVLENSNCSVKNGPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTNVYQKLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query257 2.2.26 [Sep-21-2011]
Q0VD19 625 Sphingomyelin phosphodies yes N/A 0.735 0.302 0.380 1e-37
Q04519 627 Sphingomyelin phosphodies yes N/A 0.735 0.301 0.375 1e-37
P17405 629 Sphingomyelin phosphodies yes N/A 0.735 0.300 0.380 2e-36
Q10916 564 Sphingomyelin phosphodies yes N/A 0.922 0.420 0.315 7e-28
Q54C16 637 Sphingomyelin phosphodies yes N/A 0.688 0.277 0.347 2e-24
Q55C09 583 Sphingomyelin phosphodies no N/A 0.653 0.288 0.289 3e-20
Q23498 618 Sphingomyelin phosphodies no N/A 0.933 0.388 0.255 2e-18
Q9UAY4 589 Putative sphingomyelin ph no N/A 0.914 0.398 0.26 4e-18
Q54SR8 446 Sphingomyelinase phosphod no N/A 0.673 0.387 0.298 3e-14
Q92484 453 Acid sphingomyelinase-lik no N/A 0.638 0.362 0.329 5e-12
>sp|Q0VD19|ASM_BOVIN Sphingomyelin phosphodiesterase OS=Bos taurus GN=SMPD1 PE=2 SV=1 Back     alignment and function desciption
 Score =  157 bits (396), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 72/189 (38%), Positives = 104/189 (55%)

Query: 69  IIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSA 128
           ++ LTD+H+D  YL G   +C  PLCCR D     +    A  +G Y  CD+PL  + S 
Sbjct: 197 VLFLTDLHWDHDYLEGTDPNCENPLCCRRDSGPPPASQPGAGYWGEYSKCDLPLRTLESL 256

Query: 129 LEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHE 188
           L  +       MVY TGD+ AH IW+ SR   +  +  +  L +++LG +PV P +GNHE
Sbjct: 257 LSGLGPAGPFDMVYWTGDIPAHNIWQQSRQDQLRALTTITALVKKFLGPVPVYPAVGNHE 316

Query: 189 THPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVL 248
           + PVN F P F++G  S+ W+YE+  + W   LP  A +T   GG+Y+      LR+I L
Sbjct: 317 STPVNGFPPPFIKGNQSSHWLYEAMAEAWEPWLPAEALRTLRIGGFYALSPRPGLRLISL 376

Query: 249 NTNVYQKLN 257
           N N   + N
Sbjct: 377 NMNFCSREN 385
Converts sphingomyelin to ceramide. Also has phospholipase C activities toward 1,2-diacylglycerolphosphocholine and 1,2-diacylglycerolphosphoglycerol.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q04519|ASM_MOUSE Sphingomyelin phosphodiesterase OS=Mus musculus GN=Smpd1 PE=2 SV=2 Back     alignment and function description
>sp|P17405|ASM_HUMAN Sphingomyelin phosphodiesterase OS=Homo sapiens GN=SMPD1 PE=1 SV=4 Back     alignment and function description
>sp|Q10916|ASM1_CAEEL Sphingomyelin phosphodiesterase 1 OS=Caenorhabditis elegans GN=asm-1 PE=1 SV=2 Back     alignment and function description
>sp|Q54C16|SGMB_DICDI Sphingomyelin phosphodiesterase B OS=Dictyostelium discoideum GN=sgmB PE=3 SV=1 Back     alignment and function description
>sp|Q55C09|SGMA_DICDI Sphingomyelin phosphodiesterase A OS=Dictyostelium discoideum GN=sgmA PE=3 SV=1 Back     alignment and function description
>sp|Q23498|ASM2_CAEEL Sphingomyelin phosphodiesterase 2 OS=Caenorhabditis elegans GN=asm-2 PE=1 SV=3 Back     alignment and function description
>sp|Q9UAY4|ASM3_CAEEL Putative sphingomyelin phosphodiesterase asm-3 OS=Caenorhabditis elegans GN=asm-3 PE=2 SV=2 Back     alignment and function description
>sp|Q54SR8|SGMC_DICDI Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum GN=sgmC PE=3 SV=1 Back     alignment and function description
>sp|Q92484|ASM3A_HUMAN Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens GN=SMPDL3A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
195452710 687 GK14133 [Drosophila willistoni] gi|19416 0.906 0.339 0.387 6e-45
194746209 687 GF18837 [Drosophila ananassae] gi|190628 0.906 0.339 0.378 4e-42
195110901 664 GI24854 [Drosophila mojavensis] gi|19391 0.894 0.346 0.387 1e-41
195505168 691 GE10876 [Drosophila yakuba] gi|194185489 0.906 0.337 0.378 1e-41
322778827 570 hypothetical protein SINV_08456 [Solenop 0.941 0.424 0.375 2e-41
195341522 690 GM12878 [Drosophila sechellia] gi|194131 0.906 0.337 0.361 2e-41
158287619 639 AGAP004054-PA [Anopheles gambiae str. PE 0.964 0.388 0.347 2e-41
195391738 667 GJ24498 [Drosophila virilis] gi|19415260 0.918 0.353 0.361 5e-41
198449664 675 GA13791 [Drosophila pseudoobscura pseudo 0.906 0.345 0.365 7e-41
170053649 630 sphingomyelin phosphodiesterase [Culex q 0.941 0.384 0.355 7e-41
>gi|195452710|ref|XP_002073466.1| GK14133 [Drosophila willistoni] gi|194169551|gb|EDW84452.1| GK14133 [Drosophila willistoni] Back     alignment and taxonomy information
 Score =  186 bits (473), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 93/240 (38%), Positives = 131/240 (54%), Gaps = 7/240 (2%)

Query: 14  LTPERVCGTVLENSNCSVKNGPQVDW--QVDTNYGTKVDRITAPSESRYLASGDEISIIQ 71
           +  +  C   +E S C+  + P  +W   VDT+ G      T P  +  L S  +  I Q
Sbjct: 165 MDAQSFCSLFMEYSFCNTVSNPDYNWTLSVDTSGGA-----TGPKSNTPLESPSDFKICQ 219

Query: 72  LTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQ 131
           LTDIH+DP Y  G  A C  P+CC+ ++      ++ A  +G Y +CD+P +V+ SAL  
Sbjct: 220 LTDIHHDPLYEPGSLASCDEPMCCQRNKDTVEGTSEAAGVWGDYRDCDLPWNVLESALSH 279

Query: 132 IKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHP 191
           + + +    +Y TGD+V H +W TS  KN EV+  V+    E   D+PV P IGNHE HP
Sbjct: 280 VAETQKCDFIYQTGDVVDHMVWATSEEKNKEVLTKVSNRITEVFPDVPVYPCIGNHEPHP 339

Query: 192 VNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTN 251
           +N+FSP  V    ST+W+YE     W   LPE  ++T LKGGYY+       RII LN+N
Sbjct: 340 LNLFSPEGVPTDVSTTWLYEHLYGIWSKWLPEETKETILKGGYYTVSPRSGFRIIALNSN 399

Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194746209|ref|XP_001955573.1| GF18837 [Drosophila ananassae] gi|190628610|gb|EDV44134.1| GF18837 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195110901|ref|XP_002000018.1| GI24854 [Drosophila mojavensis] gi|193916612|gb|EDW15479.1| GI24854 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195505168|ref|XP_002099388.1| GE10876 [Drosophila yakuba] gi|194185489|gb|EDW99100.1| GE10876 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|322778827|gb|EFZ09243.1| hypothetical protein SINV_08456 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|195341522|ref|XP_002037355.1| GM12878 [Drosophila sechellia] gi|194131471|gb|EDW53514.1| GM12878 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|158287619|ref|XP_309607.4| AGAP004054-PA [Anopheles gambiae str. PEST] gi|157019509|gb|EAA05348.4| AGAP004054-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195391738|ref|XP_002054517.1| GJ24498 [Drosophila virilis] gi|194152603|gb|EDW68037.1| GJ24498 [Drosophila virilis] Back     alignment and taxonomy information
>gi|198449664|ref|XP_001357675.2| GA13791 [Drosophila pseudoobscura pseudoobscura] gi|198130706|gb|EAL26809.2| GA13791 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|170053649|ref|XP_001862773.1| sphingomyelin phosphodiesterase [Culex quinquefasciatus] gi|167874082|gb|EDS37465.1| sphingomyelin phosphodiesterase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query257
FB|FBgn0039768 692 CG15533 [Drosophila melanogast 0.891 0.330 0.364 8.4e-41
UNIPROTKB|F1Q018 623 SMPD1 "Uncharacterized protein 0.914 0.377 0.354 5.3e-38
FB|FBgn0039769 666 CG15534 [Drosophila melanogast 0.731 0.282 0.388 1.9e-37
UNIPROTKB|Q0VD19 625 SMPD1 "Sphingomyelin phosphodi 0.918 0.377 0.340 2e-37
MGI|MGI:98325 627 Smpd1 "sphingomyelin phosphodi 0.918 0.376 0.336 7.6e-37
UNIPROTKB|F1RMN6 451 SMPD1 "Uncharacterized protein 0.785 0.447 0.382 5.7e-36
RGD|1549719 627 Smpd1 "sphingomyelin phosphodi 0.961 0.393 0.324 6.1e-36
ZFIN|ZDB-GENE-110411-222 675 smpd1 "sphingomyelin phosphodi 0.735 0.28 0.4 7.1e-36
UNIPROTKB|P17405 629 SMPD1 "Sphingomyelin phosphodi 0.918 0.375 0.340 1.7e-35
UNIPROTKB|E9PKS3 630 SMPD1 "Sphingomyelin phosphodi 0.918 0.374 0.340 1.8e-35
FB|FBgn0039768 CG15533 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 438 (159.2 bits), Expect = 8.4e-41, P = 8.4e-41
 Identities = 85/233 (36%), Positives = 118/233 (50%)

Query:    20 CGTVLENSNCSVKNGPQVDWQVDT-NYGTKVDRITAPSESRYLASGDEISIIQLTDIHYD 78
             C   +E + C+       +W +   N G   +    P          +I I Q +DIH+D
Sbjct:   174 CSLFMEFNFCNTGTNQDYNWTLTIDNTG---EASAGPKSDTPTFQDSDIRICQFSDIHHD 230

Query:    79 PKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKKHKNI 138
             P Y  G  A C  P+CC+ ++      +D A  +G Y +CD+P     SAL+    +   
Sbjct:   231 PYYTPGSLATCAEPMCCQRNKETTEGTSDAAGYWGDYRDCDLPWHAFESALDNAVANSKC 290

Query:   139 SMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPY 198
               +Y TGD+V H +W TS  KN  V+  V+E      GD+PV P IGNHE HP+N+FSP 
Sbjct:   291 DFIYQTGDIVDHMVWATSVEKNTMVLTKVSERLNAAFGDVPVYPCIGNHEPHPLNLFSPE 350

Query:   199 FVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRIIVLNTN 251
              V    ST W+YE     W   LP   ++T LKGGYY+ +  K  RII LN+N
Sbjct:   351 GVPDEISTKWLYEHLYNDWSKWLPAETKETILKGGYYTVVPRKGFRIIALNSN 403
GO:0004767 "sphingomyelin phosphodiesterase activity" evidence=ISS
GO:0006684 "sphingomyelin metabolic process" evidence=ISS
GO:0006685 "sphingomyelin catabolic process" evidence=IEA
UNIPROTKB|F1Q018 SMPD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0039769 CG15534 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VD19 SMPD1 "Sphingomyelin phosphodiesterase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:98325 Smpd1 "sphingomyelin phosphodiesterase 1, acid lysosomal" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMN6 SMPD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1549719 Smpd1 "sphingomyelin phosphodiesterase 1, acid lysosomal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110411-222 smpd1 "sphingomyelin phosphodiesterase 1, acid lysosomal" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P17405 SMPD1 "Sphingomyelin phosphodiesterase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E9PKS3 SMPD1 "Sphingomyelin phosphodiesterase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
cd00842 296 cd00842, MPP_ASMase, acid sphingomyelinase and rel 3e-57
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 6e-05
>gnl|CDD|163618 cd00842, MPP_ASMase, acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  184 bits (469), Expect = 3e-57
 Identities = 76/193 (39%), Positives = 104/193 (53%), Gaps = 13/193 (6%)

Query: 69  IIQLTDIHYDPKYLAGKTAH--CIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIR 126
            + ++DIHYDP Y  G      C +PLCCR     +   +  A  +G Y  CD P  ++ 
Sbjct: 1   FLHISDIHYDPLYKVGSEYSANCHSPLCCR---DESGDISPPAGPWGDY-GCDSPWRLVE 56

Query: 127 SALEQIKK-HKNISMVYMTGDLVAHAIWE-TSRAKNIEVMKVVAELFREYLGDIPVIPII 184
           SALE IKK H     +  TGDLV H + E T     +  +  +  L ++   D PV P +
Sbjct: 57  SALEAIKKNHPKPDFILWTGDLVRHDVDEQTPETLVLISISNLTSLLKKAFPDTPVYPAL 116

Query: 185 GNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLR 244
           GNH+++PVN F P       S SW+Y++  + W   LPE A +TF KGGYYS   +  LR
Sbjct: 117 GNHDSYPVNQFPP-----NNSPSWLYDALAELWKSWLPEEAEETFKKGGYYSVPVKPGLR 171

Query: 245 IIVLNTNVYQKLN 257
           +I LNTN+Y K N
Sbjct: 172 VISLNTNLYYKKN 184

Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway. ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes). ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues. Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages. ASMase belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 296
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 257
KOG3770|consensus 577 100.0
cd00842 296 MPP_ASMase acid sphingomyelinase and related prote 100.0
cd07395 262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 99.54
cd07402 240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 99.46
PRK11148 275 cyclic 3',5'-adenosine monophosphate phosphodieste 99.44
cd07396 267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 99.29
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 99.2
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 99.14
COG1409 301 Icc Predicted phosphohydrolases [General function 99.12
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 99.12
PRK11340271 phosphodiesterase YaeI; Provisional 99.05
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 99.04
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 99.02
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.02
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.98
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 98.97
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.96
PHA02546 340 47 endonuclease subunit; Provisional 98.95
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.93
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.91
PRK10966 407 exonuclease subunit SbcD; Provisional 98.9
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.86
cd07378 277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 98.85
KOG1432|consensus 379 98.78
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.74
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 98.72
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 98.65
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 98.57
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.54
PLN02533 427 probable purple acid phosphatase 98.52
COG1408284 Predicted phosphohydrolases [General function pred 98.42
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 98.42
PRK09453182 phosphodiesterase; Provisional 98.41
TIGR03767 496 P_acnes_RR metallophosphoesterase, PPA1498 family. 98.39
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 98.38
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 98.36
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.36
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.35
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 98.31
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 98.29
PRK04036504 DNA polymerase II small subunit; Validated 98.28
cd07397 238 MPP_DevT Myxococcus xanthus DevT and related prote 98.23
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.2
PHA02239235 putative protein phosphatase 98.1
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 98.08
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 98.04
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 98.03
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 97.97
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 97.95
cd00838131 MPP_superfamily metallophosphatase superfamily, me 97.92
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.84
COG2908237 Uncharacterized protein conserved in bacteria [Fun 97.75
cd07406 257 MPP_CG11883_N Drosophila melanogaster CG11883 and 97.73
PRK00166 275 apaH diadenosine tetraphosphatase; Reviewed 97.71
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 97.63
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 97.61
cd00845 252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.6
KOG3662|consensus 410 97.58
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 97.52
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 97.48
TIGR03768 492 RPA4764 metallophosphoesterase, RPA4764 family. Th 97.43
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 97.42
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 97.4
PTZ00422 394 glideosome-associated protein 50; Provisional 97.38
cd07410 277 MPP_CpdB_N Escherichia coli CpdB and related prote 97.38
COG2129226 Predicted phosphoesterases, related to the Icc pro 97.38
cd07422 257 MPP_ApaH Escherichia coli ApaH and related protein 97.35
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 97.34
KOG2310|consensus 646 97.3
PRK09968218 serine/threonine-specific protein phosphatase 2; P 97.27
COG0622172 Predicted phosphoesterase [General function predic 97.16
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 97.15
cd07421 304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 97.13
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 97.1
cd07408 257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 97.07
KOG1378|consensus 452 97.0
TIGR00668 279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 96.95
cd07411 264 MPP_SoxB_N Thermus thermophilus SoxB and related p 96.92
cd07389228 MPP_PhoD Bacillus subtilis PhoD and related protei 96.9
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 96.86
cd00844 262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 96.68
cd07407 282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 96.61
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 96.48
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 96.34
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.29
cd07412 288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 96.2
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 96.17
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 95.96
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 95.95
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.87
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 95.82
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 95.53
cd07409 281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 95.51
KOG2679|consensus 336 95.36
cd08162 313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 94.58
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 94.49
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 94.47
smart00156 271 PP2Ac Protein phosphatase 2A homologues, catalytic 94.46
cd07405 285 MPP_UshA_N Escherichia coli UshA and related prote 94.45
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 94.32
cd07416 305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 93.62
cd07415 285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 93.46
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 93.31
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 93.23
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 93.15
cd07420 321 MPP_RdgC Drosophila melanogaster RdgC and related 93.07
cd07417 316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 92.89
cd07414 293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 92.61
PF09423 453 PhoD: PhoD-like phosphatase; InterPro: IPR018946 T 92.49
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 92.33
PTZ00480 320 serine/threonine-protein phosphatase; Provisional 92.16
PTZ00235 291 DNA polymerase epsilon subunit B; Provisional 92.07
PTZ00239 303 serine/threonine protein phosphatase 2A; Provision 90.87
COG1768230 Predicted phosphohydrolase [General function predi 90.53
cd07382 255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 90.53
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 90.28
TIGR00282 266 metallophosphoesterase, MG_246/BB_0505 family. A m 88.65
KOG3818|consensus525 87.7
PTZ00244 294 serine/threonine-protein phosphatase PP1; Provisio 87.25
PF13277 253 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C. 85.09
cd07419 311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 82.81
>KOG3770|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-59  Score=445.99  Aligned_cols=252  Identities=37%  Similarity=0.697  Sum_probs=226.8

Q ss_pred             CchhhhhhcCCCCChhhhcccccccCCCCCCC-CCCccCeeecCCCCcCCccCCCCCccCCCCCCceeEEEecccCCCCC
Q psy15259          2 DVLFDLKDQGIPLTPERVCGTVLENSNCSVKN-GPQVDWQVDTNYGTKVDRITAPSESRYLASGDEISIIQLTDIHYDPK   80 (257)
Q Consensus         2 ~~~~~i~~~~~~~~~~~~C~~~~~~~~C~~~~-~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~kvlhlSDiH~D~~   80 (257)
                      ++++++++... .++..+|+.+++ +.|.... +...+|++++|.+.+|++.  |..+.+..+...+|||||||+|+|+.
T Consensus        77 ~~f~~v~~r~~-~~~~~icg~~l~-~~c~~~~~~~~~~w~~~l~~~~~~p~~--p~~~~p~~~~p~~rvlhltDiH~D~~  152 (577)
T KOG3770|consen   77 DEFFDVFVRSA-NSPEEICGHFLP-DTCGDIVDPLENNWNLTLPGPPKPPRL--PKLPLPLKNNPTFRVLHLTDIHLDPD  152 (577)
T ss_pred             HHHHHHHHHHh-cCHHHHhhcccC-CccccccchhhhcceeeccCCCCCCCC--CCCCCCCCCCCceeEEEeeccccCcc
Confidence            57888998877 688999999887 6797654 3456899999963333222  22223335568899999999999999


Q ss_pred             CCCCCCcCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHHHHHHh-cCCccEEEEcCCCCcCcccccCHHH
Q psy15259         81 YLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKK-HKNISMVYMTGDLVAHAIWETSRAK  159 (257)
Q Consensus        81 Y~~g~~a~C~~~~CCr~~~~~~~~~~~~ag~~G~y~~CD~P~~l~~s~l~~i~~-~~~~dfii~TGD~v~H~~~~~s~~~  159 (257)
                      |.+|++++|..|+|||.+++.+...+.+||+||+|+.||+|+.|++++|++|++ ++++|||+||||+++|++|.++++.
T Consensus       153 Y~~gs~a~c~~p~ccr~s~~~p~~~~~~Ag~wG~y~~CD~P~~lies~L~~ike~~~~iD~I~wTGD~~~H~~w~~t~~~  232 (577)
T KOG3770|consen  153 YSEGSDADCDCPMCCRNSDGTPSGTKVAAGPWGDYGKCDSPKRLIESALDHIKENHKDIDYIIWTGDNVAHDVWAQTEEE  232 (577)
T ss_pred             cccCCcccccCccccccCCCCCCCccccCCCCCCcCCCCCCHHHHHHHHHHHHhcCCCCCEEEEeCCCCcccchhhhHHH
Confidence            999999999999999999998887888999999999999999999999999999 7679999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhCCCCEEEecCCCCCCCCCCCCCCCCCCCCChhhHHHHHHHHHhccCChhHHhhhhcCceEEEee
Q psy15259        160 NIEVMKVVAELFREYLGDIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLT  239 (257)
Q Consensus       160 ~~~~~~~~~~~l~~~~~~~pv~~~lGNHD~~P~n~f~~~~~~~~~~~~w~~~~l~~~w~~wl~~~~~~~~~~~GyYs~~~  239 (257)
                      +++++..++++|+++||++|||+++||||.+|+|.|+++.++...+.+|+|++++.+|+.||+.++++++++||||++.+
T Consensus       233 ~l~~~~~l~~~~~e~FpdvpvypalGNhe~~P~N~F~~~~~~~~~~~~wly~~~~~~W~~wlp~e~~~t~~kga~Y~~~~  312 (577)
T KOG3770|consen  233 NLSMLSRLTSLLSEYFPDVPVYPALGNHEIHPVNLFAPGSVPKRHSQLWLYKHLAGAWSTWLPAEAKETFLKGAYYLVLV  312 (577)
T ss_pred             HHHHHHHHHHHHHHhCCCCceeeecccCCCCcHhhcCCCCCcchhhhhHHHHHHHhhhhccCCHHHHhhhhcCcEEEEee
Confidence            99999999999999999999999999999999999999998877889999999999999999999999999999999999


Q ss_pred             cCCeEEEEEcCcccccCC
Q psy15259        240 EKNLRIIVLNTNVYQKLN  257 (257)
Q Consensus       240 ~~glriIsLNtn~~y~~N  257 (257)
                      .+|||+|||||++|+..|
T Consensus       313 ~~Glr~IslNt~~c~~~N  330 (577)
T KOG3770|consen  313 IDGLRLISLNTNYCSAPN  330 (577)
T ss_pred             cCCceEEEeccccccccc
Confidence            999999999999999887

>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1432|consensus Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>TIGR03767 P_acnes_RR metallophosphoesterase, PPA1498 family Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG3662|consensus Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03768 RPA4764 metallophosphoesterase, RPA4764 family Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>KOG2310|consensus Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG1378|consensus Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07389 MPP_PhoD Bacillus subtilis PhoD and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>KOG2679|consensus Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>PF09423 PhoD: PhoD-like phosphatase; InterPro: IPR018946 This entry contains a number of putative proteins as well as Alkaline phosphatase D which catalyses the reaction: A phosphate monoester + H(2)O = an alcohol + phosphate ; PDB: 2YEQ_B Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>KOG3818|consensus Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>PF13277 YmdB: YmdB-like protein; PDB: 2CV9_B 2Z06_C Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query257
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 4e-14
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 1e-09
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 4e-04
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 4e-04
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 5e-04
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Length = 443 Back     alignment and structure
 Score = 70.2 bits (171), Expect = 4e-14
 Identities = 24/203 (11%), Positives = 63/203 (31%), Gaps = 27/203 (13%)

Query: 54  APSESRYLASGDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYG 113
               +  +     +S++  TD+HY    L                        ++    G
Sbjct: 27  TEKITAPIEKDRNLSMVVTTDVHYFAPSLTDN-----------------GKAFEKYVAAG 69

Query: 114 HYDNCDMPLDVIRSALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFRE 173
                    ++  + L  ++  K   ++ ++GDL  +    +         + +A+   +
Sbjct: 70  DGKQLAYSDEITDAFLADVESKK-TDVLIISGDLTNNGEKTS--------HEELAKKLTQ 120

Query: 174 YLG-DIPVIPIIGNHETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKG 232
                  V  + GNH+ +          +   + +     F + +     E A  +    
Sbjct: 121 VEKNGTQVFVVPGNHDINNPWARKFEKDKQLPTDTISPTDFSKIYSDFGYEDAISSDEFS 180

Query: 233 GYYSFLTEKNLRIIVLNTNVYQK 255
             Y       + +++L+T +Y+ 
Sbjct: 181 LSYLAAPSSKVWLLMLDTAIYKT 203
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Length = 322 Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Length = 426 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Length = 274 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Length = 330 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 99.47
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 99.39
3d03_A 274 Phosphohydrolase; glycerophosphodiesterase, metall 99.39
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 99.37
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 99.02
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.98
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.95
2q8u_A 336 Exonuclease, putative; structural genomics, joint 98.94
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 98.93
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.89
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.88
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.86
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 98.85
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.83
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 98.83
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 98.75
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 98.54
1nnw_A 252 Hypothetical protein; structural genomics, PSI, pr 98.44
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 98.4
3qfm_A 270 SAPH, putative uncharacterized protein; sandwich f 98.4
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 98.39
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 98.39
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.37
3rl5_A 296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.27
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 98.25
3rqz_A 246 Metallophosphoesterase; PSI-biology, midwest cente 98.19
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 98.11
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 97.89
3ck2_A176 Conserved uncharacterized protein (predicted phosp 97.89
2qjc_A 262 Diadenosine tetraphosphatase, putative; putative d 97.76
2dfj_A 280 Diadenosinetetraphosphatase; helices and strands m 97.64
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 97.54
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 97.51
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 97.49
3qfk_A 527 Uncharacterized protein; structural genomics, cent 97.45
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 97.3
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 97.24
2z72_A 342 Protein-tyrosine-phosphatase; cold-active enzyme, 97.03
2ie4_C 309 PP2A-alpha;, serine/threonine-protein phosphatase 96.97
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 96.97
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 96.96
3h63_A 315 Serine/threonine-protein phosphatase 5; metalloenz 96.86
3e0j_A476 DNA polymerase subunit delta-2; DNA polymerase del 96.83
3icf_A 335 PPT, serine/threonine-protein phosphatase T; IRO m 96.78
1fjm_A 330 Protein serine/threonine phosphatase-1 (alpha ISO 96.77
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 96.57
3e7a_A 299 PP-1A, serine/threonine-protein phosphatase PP1-al 96.56
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 96.45
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 96.22
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 96.03
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 95.92
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 95.83
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 95.38
1t71_A 281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 92.39
3flo_A 460 DNA polymerase alpha subunit B; protein-protein co 88.35
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
Probab=99.47  E-value=1e-12  Score=117.14  Aligned_cols=89  Identities=20%  Similarity=0.275  Sum_probs=63.1

Q ss_pred             CCceeEEEecccCCCCCCCCCCCcCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHHHHHHh-cCCccEEE
Q psy15259         64 GDEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKK-HKNISMVY  142 (257)
Q Consensus        64 ~~~~kvlhlSDiH~D~~Y~~g~~a~C~~~~CCr~~~~~~~~~~~~ag~~G~y~~CD~P~~l~~s~l~~i~~-~~~~dfii  142 (257)
                      .+.+||+|+||+|++....                           +.+|.    ..+...++.+++.+++ ..++||||
T Consensus        23 ~~~~ri~~iSD~H~~~~~~---------------------------~~~~~----~~~~~~l~~~l~~i~~~~~~~d~vi   71 (330)
T 3ib7_A           23 RPDYVLLHISDTHLIGGDR---------------------------RLYGA----VDADDRLGELLEQLNQSGLRPDAIV   71 (330)
T ss_dssp             CCSEEEEEECCCCBCSSSC---------------------------CBTTT----BCHHHHHHHHHHHHHHHTCCCSEEE
T ss_pred             CCCeEEEEEeCCccCCCCc---------------------------ccccc----cCHHHHHHHHHHHHHhcCCCCCEEE
Confidence            4579999999999965321                           12232    2367889999999987 46899999


Q ss_pred             EcCCCCcCcccccCHHHHHHHHHHHHHHHHHHhCCCCEEEecCCCCC
Q psy15259        143 MTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHET  189 (257)
Q Consensus       143 ~TGD~v~H~~~~~s~~~~~~~~~~~~~~l~~~~~~~pv~~~lGNHD~  189 (257)
                      ++||++++...     .....+..+++.+.+.+ ++|||.++||||.
T Consensus        72 ~~GDl~~~~~~-----~~~~~~~~~l~~l~~~~-~~pv~~v~GNHD~  112 (330)
T 3ib7_A           72 FTGDLADKGEP-----AAYRKLRGLVEPFAAQL-GAELVWVMGNHDD  112 (330)
T ss_dssp             ECSCCBTTCCH-----HHHHHHHHHHHHHHHHH-TCEEEECCCTTSC
T ss_pred             ECCCCCCCCCH-----HHHHHHHHHHHHHHhhc-CCCEEEeCCCCCC
Confidence            99999987642     22233344444444444 5899999999996
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3e0j_A DNA polymerase subunit delta-2; DNA polymerase delta, P66 subunit, P50 subunit, human, DNA replication, DNA-directed DNA polymerase; HET: DNA; 3.00A {Homo sapiens} Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>3flo_A DNA polymerase alpha subunit B; protein-protein complex, phosphoesterase fold, OB fold, zinc motif, DNA replication, nucleus; HET: DNA; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 257
d2nxfa1 320 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homo 1e-07
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: ADPRibase-Mn-like
domain: Uncharacterized C17orf48 homolog zgc:64213
species: Zebrafish (Danio rerio) [TaxId: 7955]

 Score = 49.4 bits (116), Expect = 1e-07
 Identities = 26/187 (13%), Positives = 53/187 (28%), Gaps = 40/187 (21%)

Query: 67  ISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIR 126
            +   + D+ Y                           E    T+  +Y       D++R
Sbjct: 4   FTFGLIADVQYADIE---------------------DGENYLRTRRRYYRGS---ADLLR 39

Query: 127 SALEQIKKHKNISMVYMTGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGN 186
            A+ Q ++   +  V   GD++        R  +   +  V          + V  + GN
Sbjct: 40  DAVLQWRRE-RVQCVVQLGDIIDG--HNRRRDASDRALDTVMAELDAC--SVDVHHVWGN 94

Query: 187 HETHPVNVFSPYFVQGPTSTSWVYESFIQYWGWSLPESARQTFLKGGYYSFLTEKNLRII 246
           HE +  +  S    +  ++     ++     G                Y F    N R +
Sbjct: 95  HEFYNFSRPSLLSSRLNSAQRTGTDTGSDLIGDD-----------IYAYEFSPAPNFRFV 143

Query: 247 VLNTNVY 253
           +L+    
Sbjct: 144 LLDAYDL 150

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query257
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 99.6
d3d03a1 271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 99.51
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 99.29
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.11
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 98.92
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 98.85
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 98.65
d1nnwa_ 251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 98.59
d1utea_ 302 Mammalian purple acid phosphatase {Pig (Sus scrofa 98.53
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 98.31
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 98.05
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 97.83
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 97.63
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 97.44
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 97.32
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 97.2
d2z1aa2 302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 96.86
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 96.77
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 96.3
d1s95a_ 324 Serine/threonine protein phosphatase 5, PP5 {Human 89.52
d1jk7a_ 294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 89.02
d3c5wc1 288 Protein phosphatase 2A catalytic subunit alpha iso 88.75
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 83.78
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: GpdQ-like
domain: Rv0805 cyclic nucleotide phosphodiesterase
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.60  E-value=3.7e-15  Score=127.31  Aligned_cols=88  Identities=19%  Similarity=0.278  Sum_probs=61.3

Q ss_pred             CceeEEEecccCCCCCCCCCCCcCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCChHHHHHHHHHHHHh-cCCccEEEE
Q psy15259         65 DEISIIQLTDIHYDPKYLAGKTAHCIAPLCCRVDQPNASSETDRATKYGHYDNCDMPLDVIRSALEQIKK-HKNISMVYM  143 (257)
Q Consensus        65 ~~~kvlhlSDiH~D~~Y~~g~~a~C~~~~CCr~~~~~~~~~~~~ag~~G~y~~CD~P~~l~~s~l~~i~~-~~~~dfii~  143 (257)
                      +.|||+||||+|++..                           ..   +.+ .+..+.+.+++++++|++ ..++||||+
T Consensus         3 ~~~~i~~iSD~Hl~~~---------------------------~~---~~~-~~~~~~~~l~~~i~~i~~~~~~pD~vl~   51 (256)
T d2hy1a1           3 PDYVLLHISDTHLIGG---------------------------DR---RLY-GAVDADDRLGELLEQLNQSGLRPDAIVF   51 (256)
T ss_dssp             CSEEEEEECCCCBC-----------------------------------------CHHHHHHHHHHHHHHHTCCCSEEEE
T ss_pred             CCEEEEEEeeCccCCC---------------------------Cc---ccc-cCcCHHHHHHHHHHHHHhcCCCCCEEEE
Confidence            4799999999999542                           11   223 355578899999999988 678999999


Q ss_pred             cCCCCcCcccccCHHHHHHHHHHHHHHHHHHhCCCCEEEecCCCCC
Q psy15259        144 TGDLVAHAIWETSRAKNIEVMKVVAELFREYLGDIPVIPIIGNHET  189 (257)
Q Consensus       144 TGD~v~H~~~~~s~~~~~~~~~~~~~~l~~~~~~~pv~~~lGNHD~  189 (257)
                      +||+++++.++     ..+.+..+.+.+.+.+ ++|+|.++||||.
T Consensus        52 ~GDl~~~g~~~-----~~~~~~~~l~~~~~~~-~~p~~~v~GNHD~   91 (256)
T d2hy1a1          52 TGDLADKGEPA-----AYRKLRGLVEPFAAQL-GAELVWVMGNHDD   91 (256)
T ss_dssp             CSCCBSSCCHH-----HHHHHHHHHHHHHHHH-TCEEEECCCTTSC
T ss_pred             CCCCCCCCChh-----HHHHHHHHhhhhhhhc-CCCEEEEcccccc
Confidence            99999876432     2233444444444455 4899999999993
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure