Psyllid ID: psy15287

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180------
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
ccEEEEEccccccccEEEEccccccccccHHHHcccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccEEEEEEEEEEcccEEEEEEccccccccccEEEEccccccccccHHHHccccccccccccccccccccc
cEEEEEEccccHHHcEEEEcccccEEcccHHHHHcccEEcccccccccccccccHHHHHHHcccccccHHHHHHccccccccccccccccccccccccccccEEcEEEEEEccccccEEEEEEEEEEccccEEEEEEccccccHHHcEEEccccccEEcccHHHHHcccEEcccccccccccEEcc
prirlhfdgypdrfdfwvncnhpdlypcgwnanfhrriyppastpnmrntawFSWGKYlhvtksmaapphcftsshsskycacatqpgshcftsshmppsvFKIGRKLEAIdkkggsnlfHVATVRDVIGTRLHIhidsagssdrmdyWTDIgsayirpvgwcrrnkvklvppasgkrvsplffis
prirlhfdgypDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIdkkggsnlFHVATVRDVIGTRLHIhidsagssdrmdYWTDIGSAyirpvgwcrrnkvklvppasgkrvsplffis
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
***RLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVP**************
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKY*******GSH*F*SSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCA******SHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVSPLFFIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query186 2.2.26 [Sep-21-2011]
A2A5N8 826 Lethal(3)malignant brain yes N/A 0.784 0.176 0.416 2e-28
Q9Y468 752 Lethal(3)malignant brain no N/A 0.784 0.194 0.404 4e-28
E1C2V1 847 Lethal(3)malignant brain yes N/A 0.790 0.173 0.389 3e-27
D3ZWK4 826 Lethal(3)malignant brain yes N/A 0.784 0.176 0.393 7e-25
Q96JM7 780 Lethal(3)malignant brain no N/A 0.790 0.188 0.360 3e-24
B1B1A0 621 Lethal(3)malignant brain no N/A 0.790 0.236 0.358 2e-23
Q8BLB7 883 Lethal(3)malignant brain no N/A 0.790 0.166 0.360 2e-23
Q8NA19 623 Lethal(3)malignant brain no N/A 0.790 0.235 0.358 8e-23
Q9UQR0 700 Sex comb on midleg-like p no N/A 0.801 0.212 0.329 2e-12
Q96GD3 660 Polycomb protein SCMH1 OS no N/A 0.591 0.166 0.343 7e-12
>sp|A2A5N8|LMBL1_MOUSE Lethal(3)malignant brain tumor-like protein 1 OS=Mus musculus GN=L3mbtl1 PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 72/173 (41%), Positives = 91/173 (52%), Gaps = 27/173 (15%)

Query: 2   RIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHV 61
           R+RLHFDGY +  DFWVN N PD++P GW      ++      P       FSW +YL  
Sbjct: 341 RLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKL----QLPKGYKEEEFSWSQYLRS 396

Query: 62  TKSMAAPPHCFTS-SHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLF 120
           TK+ AAP H F S SHS+                   PP  F++G KLEA+D+   S L 
Sbjct: 397 TKAQAAPKHLFVSQSHST-------------------PPVGFQVGMKLEAVDRMNPS-LV 436

Query: 121 HVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPP 173
            VA+V DV+ +R  +H D  G  D  DYW D  S YI PVGWC++    L PP
Sbjct: 437 CVASVTDVVDSRFLVHFDDWG--DTYDYWCDPSSPYIHPVGWCQKQGKPLTPP 487
Polycomb group (PcG) protein that specifically recognizes and binds mono- and dimethyllysine residues on target proteins, therey acting as a 'reader' of a network of post-translational modifications. PcG proteins maintain the transcriptionally repressive state of genes: acts as a chromatin compaction factor by recognizing and binding mono- and dimethylated histone H1b/HIST1H1E at 'Lys-26' (H1bK26me1 and H1bK26me2) and histone H4 at 'Lys-20' (H4K20me1 and H4K20me2), leading to condense chromatin and repress transcription. Recognizes and binds p53/TP53 monomethylated at 'Lys-382', leading to repress p53/TP53-target genes. Also recognizes and binds RB1/RB monomethylated at 'Lys-860'. Participates in the ETV6-mediated repression. Probably plays a role in cell proliferation. Overexpression induces multinucleated cells, suggesting that it is required to accomplish normal mitosis.
Mus musculus (taxid: 10090)
>sp|Q9Y468|LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens GN=L3MBTL1 PE=1 SV=3 Back     alignment and function description
>sp|E1C2V1|LMBL1_CHICK Lethal(3)malignant brain tumor-like protein 1 OS=Gallus gallus GN=L3MBTL1 PE=3 SV=1 Back     alignment and function description
>sp|D3ZWK4|LMBL1_RAT Lethal(3)malignant brain tumor-like protein 1 OS=Rattus norvegicus GN=L3mbtl1 PE=3 SV=1 Back     alignment and function description
>sp|Q96JM7|LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens GN=L3MBTL3 PE=1 SV=2 Back     alignment and function description
>sp|B1B1A0|LMBL4_MOUSE Lethal(3)malignant brain tumor-like protein 4 OS=Mus musculus GN=L3mbtl4 PE=2 SV=2 Back     alignment and function description
>sp|Q8BLB7|LMBL3_MOUSE Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus GN=L3mbtl3 PE=1 SV=1 Back     alignment and function description
>sp|Q8NA19|LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens GN=L3MBTL4 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQR0|SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens GN=SCML2 PE=1 SV=1 Back     alignment and function description
>sp|Q96GD3|SCMH1_HUMAN Polycomb protein SCMH1 OS=Homo sapiens GN=SCMH1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
345485725 1276 PREDICTED: lethal(3)malignant brain tumo 0.784 0.114 0.395 2e-28
328720123 1135 PREDICTED: hypothetical protein LOC10016 0.806 0.132 0.4 4e-28
354479740 832 PREDICTED: lethal(3)malignant brain tumo 0.784 0.175 0.421 1e-27
189240736 1006 PREDICTED: similar to l(3)mbt-like 3 [Tr 0.790 0.146 0.410 2e-27
383848673 1246 PREDICTED: lethal(3)malignant brain tumo 0.844 0.126 0.403 2e-27
124486779 826 lethal(3)malignant brain tumor-like prot 0.784 0.176 0.416 1e-26
60360338 826 mKIAA0681 protein [Mus musculus] 0.784 0.176 0.416 1e-26
109733235 567 L3mbtl protein [Mus musculus] 0.784 0.257 0.416 1e-26
194387656 840 unnamed protein product [Homo sapiens] 0.784 0.173 0.404 2e-26
443722510 808 hypothetical protein CAPTEDRAFT_161824 [ 0.833 0.191 0.396 2e-26
>gi|345485725|ref|XP_001606620.2| PREDICTED: lethal(3)malignant brain tumor-like protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  130 bits (327), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 68/172 (39%), Positives = 93/172 (54%), Gaps = 26/172 (15%)

Query: 2   RIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHV 61
           R+RLHFDGY + FDFWVN +  D++P GW      ++ PP           F+W  YL +
Sbjct: 739 RLRLHFDGYAENFDFWVNADSMDIFPVGWAEKNGHKLQPPKGYVQSN----FNWNAYLRI 794

Query: 62  TKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFH 121
            K+ AAP   F++ +S                   M P+ F++G KLEA+D+K  S+L  
Sbjct: 795 CKATAAPKTLFSNKNS-------------------MIPTGFRVGMKLEAVDRK-HSSLVC 834

Query: 122 VATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPP 173
           VA+V DV+ +R+ +H DS    D  DYW D+ S YI PVGWC  N   L PP
Sbjct: 835 VASVADVMDSRILVHFDSW--DDVYDYWADVSSPYIHPVGWCHHNGHSLTPP 884

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328720123|ref|XP_001950851.2| PREDICTED: hypothetical protein LOC100167356, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|354479740|ref|XP_003502067.1| PREDICTED: lethal(3)malignant brain tumor-like protein 1 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|189240736|ref|XP_967932.2| PREDICTED: similar to l(3)mbt-like 3 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383848673|ref|XP_003699972.1| PREDICTED: lethal(3)malignant brain tumor-like protein 3-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|124486779|ref|NP_001074807.1| lethal(3)malignant brain tumor-like protein 1 [Mus musculus] gi|325530089|sp|A2A5N8.1|LMBL1_MOUSE RecName: Full=Lethal(3)malignant brain tumor-like protein 1; Short=H-l(3)mbt; Short=H-l(3)mbt protein; Short=L(3)mbt-like; AltName: Full=L(3)mbt protein homolog gi|148674362|gb|EDL06309.1| mCG1668, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|60360338|dbj|BAD90413.1| mKIAA0681 protein [Mus musculus] Back     alignment and taxonomy information
>gi|109733235|gb|AAI16640.1| L3mbtl protein [Mus musculus] Back     alignment and taxonomy information
>gi|194387656|dbj|BAG61241.1| unnamed protein product [Homo sapiens] Back     alignment and taxonomy information
>gi|443722510|gb|ELU11332.1| hypothetical protein CAPTEDRAFT_161824 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query186
UNIPROTKB|Q9Y468 752 L3MBTL1 "Lethal(3)malignant br 0.806 0.199 0.329 8.7e-15
UNIPROTKB|F1NLU1 520 F1NLU1 "Uncharacterized protei 0.516 0.184 0.42 1.7e-26
UNIPROTKB|E2RLD3 749 L3MBTL1 "Uncharacterized prote 0.806 0.200 0.329 1.1e-14
RGD|1307316 826 L3mbtl1 "l(3)mbt-like 1 (Droso 0.806 0.181 0.341 2.3e-15
MGI|MGI:2676663 826 L3mbtl1 "l(3)mbt-like (Drosoph 0.806 0.181 0.335 4.8e-15
UNIPROTKB|J9NV61 834 L3MBTL1 "Uncharacterized prote 0.806 0.179 0.329 1.3e-14
UNIPROTKB|E1C2V1 847 L3MBTL1 "Lethal(3)malignant br 0.806 0.177 0.317 9.6e-14
ZFIN|ZDB-GENE-040724-127 739 l3mbtl3 "l(3)mbt-like 3 (Droso 0.677 0.170 0.345 3.7e-11
ZFIN|ZDB-GENE-100922-38 851 l3mbtl1b "l(3)mbt-like 1b (Dro 0.521 0.113 0.417 4.3e-15
ZFIN|ZDB-GENE-090312-120 815 l3mbtl1a "l(3)mbt-like 1a (Dro 0.510 0.116 0.38 2.8e-23
UNIPROTKB|Q9Y468 L3MBTL1 "Lethal(3)malignant brain tumor-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 8.7e-15, P = 8.7e-15
 Identities = 57/173 (32%), Positives = 79/173 (45%)

Query:    18 VNCNHPDLY-------PCGWNANFHRRIYPP-------ASTPNMRNTAWFS-WGKYLHVT 62
             ++  HP +Y        CG+    H   Y         A++P++    WF   G  L   
Sbjct:   247 IDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQPP 306

Query:    63 KSMAAPPHCFTSSHSSKYCACATQPGSHCFTS-SHMPPSV-FKIGRKLEAIDKKGGSNLF 120
             K        F+ S   +       P  H F S SH PP + F++G KLEA+D+   S L 
Sbjct:   307 KGYKEEE--FSWSQYLRSTRAQAAP-KHLFVSQSHSPPPLGFQVGMKLEAVDRMNPS-LV 362

Query:   121 HVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPP 173
              VA+V DV+ +R  +H D+    D  DYW D  S YI PVGWC++    L PP
Sbjct:   363 CVASVTDVVDSRFLVHFDNW--DDTYDYWCDPSSPYIHPVGWCQKQGKPLTPP 413
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0000793 "condensed chromosome" evidence=IDA
GO:0005634 "nucleus" evidence=IDA
GO:0005654 "nucleoplasm" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0007088 "regulation of mitosis" evidence=IMP
GO:0042802 "identical protein binding" evidence=IPI
GO:0032093 "SAM domain binding" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA;IMP
GO:0042393 "histone binding" evidence=IPI
GO:0045652 "regulation of megakaryocyte differentiation" evidence=IDA
GO:0035064 "methylated histone residue binding" evidence=IDA;IPI
GO:0051726 "regulation of cell cycle" evidence=NAS
GO:0016568 "chromatin modification" evidence=IDA
GO:0031491 "nucleosome binding" evidence=IDA
GO:0000785 "chromatin" evidence=IDA
GO:0003682 "chromatin binding" evidence=IDA
GO:0031493 "nucleosomal histone binding" evidence=IDA
GO:0030097 "hemopoiesis" evidence=IEP
UNIPROTKB|F1NLU1 F1NLU1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLD3 L3MBTL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1307316 L3mbtl1 "l(3)mbt-like 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2676663 L3mbtl1 "l(3)mbt-like (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV61 L3MBTL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2V1 L3MBTL1 "Lethal(3)malignant brain tumor-like protein 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-127 l3mbtl3 "l(3)mbt-like 3 (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100922-38 l3mbtl1b "l(3)mbt-like 1b (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-120 l3mbtl1a "l(3)mbt-like 1a (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
smart0056196 smart00561, MBT, Present in Drosophila Scm, l(3)mb 4e-24
pfam0282073 pfam02820, MBT, mbt repeat 3e-15
smart0056196 smart00561, MBT, Present in Drosophila Scm, l(3)mb 1e-10
pfam0282073 pfam02820, MBT, mbt repeat 3e-10
>gnl|CDD|214723 smart00561, MBT, Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information 
 Score = 90.4 bits (225), Expect = 4e-24
 Identities = 45/117 (38%), Positives = 55/117 (47%), Gaps = 22/117 (18%)

Query: 57  KYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGG 116
            YL  T + AAP   F     S                   PP+ FK+G KLEA+D +  
Sbjct: 2   DYLEETGARAAPVELFKQPVDS-------------------PPNGFKVGMKLEAVDPRNP 42

Query: 117 SNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPP 173
           S L  VATV +V G RL +H D  G  D+ D+W    S  I PVGWC +N   L PP
Sbjct: 43  S-LICVATVVEVKGYRLLLHFD--GWDDKYDFWCHADSPDIFPVGWCEKNGHPLQPP 96

Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2. These proteins are involved in transcriptional regulation. Length = 96
>gnl|CDD|202414 pfam02820, MBT, mbt repeat Back     alignment and domain information
>gnl|CDD|214723 smart00561, MBT, Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>gnl|CDD|202414 pfam02820, MBT, mbt repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 186
KOG3766|consensus 478 100.0
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 100.0
KOG3766|consensus478 99.97
PF0282073 MBT: mbt repeat; InterPro: IPR004092 The function 99.96
PF0282073 MBT: mbt repeat; InterPro: IPR004092 The function 99.75
smart0056196 MBT Present in Drosophila Scm, l(3)mbt, and verteb 99.71
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 97.77
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 96.37
smart0074361 Agenet Tudor-like domain present in plant sequence 95.43
PF06003 264 SMN: Survival motor neuron protein (SMN); InterPro 88.0
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 85.8
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 83.47
PLN00104 450 MYST -like histone acetyltransferase; Provisional 82.53
PF1162353 DUF3252: Protein of unknown function (DUF3252); In 80.21
>KOG3766|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.2e-39  Score=291.60  Aligned_cols=161  Identities=37%  Similarity=0.704  Sum_probs=146.0

Q ss_pred             CceEEEEcCCCCCCcEEEeCCCCCcccCchhHhhCCccCCCCCCCCCCCCCCCCHHHHHHhhC--CCCCCCCCcccCCCc
Q psy15287          1 PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTK--SMAAPPHCFTSSHSS   78 (186)
Q Consensus         1 ~r~~lhfdG~~~~~dfW~~~~S~~IhPvGw~~~~g~~L~pP~g~~~~~~~~~f~W~~YL~~~~--~~~aP~~~F~~~~~~   78 (186)
                      .|++|+|||.++.+|||+|++||+|||+|||+++|+.|+||.+|..   .+.++|+.||+++-  +..+|..+|..... 
T Consensus       118 ~Rl~l~~~g~~~~~dfW~~~~sp~i~pvGw~~~~g~~l~pP~~~~~---~~~~s~~~~~~k~~~~~~~~p~~~~~~~~~-  193 (478)
T KOG3766|consen  118 GRLRLRFDGLDENYDFWLHALSPDIHPVGWCEKSGHKLQPPLGYRI---RNEYSWEQYLEKTLGQAELAPKRLFVREPS-  193 (478)
T ss_pred             cEEEEEecCcccCCccceecCCccccccccccccCcccCCCccccc---cccccccchhhhcccccccCcccccccccc-
Confidence            3899999999999999999999999999999999999999999973   57899999999983  78888888866543 


Q ss_pred             ccccccCCCCCcccccCCCCCCCCCcccEEEeecCCCCCccEEEEEEEeeeCCe-EEEEecCCCCCCC-CCeEEeCCCCC
Q psy15287         79 KYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTR-LHIHIDSAGSSDR-MDYWTDIGSAY  156 (186)
Q Consensus        79 ~~~~~~~~~g~~~~~~~~~~~~~F~vGmkLEa~d~~~~~~~i~vAtV~~v~g~~-l~v~~dg~~~d~~-~d~W~d~~S~~  156 (186)
                                      .....+.|++|||||+||+.| |..||||||.+|.+.+ +.|++|+|  +.+ +|+||+.+|+.
T Consensus       194 ----------------~~~~~~~F~vgmkLEavd~~n-p~~IcvATV~~V~~~~~i~v~~d~~--~~~~~d~~~~~~s~~  254 (478)
T KOG3766|consen  194 ----------------RDPPPSRFQVGMKLEAVDDLN-PSAICVATVVEVFDSREILVHFDGW--DKSELDYWCDHDSPK  254 (478)
T ss_pred             ----------------cCCCCCcceeccEEEEeccCC-CcceeeeehheecccceEEEEeccC--CCcccceeEecCCCc
Confidence                            135679999999999999999 9999999999999999 99999999  777 99999999999


Q ss_pred             eeeeeceeccCCcccCCCCCCCCCCccc
Q psy15287        157 IRPVGWCRRNKVKLVPPASGKRVSPLFF  184 (186)
Q Consensus       157 I~PvGwc~~~g~~L~pP~~~~~~~~~~~  184 (186)
                      |||||||..+|+.|+||+.|.+...+-|
T Consensus       255 I~Pv~~~~~~~~~L~ppk~~~~~~~~~~  282 (478)
T KOG3766|consen  255 IFPVGWCCKNGDKLTPPKDYYEADNFKW  282 (478)
T ss_pred             eeeeeEhhhcCcccCCCccccccccccc
Confidence            9999999999999999997776666554

>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>KOG3766|consensus Back     alignment and domain information
>PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression Back     alignment and domain information
>PF02820 MBT: mbt repeat; InterPro: IPR004092 The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression Back     alignment and domain information
>smart00561 MBT Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2 Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PF11623 DUF3252: Protein of unknown function (DUF3252); InterPro: IPR021659 This family of proteins has no known function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
2ri5_A319 Crystal Structure Of The 3-Mbt Repeats From Human L 4e-29
2rhu_A 329 Crystal Structure Of The 3-Mbt Repeats From Human L 5e-29
2rhy_A319 Crystal Structure Of The 3-Mbt Repeats From Human L 5e-29
2ri3_A319 Crystal Structure Of The 3-Mbt Repeats From Human L 6e-29
1oyx_A 331 Crystal Structure Of 3-Mbt Repeats Of Lethal (3) Ma 7e-29
3oq5_A 345 Crystal Structure Of The 3-Mbt Domain From Human L3 8e-29
2rhi_A 345 Crystal Structure Of The 3-mbt Domain From Human L3 9e-29
1oz2_A 331 Crystal Structure Of 3-Mbt Repeats Of Lethal (3) Ma 9e-29
2rjc_A 331 Crystal Structure Of L3mbtl1 Protein In Complex Wit 1e-28
2pqw_A323 Crystal Structure Of L3mbtl1 In Complex With H4k20m 1e-28
2rhz_A319 Crystal Structure Of The 3-Mbt Repeats From Human L 2e-28
2ri2_A319 Crystal Structure Of The 3-Mbt Repeats From Human L 4e-28
4fl6_A 332 Crystal Structure Of The Complex Of The 3-Mbt Repea 4e-25
3ut1_A324 Crystal Structure Of The 3-Mbt Repeat Domain Of L3m 5e-25
1oi1_A221 Crystal Structure Of The Mbt Domains Of Human Scml2 9e-14
4edu_A215 The Mbt Repeats Of Human Scml2 In A Complex With Hi 1e-13
4edu_A215 The Mbt Repeats Of Human Scml2 In A Complex With Hi 4e-12
2biv_A243 Crystal Structure Of The Wild-Type Mbt Domains Of H 1e-13
2p0k_A212 Crystal Structure Of Scmh1 Length = 212 8e-13
2r57_A 265 Crystal Structure Of The Two Mbt Repeats From Sex-C 1e-11
3cey_A474 Crystal Structure Of L3mbtl2 Length = 474 1e-11
3f70_A456 Crystal Structure Of L3mbtl2-H4k20me1 Complex Lengt 2e-11
1wjs_A127 Solution Structure Of The First Mbt Domain From Hum 5e-11
1wjs_A127 Solution Structure Of The First Mbt Domain From Hum 1e-09
3feo_A437 The Crystal Structure Of Mbtd1 Length = 437 7e-11
3h6z_A447 Crystal Structure Of The Four Mbt Repeats Of Drosop 5e-09
1wjq_A107 Solution Structure Of The Third Mbt Domain From Hum 6e-08
1wjr_A127 Solution Structure Of The 2nd Mbt Domain From Human 1e-04
>pdb|2RI5|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 With N358a Point Mutation Length = 319 Back     alignment and structure 
Iteration: 1

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/173 (40%), Positives = 91/173 (52%), Gaps = 27/173 (15%)
Query: 2   RIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHV 61
           R+RLHFDGY +  DFWVN N PD++P GW      ++ PP           FSW +YL  
Sbjct: 67  RLRLHFDGYSEXHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEE----FSWSQYLRS 122
Query: 62  TKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSV-FKIGRKLEAIDKKGGSNLF 120
           T++ AAP H F S                    SH PP + F++G KLEA+D+   S L 
Sbjct: 123 TRAQAAPKHLFVS-------------------QSHSPPPLGFQVGMKLEAVDRMAPS-LV 162
Query: 121 HVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPP 173
            VA+V DV+ +R  +H D+    D  DYW D  S YI PVGWC++    L PP
Sbjct: 163 CVASVTDVVDSRFLVHFDNW--DDTYDYWCDPSSPYIHPVGWCQKQGKPLTPP 213
>pdb|2RHU|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 Bound To Dimethyl-Lysine And In Chimera With Histone H3.3(28-34) Length = 329 Back     alignment and structure
>pdb|2RHY|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 Bound To Monomethyl-Lysine Length = 319 Back     alignment and structure
>pdb|2RI3|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 With N358q Point Mutation Length = 319 Back     alignment and structure
>pdb|1OYX|A Chain A, Crystal Structure Of 3-Mbt Repeats Of Lethal (3) Malignant Brain Tumor (Seleno-Met) At 1.85 Angstrom Length = 331 Back     alignment and structure
>pdb|3OQ5|A Chain A, Crystal Structure Of The 3-Mbt Domain From Human L3mbtl1 In Complex With P53k382me1 Length = 345 Back     alignment and structure
>pdb|2RHI|A Chain A, Crystal Structure Of The 3-mbt Domain From Human L3mbtl1 In Complex With H1.5k27me2 At 1.66 Angstrom Length = 345 Back     alignment and structure
>pdb|1OZ2|A Chain A, Crystal Structure Of 3-Mbt Repeats Of Lethal (3) Malignant Brain Tumor (Native-Ii) At 1.55 Angstrom Length = 331 Back     alignment and structure
>pdb|2RJC|A Chain A, Crystal Structure Of L3mbtl1 Protein In Complex With Mes Length = 331 Back     alignment and structure
>pdb|2PQW|A Chain A, Crystal Structure Of L3mbtl1 In Complex With H4k20me2 (Residues 17- 25), Trigonal Form Length = 323 Back     alignment and structure
>pdb|2RHZ|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 With D355n Point Mutation Length = 319 Back     alignment and structure
>pdb|2RI2|A Chain A, Crystal Structure Of The 3-Mbt Repeats From Human L3mbtl1 With D355a Point Mutation Length = 319 Back     alignment and structure
>pdb|4FL6|A Chain A, Crystal Structure Of The Complex Of The 3-Mbt Repeat Domain Of L3mbtl3 And Unc1215 Length = 332 Back     alignment and structure
>pdb|3UT1|A Chain A, Crystal Structure Of The 3-Mbt Repeat Domain Of L3mbtl3 Length = 324 Back     alignment and structure
>pdb|1OI1|A Chain A, Crystal Structure Of The Mbt Domains Of Human Scml2 Length = 221 Back     alignment and structure
>pdb|4EDU|A Chain A, The Mbt Repeats Of Human Scml2 In A Complex With Histone H2a Peptide Length = 215 Back     alignment and structure
>pdb|4EDU|A Chain A, The Mbt Repeats Of Human Scml2 In A Complex With Histone H2a Peptide Length = 215 Back     alignment and structure
>pdb|2BIV|A Chain A, Crystal Structure Of The Wild-Type Mbt Domains Of Human Scml2 Length = 243 Back     alignment and structure
>pdb|2P0K|A Chain A, Crystal Structure Of Scmh1 Length = 212 Back     alignment and structure
>pdb|2R57|A Chain A, Crystal Structure Of The Two Mbt Repeats From Sex-Comb On Midleg (Scm) Length = 265 Back     alignment and structure
>pdb|3CEY|A Chain A, Crystal Structure Of L3mbtl2 Length = 474 Back     alignment and structure
>pdb|3F70|A Chain A, Crystal Structure Of L3mbtl2-H4k20me1 Complex Length = 456 Back     alignment and structure
>pdb|1WJS|A Chain A, Solution Structure Of The First Mbt Domain From Human Kiaa1798 Protein Length = 127 Back     alignment and structure
>pdb|1WJS|A Chain A, Solution Structure Of The First Mbt Domain From Human Kiaa1798 Protein Length = 127 Back     alignment and structure
>pdb|3FEO|A Chain A, The Crystal Structure Of Mbtd1 Length = 437 Back     alignment and structure
>pdb|3H6Z|A Chain A, Crystal Structure Of The Four Mbt Repeats Of Drosophila Melanogaster Sfmbt In Complex With Peptide Rhr (Me)k Vlr Length = 447 Back     alignment and structure
>pdb|1WJQ|A Chain A, Solution Structure Of The Third Mbt Domain From Human Kiaa1798 Protein Length = 107 Back     alignment and structure
>pdb|1WJR|A Chain A, Solution Structure Of The 2nd Mbt Domain From Human Kiaa1617 Protein Length = 127 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query186
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 3e-40
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 1e-39
3ut1_A 324 Lethal(3)malignant brain tumor-like protein 3; chr 9e-24
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 2e-36
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 2e-31
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 2e-10
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 3e-35
2r58_A 265 Polycomb protein SCM; MBT repeat, sex COMB on midl 1e-26
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 4e-12
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 4e-35
1oz2_A 331 Lethal(3)malignant brain tumor-like protein; prope 2e-34
1oz2_A 331 Lethal(3)malignant brain tumor-like protein; prope 4e-23
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 1e-09
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 9e-35
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 3e-34
3h6z_A 447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 3e-30
3h6z_A 447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 1e-20
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 2e-34
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 4e-32
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 1e-30
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 4e-22
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 2e-09
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 1e-33
3feo_A 437 MBT domain-containing protein 1; MBTL1, structural 2e-29
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 2e-27
3feo_A 437 MBT domain-containing protein 1; MBTL1, structural 3e-21
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 2e-09
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 2e-22
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 1e-10
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 1e-20
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 3e-13
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 2e-11
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 1e-05
3sd4_A69 PHD finger protein 20; tudor domain, transcription 2e-09
3sd4_A69 PHD finger protein 20; tudor domain, transcription 8e-04
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Length = 324 Back     alignment and structure
 Score =  137 bits (347), Expect = 3e-40
 Identities = 61/181 (33%), Positives = 89/181 (49%), Gaps = 25/181 (13%)

Query: 1   PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLH 60
            RI+LHFDGY D +DFWVN +  D++P GW      +++PP           F+W  YL 
Sbjct: 65  YRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEE----EFNWQTYLK 120

Query: 61  VTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLF 120
             K+ AAP   F + + +                  + PS F++G KLEA+DKK   +  
Sbjct: 121 TCKAQAAPKSLFENQNIT------------------VIPSGFRVGMKLEAVDKK-NPSFI 161

Query: 121 HVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGKRVS 180
            VATV D++  R  +H D     +  DYW +  S +I PVGWC+ ++  L+ P     V 
Sbjct: 162 CVATVTDMVDNRFLVHFD--NWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYPNVK 219

Query: 181 P 181
            
Sbjct: 220 H 220
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Length = 324 Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Length = 324 Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Length = 243 Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Length = 243 Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Length = 243 Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Length = 265 Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Length = 265 Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Length = 265 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Length = 331 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Length = 331 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Length = 331 Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Length = 331 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Length = 447 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Length = 447 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Length = 447 Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Length = 447 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Length = 456 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Length = 456 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Length = 456 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Length = 456 Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Length = 456 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Length = 437 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Length = 437 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Length = 437 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Length = 437 Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Length = 437 Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Length = 107 Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Length = 107 Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Length = 127 Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Length = 127 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Length = 88 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Length = 88 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Length = 69 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 100.0
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 100.0
2r58_A265 Polycomb protein SCM; MBT repeat, sex COMB on midl 100.0
1oz2_A 331 Lethal(3)malignant brain tumor-like protein; prope 100.0
3ut1_A324 Lethal(3)malignant brain tumor-like protein 3; chr 100.0
1oz2_A331 Lethal(3)malignant brain tumor-like protein; prope 100.0
3feo_A437 MBT domain-containing protein 1; MBTL1, structural 100.0
3f70_A456 Lethal(3)malignant brain tumor-like 2 protein; MBT 100.0
3h6z_A447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 100.0
3feo_A 437 MBT domain-containing protein 1; MBTL1, structural 100.0
3f70_A 456 Lethal(3)malignant brain tumor-like 2 protein; MBT 100.0
3h6z_A 447 Polycomb protein SFMBT; MBT, MBR repeat, aromatic 100.0
2biv_A243 SCML2 protein, sex COMB on midleg-like protein 2; 100.0
2r58_A 265 Polycomb protein SCM; MBT repeat, sex COMB on midl 100.0
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 100.0
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 99.97
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 99.92
1wjr_A127 KIAA1617 protein; MBT domain, structural genomics, 99.9
3sd4_A69 PHD finger protein 20; tudor domain, transcription 99.87
1wjq_A107 KIAA1798 protein; MBT domain, structural genomics, 99.73
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 99.36
3sd4_A69 PHD finger protein 20; tudor domain, transcription 98.81
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 97.75
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 97.51
2lcc_A76 AT-rich interactive domain-containing protein 4A; 97.06
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 96.95
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 96.94
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 96.93
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 96.48
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 95.02
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 95.94
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 95.76
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 95.38
3dlm_A213 Histone-lysine N-methyltransferase setdb1; setdb1_ 93.97
2bud_A92 Males-absent on the first protein; transferase, MO 93.45
2k3y_A136 Chromatin modification-related protein EAF3; dimet 92.11
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 91.22
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 91.2
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 90.19
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 90.01
3e9g_A130 Chromatin modification-related protein EAF3; chrom 89.05
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 88.25
2eqj_A66 Metal-response element-binding transcription facto 87.91
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 86.95
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 86.42
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 85.23
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 84.4
2jz2_A66 SSL0352 protein; SH3-like, synechocystis SP. PCC 6 83.76
3qii_A85 PHD finger protein 20; tudor domain, structural ge 83.21
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 83.05
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 81.32
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
Probab=100.00  E-value=8.7e-58  Score=396.91  Aligned_cols=159  Identities=38%  Similarity=0.783  Sum_probs=148.3

Q ss_pred             CceEEEEcCCCCCCcEEEeCCCCCcccCchhHhhCCccCCCCCCCCCCCCCCCCHHHHHHhhCCCCCCCCCcccCCCccc
Q psy15287          1 PRIRLHFDGYPDRFDFWVNCNHPDLYPCGWNANFHRRIYPPASTPNMRNTAWFSWGKYLHVTKSMAAPPHCFTSSHSSKY   80 (186)
Q Consensus         1 ~r~~lhfdG~~~~~dfW~~~~S~~IhPvGw~~~~g~~L~pP~g~~~~~~~~~f~W~~YL~~~~~~~aP~~~F~~~~~~~~   80 (186)
                      .||||||||+++++|||||++|++|||||||++||+.|+||+||.    +..|+|++||+++++++||.++|++...   
T Consensus        65 ~rl~l~~dg~~~~~dFW~~~~S~~IhPvGwc~~~g~~L~pP~g~~----~~~f~W~~yL~~~~a~~aP~~lF~~~~~---  137 (324)
T 3ut1_A           65 YRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYK----EEEFNWQTYLKTCKAQAAPKSLFENQNI---  137 (324)
T ss_dssp             TEEEEEETTSCGGGCEEEETTCSSEECTTHHHHHTCCEECCTTCC----TTTCCHHHHHHHTTCCBCCGGGCTTTTC---
T ss_pred             CEEEEEECCCCCCCCEEEeCCCCCeeccchhHhcCeeccCCCCCc----CCCCCHHHHHHHhCcccCChHHcccCCC---
Confidence            489999999999999999999999999999999999999999999    7899999999999999999999998643   


Q ss_pred             ccccCCCCCcccccCCCCCCCCCcccEEEeecCCCCCccEEEEEEEeeeCCeEEEEecCCCCCCCCCeEEeCCCCCeeee
Q psy15287         81 CACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPV  160 (186)
Q Consensus        81 ~~~~~~~g~~~~~~~~~~~~~F~vGmkLEa~d~~~~~~~i~vAtV~~v~g~~l~v~~dg~~~d~~~d~W~d~~S~~I~Pv  160 (186)
                                     ....|+|++||||||+|+++ +.+||||||++|.|++|+||||||  ++++||||+++|++||||
T Consensus       138 ---------------~~~~~~F~vGMKLEavDp~~-p~~icvATV~~V~g~~l~v~~Dg~--~~~~d~w~~~~Sp~I~PV  199 (324)
T 3ut1_A          138 ---------------TVIPSGFRVGMKLEAVDKKN-PSFICVATVTDMVDNRFLVHFDNW--DESYDYWCEASSPHIHPV  199 (324)
T ss_dssp             ---------------CCCCCSCCTTCEEEEEETTE-EEEEEEEEEEEEETTEEEEEETTS--CGGGCEEECTTCTTEECT
T ss_pred             ---------------ccCccccccCCEEEEecCCC-CCcEEEEEEEEEECCEEEEEECCC--CCcCCEEEECCCCCcccC
Confidence                           24578999999999999999 999999999999999999999999  888999999999999999


Q ss_pred             eceeccCCcccCCCCCCCCCCccc
Q psy15287        161 GWCRRNKVKLVPPASGKRVSPLFF  184 (186)
Q Consensus       161 Gwc~~~g~~L~pP~~~~~~~~~~~  184 (186)
                      |||++||++|+||++|+....|.|
T Consensus       200 GWCe~~g~~L~pP~gy~~~~~f~W  223 (324)
T 3ut1_A          200 GWCKEHRRTLITPPGYPNVKHFSW  223 (324)
T ss_dssp             THHHHTTCCEECCTTC--CCSCCH
T ss_pred             cHHHhcCCCCCCCCCCCCCCcccH
Confidence            999999999999999997666666
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>3ut1_A Lethal(3)malignant brain tumor-like protein 3; chromatin modification, transcription repression, MBT repeat structural genomics; HET: EPE; 2.05A {Homo sapiens} PDB: 4fl6_A* 1wjs_A Back     alignment and structure
>1oz2_A Lethal(3)malignant brain tumor-like protein; propeller, transcription repressor, three malignant brain TU repeats, transcription; HET: MES; 1.55A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 b.34.9.3 PDB: 1oyx_A* 1oz3_A* 3oq5_A* 2rhi_A* 2rhx_A* 2rjd_A 2rjc_A 2rje_A* 2rjf_A* 3uwn_A* 2pqw_A* 3p8h_A* 2rhu_A* 2rhy_A* 2rhz_A* 2ri3_A* 2ri2_A* 2ri5_A* Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>3feo_A MBT domain-containing protein 1; MBTL1, structural genomics, structural genomics consortium, metal-binding, nucleus, zinc-finger; 2.50A {Homo sapiens} Back     alignment and structure
>3f70_A Lethal(3)malignant brain tumor-like 2 protein; MBT, chromatin regulator, metal-binding, nucleus, transcript transcription regulation, zinc-finger; HET: MLZ; 2.10A {Homo sapiens} PDB: 3dbb_A* 3cey_A Back     alignment and structure
>3h6z_A Polycomb protein SFMBT; MBT, MBR repeat, aromatic CAGE, chromatin regulator, DNA-BIN metal-binding, nucleus, repressor, transcription; HET: MLZ SUC; 2.80A {Drosophila melanogaster} Back     alignment and structure
>2biv_A SCML2 protein, sex COMB on midleg-like protein 2; MBT, malignant brain tumor, transcription factor; 1.7A {Homo sapiens} SCOP: b.34.9.3 b.34.9.3 PDB: 1oi1_A 2vyt_A* 2p0k_A Back     alignment and structure
>2r58_A Polycomb protein SCM; MBT repeat, sex COMB on midleg, DI-methyl lysine, regulator, developmental protein, metal-binding, nucleus; HET: MLY; 2.00A {Drosophila melanogaster} PDB: 2r57_A* 2r5a_A* 2r5m_A* Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>1wjr_A KIAA1617 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>1wjq_A KIAA1798 protein; MBT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.9.3 Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3dlm_A Histone-lysine N-methyltransferase setdb1; setdb1_human, structural genomics, structural genomics consortium, SGC, alternative splicing; 1.77A {Homo sapiens} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>2jz2_A SSL0352 protein; SH3-like, synechocystis SP. PCC 6803, targe PSI, protein structure initiative, northeast structural GEN consortium, NESG; NMR {Synechocystis SP} PDB: 3c4s_A Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 186
d1oz2a1110 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumo 1e-28
d1oz2a1110 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumo 9e-10
d1oz2a3106 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumo 1e-27
d1oz2a3106 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumo 1e-09
d1oi1a1103 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sap 6e-27
d1oi1a1103 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sap 3e-09
d1oz2a2108 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumo 2e-26
d1oz2a2108 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumo 2e-09
d1oi1a2104 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sa 5e-25
d1oi1a2104 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sa 8e-10
d1wjra_127 b.34.9.3 (A:) Scm-like with four MBT domains prote 3e-22
d1wjra_127 b.34.9.3 (A:) Scm-like with four MBT domains prote 2e-13
d1wjqa_107 b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 6e-21
d1wjqa_107 b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 9e-10
d1wjsa_127 b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 2e-20
d1wjsa_127 b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 1e-15
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: MBT repeat
domain: Lethal(3)malignant brain tumor-like protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  100 bits (251), Expect = 1e-28
 Identities = 38/121 (31%), Positives = 55/121 (45%), Gaps = 20/121 (16%)

Query: 53  FSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAID 112
           +SW  YL   K++ AP   F  S +                      + FK+G KLE ID
Sbjct: 3   WSWESYLEEQKAITAPVSLFQDSQAVT-----------------HNKNGFKLGMKLEGID 45

Query: 113 KKGGSNLFHVATVRDVIGTRLHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVP 172
            +   +++ + TV +V G RL +H D  G S+  D+W +  S  I P GW  +   KL P
Sbjct: 46  PQH-PSMYFILTVAEVCGYRLRLHFD--GYSECHDFWVNANSPDIHPAGWFEKTGHKLQP 102

Query: 173 P 173
           P
Sbjct: 103 P 103
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query186
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 100.0
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 100.0
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 100.0
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 99.97
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 99.97
d1wjra_127 Scm-like with four MBT domains protein 2, SFMBT2 ( 99.97
d1wjsa_127 Lethal(3)malignant brain tumor-like 3 protein, L3M 99.94
d1wjra_127 Scm-like with four MBT domains protein 2, SFMBT2 ( 99.87
d1oi1a1103 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1oz2a3106 Lethal(3)malignant brain tumor-like protein {Human 99.74
d1oz2a2108 Lethal(3)malignant brain tumor-like protein {Human 99.72
d1oz2a1110 Lethal(3)malignant brain tumor-like protein {Human 99.71
d1oi1a2104 Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1wjqa_107 Lethal(3)malignant brain tumor-like 3 protein, L3M 99.67
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 97.31
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 96.24
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 94.67
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Tudor/PWWP/MBT
family: MBT repeat
domain: Scml2 protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-42  Score=255.12  Aligned_cols=103  Identities=38%  Similarity=0.705  Sum_probs=98.7

Q ss_pred             CCHHHHHHhhCCCCCCCCCcccCCCcccccccCCCCCcccccCCCCCCCCCcccEEEeecCCCCCccEEEEEEEeeeCCe
Q psy15287         53 FSWGKYLHVTKSMAAPPHCFTSSHSSKYCACATQPGSHCFTSSHMPPSVFKIGRKLEAIDKKGGSNLFHVATVRDVIGTR  132 (186)
Q Consensus        53 f~W~~YL~~~~~~~aP~~~F~~~~~~~~~~~~~~~g~~~~~~~~~~~~~F~vGmkLEa~d~~~~~~~i~vAtV~~v~g~~  132 (186)
                      |+|++||++|++++||.++|+++..                   ...++|++||||||+|+.+ +..||||||++|.|+|
T Consensus         1 F~W~~YL~~t~a~aaP~~~F~~~~~-------------------~~~~~f~~GmklEavd~~~-~~~~~vAtV~~v~g~~   60 (103)
T d1oi1a1           1 FHWEEYLKETGSISAPSECFRQSQI-------------------PPVNDFKVGMKLEARDPRN-ATSVCIATVIGITGAR   60 (103)
T ss_dssp             CCHHHHHHHTTCCBCCGGGSSSCSS-------------------CCCCCCCTTCEEEEEETTE-EEEEEEEEEEEEETTE
T ss_pred             CChHHHHHHhCCccCCHHHhcCCCC-------------------CCCcCcccCCEEEeEcCCC-CCeEEEEEEEEeeCCE
Confidence            8999999999999999999998753                   5679999999999999999 9999999999999999


Q ss_pred             EEEEecCCCCCCCCCeEEeCCCCCeeeeeceeccCCcccCCCCCC
Q psy15287        133 LHIHIDSAGSSDRMDYWTDIGSAYIRPVGWCRRNKVKLVPPASGK  177 (186)
Q Consensus       133 l~v~~dg~~~d~~~d~W~d~~S~~I~PvGwc~~~g~~L~pP~~~~  177 (186)
                      |+|+||||  ++++|||++.+|++|||||||+++|++|+||+||+
T Consensus        61 ~~l~~dG~--~~~~dfw~~~~S~~i~PvGWc~~~g~~L~pP~gy~  103 (103)
T d1oi1a1          61 LRLRLDGS--DNRNDFWRLVDSPDIQPVGTCEKEGDLLQPPLGYQ  103 (103)
T ss_dssp             EEEEETTS--CTTCCEEEETTCTTEECTTHHHHTTCCCCCCTTCC
T ss_pred             EEEEECCC--CCcCCEEEECCCCCeecCCHHHHcCCccCCcCCCC
Confidence            99999999  88899999999999999999999999999999995
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjsa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjra_ b.34.9.3 (A:) Scm-like with four MBT domains protein 2, SFMBT2 (KIAA1617) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a3 b.34.9.3 (A:422-527) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a2 b.34.9.3 (A:314-421) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oz2a1 b.34.9.3 (A:204-313) Lethal(3)malignant brain tumor-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oi1a2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjqa_ b.34.9.3 (A:) Lethal(3)malignant brain tumor-like 3 protein, L3MBTL3 (KIAA1798) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure