Psyllid ID: psy15347

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
cEEEEcccccEEEEccccccccccccccHHHHHHHcccccccccccccHHHHHHHcccccccEEEEcccccccHHHHHHcccccEEEEcccccccEEEEEc
cEEEEEccccEEEEEcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHccHHHHHHHHccccHHHEEEEEcc
micalkcpgkylavsafapicnpmqcqwgRDAFKAylgrdelvwkdydatelvkvydgpplelLIDQIGGHKVTSVRAmtvsgksfqvtpiledvWFICQK
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTvsgksfqvtpiledVWFICQK
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
*ICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFIC**
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMTVSGKSFQVTPILEDVWFICQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query101 2.2.26 [Sep-21-2011]
B0BNE5282 S-formylglutathione hydro yes N/A 0.663 0.237 0.656 4e-20
Q08E20282 S-formylglutathione hydro yes N/A 0.663 0.237 0.641 4e-20
Q9GJT2282 S-formylglutathione hydro yes N/A 0.663 0.237 0.656 6e-20
Q9R0P3282 S-formylglutathione hydro yes N/A 0.663 0.237 0.656 6e-20
P10768282 S-formylglutathione hydro yes N/A 0.663 0.237 0.656 6e-20
Q8LAS8284 S-formylglutathione hydro yes N/A 0.623 0.221 0.492 4e-12
A1AXZ2279 S-formylglutathione hydro yes N/A 0.653 0.236 0.477 1e-11
B1LIP0277 S-formylglutathione hydro yes N/A 0.643 0.234 0.426 4e-10
A7ZX03277 S-formylglutathione hydro yes N/A 0.643 0.234 0.426 5e-10
Q1RFI8277 S-formylglutathione hydro yes N/A 0.643 0.234 0.426 6e-10
>sp|B0BNE5|ESTD_RAT S-formylglutathione hydrolase OS=Rattus norvegicus GN=Esd PE=1 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 52/67 (77%)

Query: 1   MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPP 60
           +ICALK PGKY +VSAFAPICNP+ C WG+ AF  YLG D+  WK YDAT LVK Y GP 
Sbjct: 156 LICALKNPGKYRSVSAFAPICNPVLCPWGKKAFNGYLGPDQSKWKAYDATCLVKSYSGPQ 215

Query: 61  LELLIDQ 67
           +++LIDQ
Sbjct: 216 IDILIDQ 222
Serine hydrolase involved in the detoxification of formaldehyde.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 2
>sp|Q08E20|ESTD_BOVIN S-formylglutathione hydrolase OS=Bos taurus GN=ESD PE=2 SV=1 Back     alignment and function description
>sp|Q9GJT2|ESTD_PIG S-formylglutathione hydrolase OS=Sus scrofa GN=ESD PE=2 SV=1 Back     alignment and function description
>sp|Q9R0P3|ESTD_MOUSE S-formylglutathione hydrolase OS=Mus musculus GN=Esd PE=2 SV=1 Back     alignment and function description
>sp|P10768|ESTD_HUMAN S-formylglutathione hydrolase OS=Homo sapiens GN=ESD PE=1 SV=2 Back     alignment and function description
>sp|Q8LAS8|SFGH_ARATH S-formylglutathione hydrolase OS=Arabidopsis thaliana GN=SFGH PE=1 SV=2 Back     alignment and function description
>sp|A1AXZ2|SFGH_PARDP S-formylglutathione hydrolase OS=Paracoccus denitrificans (strain Pd 1222) GN=fghA PE=1 SV=1 Back     alignment and function description
>sp|B1LIP0|SFGH1_ECOSM S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmB PE=3 SV=1 Back     alignment and function description
>sp|A7ZX03|SFGH1_ECOHS S-formylglutathione hydrolase FrmB OS=Escherichia coli O9:H4 (strain HS) GN=frmB PE=3 SV=1 Back     alignment and function description
>sp|Q1RFI8|SFGH1_ECOUT S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain UTI89 / UPEC) GN=frmB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
307190112 1135 S-formylglutathione hydrolase [Camponotu 0.663 0.059 0.652 5e-21
260817264 282 hypothetical protein BRAFLDRAFT_79044 [B 0.663 0.237 0.641 4e-20
405971478 281 S-formylglutathione hydrolase [Crassostr 0.663 0.238 0.656 8e-20
383860247 1136 PREDICTED: coiled-coil domain-containing 0.663 0.058 0.623 1e-19
432118647 469 Spindlin-1 [Myotis davidii] 0.782 0.168 0.594 1e-19
380016978 1135 PREDICTED: LOW QUALITY PROTEIN: coiled-c 0.663 0.059 0.652 1e-19
58332198 282 esterase D [Xenopus (Silurana) tropicali 0.663 0.237 0.671 2e-19
213511138 282 S-formylglutathione hydrolase [Salmo sal 0.663 0.237 0.656 2e-19
391338500 278 PREDICTED: S-formylglutathione hydrolase 0.653 0.237 0.636 3e-19
148223293 282 esterase D [Xenopus laevis] gi|51593227| 0.663 0.237 0.671 3e-19
>gi|307190112|gb|EFN74268.1| S-formylglutathione hydrolase [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 53/69 (76%), Gaps = 2/69 (2%)

Query: 1    MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLG--RDELVWKDYDATELVKVYDG 58
            +ICA K PG+Y  VSAFAPI NP+ C WG+ AFK YLG   D + WK++DATEL KVYDG
Sbjct: 1007 LICAFKNPGQYKTVSAFAPISNPILCPWGKKAFKGYLGGPEDNVAWKEWDATELAKVYDG 1066

Query: 59   PPLELLIDQ 67
            PPL +LIDQ
Sbjct: 1067 PPLSILIDQ 1075

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|260817264|ref|XP_002603507.1| hypothetical protein BRAFLDRAFT_79044 [Branchiostoma floridae] gi|229288826|gb|EEN59518.1| hypothetical protein BRAFLDRAFT_79044 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|405971478|gb|EKC36313.1| S-formylglutathione hydrolase [Crassostrea gigas] Back     alignment and taxonomy information
>gi|383860247|ref|XP_003705602.1| PREDICTED: coiled-coil domain-containing protein 39-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|432118647|gb|ELK38169.1| Spindlin-1 [Myotis davidii] Back     alignment and taxonomy information
>gi|380016978|ref|XP_003692444.1| PREDICTED: LOW QUALITY PROTEIN: coiled-coil domain-containing protein 39-like [Apis florea] Back     alignment and taxonomy information
>gi|58332198|ref|NP_001011247.1| esterase D [Xenopus (Silurana) tropicalis] gi|56556554|gb|AAH87823.1| hypothetical LOC496692 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|213511138|ref|NP_001135000.1| S-formylglutathione hydrolase [Salmo salar] gi|209737896|gb|ACI69817.1| S-formylglutathione hydrolase [Salmo salar] Back     alignment and taxonomy information
>gi|391338500|ref|XP_003743596.1| PREDICTED: S-formylglutathione hydrolase-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|148223293|ref|NP_001087326.1| esterase D [Xenopus laevis] gi|51593227|gb|AAH78560.1| MGC85439 protein [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query101
RGD|1592114282 Esd "esterase D" [Rattus norve 0.663 0.237 0.656 8e-21
ZFIN|ZDB-GENE-050417-328334 esd "esterase D/formylglutathi 0.663 0.200 0.641 8e-21
UNIPROTKB|Q08E20282 ESD "S-formylglutathione hydro 0.663 0.237 0.641 1e-20
UNIPROTKB|H7BZT7230 ESD "S-formylglutathione hydro 0.663 0.291 0.656 1.3e-20
UNIPROTKB|P10768282 ESD "S-formylglutathione hydro 0.663 0.237 0.656 1.3e-20
MGI|MGI:95421282 Esd "esterase D/formylglutathi 0.663 0.237 0.656 1.3e-20
UNIPROTKB|Q9GJT2282 ESD "S-formylglutathione hydro 0.663 0.237 0.656 1.7e-20
UNIPROTKB|E2RCQ9282 ESD "Uncharacterized protein" 0.663 0.237 0.656 2.1e-20
FB|FBgn0038771330 CG4390 [Drosophila melanogaste 0.663 0.203 0.567 1.1e-15
ASPGD|ASPL0000071553288 AN8782 [Emericella nidulans (t 0.613 0.215 0.555 2.7e-14
RGD|1592114 Esd "esterase D" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 245 (91.3 bits), Expect = 8.0e-21, P = 8.0e-21
 Identities = 44/67 (65%), Positives = 52/67 (77%)

Query:     1 MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPP 60
             +ICALK PGKY +VSAFAPICNP+ C WG+ AF  YLG D+  WK YDAT LVK Y GP 
Sbjct:   156 LICALKNPGKYRSVSAFAPICNPVLCPWGKKAFNGYLGPDQSKWKAYDATCLVKSYSGPQ 215

Query:    61 LELLIDQ 67
             +++LIDQ
Sbjct:   216 IDILIDQ 222
GO:0003674 "molecular_function" evidence=ND
GO:0004091 "carboxylesterase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0005634 "nucleus" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0005794 "Golgi apparatus" evidence=IEA;ISO
GO:0008150 "biological_process" evidence=ND
GO:0008152 "metabolic process" evidence=ISO
GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IEA
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=ISO
GO:0018738 "S-formylglutathione hydrolase activity" evidence=IEA
GO:0046294 "formaldehyde catabolic process" evidence=IEA
ZFIN|ZDB-GENE-050417-328 esd "esterase D/formylglutathione hydrolase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08E20 ESD "S-formylglutathione hydrolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZT7 ESD "S-formylglutathione hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P10768 ESD "S-formylglutathione hydrolase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95421 Esd "esterase D/formylglutathione hydrolase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GJT2 ESD "S-formylglutathione hydrolase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCQ9 ESD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0038771 CG4390 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ASPGD|ASPL0000071553 AN8782 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B0BNE5ESTD_RAT3, ., 1, ., 2, ., 1, 20.65670.66330.2375yesN/A
Q08E20ESTD_BOVIN3, ., 1, ., 2, ., 1, 20.64170.66330.2375yesN/A
Q9GJT2ESTD_PIG3, ., 1, ., 2, ., 1, 20.65670.66330.2375yesN/A
Q9R0P3ESTD_MOUSE3, ., 1, ., 2, ., 1, 20.65670.66330.2375yesN/A
P10768ESTD_HUMAN3, ., 1, ., 1, ., 5, 60.65670.66330.2375yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
PLN02442283 PLN02442, PLN02442, S-formylglutathione hydrolase 4e-25
TIGR02821275 TIGR02821, fghA_ester_D, S-formylglutathione hydro 5e-22
COG0627316 COG0627, COG0627, Predicted esterase [General func 3e-10
pfam00756245 pfam00756, Esterase, Putative esterase 5e-07
>gnl|CDD|178061 PLN02442, PLN02442, S-formylglutathione hydrolase Back     alignment and domain information 
 Score = 94.5 bits (235), Expect = 4e-25
 Identities = 35/64 (54%), Positives = 44/64 (68%)

Query: 4   ALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLEL 63
            LK P KY +VSAFAPI NP+ C WG+ AF  YLG D+  W++YDATELV  ++     +
Sbjct: 161 YLKNPDKYKSVSAFAPIANPINCPWGQKAFTNYLGSDKADWEEYDATELVSKFNDVSATI 220

Query: 64  LIDQ 67
           LIDQ
Sbjct: 221 LIDQ 224

Length = 283
>gnl|CDD|131868 TIGR02821, fghA_ester_D, S-formylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|223700 COG0627, COG0627, Predicted esterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|216102 pfam00756, Esterase, Putative esterase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 101
KOG3101|consensus283 100.0
COG0627316 Predicted esterase [General function prediction on 99.71
PLN02442283 S-formylglutathione hydrolase 99.24
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.17
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 98.69
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 96.19
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 96.04
COG4947227 Uncharacterized protein conserved in bacteria [Fun 92.47
PRK10115686 protease 2; Provisional 92.3
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 81.74
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 80.91
>KOG3101|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-36  Score=236.43  Aligned_cols=83  Identities=45%  Similarity=0.829  Sum_probs=77.9

Q ss_pred             CeeeccCCCceeeeccCCCccCCCCCchHHHHHHhhcCCChhhhhhcCHHHHHhhcCCCCCceEEeecCCCCCccccccc
Q psy15347          1 MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPPLELLIDQIGGHKVTSVRAMT   80 (101)
Q Consensus         1 L~iaLknP~~f~SvSAFAPI~nP~~~pWG~kaf~~YLG~d~~~W~~yDa~~Lik~~~~~~~~ILIDqG~~D~Fl~~~qLh   80 (101)
                      |+|+||||++|+|||||||||||++||||||||++|||+|++.|++||+|+||+++.+.+..||||||.+|+||++ ||.
T Consensus       156 l~~~Lkn~~kykSvSAFAPI~NP~~cpWGqKAf~gYLG~~ka~W~~yDat~lik~y~~~~~~ilIdqG~~D~Fl~~-qLl  234 (283)
T KOG3101|consen  156 LTIYLKNPSKYKSVSAFAPICNPINCPWGQKAFTGYLGDNKAQWEAYDATHLIKNYRGVGDDILIDQGAADNFLAE-QLL  234 (283)
T ss_pred             EEEEEcCcccccceeccccccCcccCcchHHHhhcccCCChHHHhhcchHHHHHhcCCCCccEEEecCccchhhhh-hcC
Confidence            6899999999999999999999999999999999999999999999999999999988888999999999999985 444


Q ss_pred             c-----ccc
Q psy15347         81 V-----SGK   84 (101)
Q Consensus        81 ~-----~~~   84 (101)
                      +     +||
T Consensus       235 Pe~l~~a~~  243 (283)
T KOG3101|consen  235 PENLLEACK  243 (283)
T ss_pred             hHHHHHHhh
Confidence            4     666

>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
3fcx_A282 Crystal Structure Of Human Esterase D Length = 282 4e-21
3s8y_A280 Bromide Soaked Structure Of An Esterase From The Oi 9e-13
3i6y_A280 Structure Of An Esterase From The Oil-Degrading Bac 1e-12
3ls2_A280 Crystal Structure Of An S-Formylglutathione Hydrola 5e-11
4b6g_A283 The Crystal Structure Of The Neisserial Esterase D. 9e-10
3e4d_A278 Structural And Kinetic Study Of An S-Formylglutathi 1e-08
4fol_A299 S-Formylglutathione Hydrolase Variant H160i Length 2e-07
1pv1_A299 Crystal Structure Analysis Of Yeast Hypothetical Pr 2e-07
3c6b_A299 Reaction Product Of Paraoxon And S-Formylglutathion 5e-06
>pdb|3FCX|A Chain A, Crystal Structure Of Human Esterase D Length = 282 Back     alignment and structure 
Iteration: 1

 Score = 95.9 bits (237), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 44/67 (65%), Positives = 51/67 (76%)
Query: 1   MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPP 60
           +ICALK PGKY +VSAFAPICNP+ C WG+ AF  YLG D+  WK YDAT LVK Y G  
Sbjct: 156 LICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQ 215
Query: 61  LELLIDQ 67
           L++LIDQ
Sbjct: 216 LDILIDQ 222
>pdb|3S8Y|A Chain A, Bromide Soaked Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica Length = 280 Back     alignment and structure
>pdb|3I6Y|A Chain A, Structure Of An Esterase From The Oil-Degrading Bacterium Oleispira Antarctica Length = 280 Back     alignment and structure
>pdb|3LS2|A Chain A, Crystal Structure Of An S-Formylglutathione Hydrolase From Pseudoalteromonas Haloplanktis Tac125 Length = 280 Back     alignment and structure
>pdb|4B6G|A Chain A, The Crystal Structure Of The Neisserial Esterase D. Length = 283 Back     alignment and structure
>pdb|3E4D|A Chain A, Structural And Kinetic Study Of An S-Formylglutathione Hydrolase From Agrobacterium Tumefaciens Length = 278 Back     alignment and structure
>pdb|4FOL|A Chain A, S-Formylglutathione Hydrolase Variant H160i Length = 299 Back     alignment and structure
>pdb|1PV1|A Chain A, Crystal Structure Analysis Of Yeast Hypothetical Protein: Yjg8_yeast Length = 299 Back     alignment and structure
>pdb|3C6B|A Chain A, Reaction Product Of Paraoxon And S-Formylglutathione Hydrolase W197i Mutant Length = 299 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query101
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 2e-21
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 2e-19
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 2e-19
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 3e-15
3c6b_A299 FGH, S-formylglutathione hydrolase; cysteine sulfe 7e-11
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 3e-09
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 8e-09
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 5e-07
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} Length = 282 Back     alignment and structure
 Score = 84.7 bits (209), Expect = 2e-21
 Identities = 44/67 (65%), Positives = 51/67 (76%)

Query: 1   MICALKCPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDGPP 60
           +ICALK PGKY +VSAFAPICNP+ C WG+ AF  YLG D+  WK YDAT LVK Y G  
Sbjct: 156 LICALKNPGKYKSVSAFAPICNPVLCPWGKKAFSGYLGTDQSKWKAYDATHLVKSYPGSQ 215

Query: 61  LELLIDQ 67
           L++LIDQ
Sbjct: 216 LDILIDQ 222
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Length = 280 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} Length = 280 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} Length = 278 Back     alignment and structure
>3c6b_A FGH, S-formylglutathione hydrolase; cysteine sulfenic acid, serine hydrolase, thioesterase, formaldehyde, organophosphate, cytoplasm; HET: SDP; 2.17A {Saccharomyces cerevisiae} PDB: 1pv1_A Length = 299 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Length = 263 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Length = 280 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Length = 304 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.82
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.22
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.2
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.18
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.17
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.15
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.11
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 98.08
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.98
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.86
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 95.73
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 95.52
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 95.16
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 95.09
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 94.81
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 94.3
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 94.01
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.92
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 93.91
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 93.7
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 92.02
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 91.94
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 91.76
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 91.5
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 90.98
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 90.03
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 89.88
3bjr_A283 Putative carboxylesterase; structural genomics, jo 89.19
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 89.17
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 88.42
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 88.24
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 87.72
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 86.09
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 85.69
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.0
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 82.88
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 82.56
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 82.55
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 82.46
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 82.08
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 81.63
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 81.4
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 81.29
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 81.08
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 81.08
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 81.01
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 80.92
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 80.15
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
Probab=99.82  E-value=1.4e-21  Score=150.73  Aligned_cols=90  Identities=30%  Similarity=0.460  Sum_probs=73.6

Q ss_pred             CeeeccC--CCceeeeccCCCccCCCCCchHHHHHHhhcCCChhhhhhcCHHHHHhhcCC-CCCceEEeecCCCCCccc-
Q psy15347          1 MICALKC--PGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDG-PPLELLIDQIGGHKVTSV-   76 (101)
Q Consensus         1 L~iaLkn--P~~f~SvSAFAPI~nP~~~pWG~kaf~~YLG~d~~~W~~yDa~~Lik~~~~-~~~~ILIDqG~~D~Fl~~-   76 (101)
                      |++||||  |++|.+++||||+++|+.++|++|+|..|+|++.+.|++||+++|+++.+. ...+|+||||++|+|++. 
T Consensus       168 l~~al~~~~~~~~~~~~s~s~~~~p~~~~~~~~~~~~~~g~~~~~~~~~d~~~l~~~~~~~~~~~i~id~G~~D~f~~~~  247 (299)
T 4fol_A          168 ICGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEH  247 (299)
T ss_dssp             HHHHHHTGGGTCCSEEEEESCCCCGGGSHHHHHHHHHHTC-----CGGGCHHHHGGGSCCCTTCCEEEEEETTCTTHHHH
T ss_pred             HHHHHhCCCCCceEEEEecccccCcccccccccccccccccchhhhhhcCHHHHHHhcccCCCCceEEEecCCCcchhhh
Confidence            4578985  789999999999999999999999999999999999999999999998754 346899999999999975 


Q ss_pred             ---ccccccccccccch
Q psy15347         77 ---RAMTVSGKSFQVTP   90 (101)
Q Consensus        77 ---~qLh~~~~~~~~~~   90 (101)
                         ++|+++||..|+..
T Consensus       248 l~~~~f~~a~~~~g~~~  264 (299)
T 4fol_A          248 LKPELLLEAVKATSWQD  264 (299)
T ss_dssp             TCTHHHHHHHTTSTTTT
T ss_pred             cCHHHHHHHHHhcCCCc
Confidence               24566898888653
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 101
d1pv1a_299 c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake 4e-08
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Hypothetical esterase YJL068C
domain: Hypothetical esterase YJL068C
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 46.8 bits (110), Expect = 4e-08
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 1   MICALK--CPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDG 58
           +   LK     +Y + SAFAPI NP    WG+ AFK YLG ++  W+ YD   L+K    
Sbjct: 168 ICGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGEEKAQWEAYDPCLLIKNIRH 227

Query: 59  P-PLELLIDQ 67
                +LI  
Sbjct: 228 VGDDRILIHV 237

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query101
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.51
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 98.51
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 98.49
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 98.36
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 97.85
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 97.65
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 96.53
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 96.15
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 94.09
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 93.23
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 92.41
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 88.86
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 87.61
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 87.44
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 86.95
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 84.97
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Hypothetical esterase YJL068C
domain: Hypothetical esterase YJL068C
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.51  E-value=2.5e-15  Score=114.14  Aligned_cols=89  Identities=30%  Similarity=0.463  Sum_probs=73.9

Q ss_pred             eeecc--CCCceeeeccCCCccCCCCCchHHHHHHhhcCCChhhhhhcCHHHHHhhcCC-CCCceEEeecCCCCCccc--
Q psy15347          2 ICALK--CPGKYLAVSAFAPICNPMQCQWGRDAFKAYLGRDELVWKDYDATELVKVYDG-PPLELLIDQIGGHKVTSV--   76 (101)
Q Consensus         2 ~iaLk--nP~~f~SvSAFAPI~nP~~~pWG~kaf~~YLG~d~~~W~~yDa~~Lik~~~~-~~~~ILIDqG~~D~Fl~~--   76 (101)
                      .+|||  ||++|.+++|+||+++|...+|+.+++.+|+|++.+.|++||+..|+++.+. ...+|+|+||++|+|++.  
T Consensus       169 ~~al~~~~p~~f~~~~s~s~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~l~~~~~~~~~~~i~~~~G~~D~~~~~~~  248 (299)
T d1pv1a_         169 CGYLKGYSGKRYKSCSAFAPIVNPSNVPWGQKAFKGYLGEEKAQWEAYDPCLLIKNIRHVGDDRILIHVGDSDPFLEEHL  248 (299)
T ss_dssp             HHHHHTGGGTCCSEEEEESCCCCSTTSHHHHHHHHHHSCC----CGGGCHHHHGGGSCCCTTCCEEEECCTTCTTTTTTC
T ss_pred             HHHHHhcCCCceEEEeeccCcCCcccccchhhhhhhhcccchhhhhhcCHHHHHHHhhccCCcceeEecCCCCcchhhhh
Confidence            46787  4899999999999999999999999999999999999999999999998754 345799999999999875  


Q ss_pred             --ccccccccccccch
Q psy15347         77 --RAMTVSGKSFQVTP   90 (101)
Q Consensus        77 --~qLh~~~~~~~~~~   90 (101)
                        ++|++++|..|+..
T Consensus       249 ~~~~f~~~~~~~g~~~  264 (299)
T d1pv1a_         249 KPELLLEAVKATSWQD  264 (299)
T ss_dssp             CTHHHHHHHTTSTTTT
T ss_pred             cHHHHHHHHHhcCCCc
Confidence              34777888887653
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure