Psyllid ID: psy15439

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MPNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLAQPCTDSSRPIPV
cccccccccccccccccHHHcccccccccccccccccccccccccEEEccEEccHHHHHHHcccccccccccccccEEccccEEEEcccccEEEEEEEEEEEEEEccccccccccccccccccc
ccccccccccccccHHHEHHHHHcHHHHHHHHHHHHHcccccccEEEccccEEEccHHHHHHcccEEEEEEEEccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccc
mpnmkecgscgrpitdryLLRVADISYHENCVACVEcghslahscftrenklycrsdydsrkkgsqLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSsllaqpctdssrpipv
mpnmkecgscgrpiTDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLycrsdydsrkkgsQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLssllaqpctdssrpipv
MPNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFhtitlplhtitiriqvtiiiiRNLSSLLAQPCTDSSRPIPV
********SCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLA************
**NMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLAQPCTDSSRPIP*
*********CGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLAQ***********
*PNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLAQPCTDSSR****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSRKKGSQLVTVLFYSMYVHSVMKFHTITLPLHTITIRIQVTIIIIRNLSSLLAQPCTDSSRPIPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
P61376 402 LIM/homeobox protein Lhx5 yes N/A 0.467 0.144 0.5 1e-12
P61375 402 LIM/homeobox protein Lhx5 yes N/A 0.467 0.144 0.5 1e-12
Q9H2C1 402 LIM/homeobox protein Lhx5 yes N/A 0.467 0.144 0.5 2e-12
P53411 406 LIM/homeobox protein Lhx1 yes N/A 0.443 0.135 0.509 2e-12
P29674 403 LIM/homeobox protein Lhx1 N/A N/A 0.467 0.143 0.5 2e-12
Q5IS89 406 LIM/homeobox protein Lhx1 N/A N/A 0.443 0.135 0.509 3e-12
P63007 406 LIM/homeobox protein Lhx1 no N/A 0.443 0.135 0.509 3e-12
Q5IS44 406 LIM/homeobox protein Lhx1 no N/A 0.443 0.135 0.509 3e-12
P63006 406 LIM/homeobox protein Lhx1 no N/A 0.443 0.135 0.509 3e-12
P63008 406 LIM/homeobox protein Lhx1 N/A N/A 0.443 0.135 0.509 3e-12
>sp|P61376|LHX5_RAT LIM/homeobox protein Lhx5 OS=Rattus norvegicus GN=Lhx5 PE=2 SV=1 Back     alignment and function desciption
 Score = 71.6 bits (174), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 4  MKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSR 61
          M  C  C RPI DR+LL V D ++H  CV C EC  +L+  CF+RE KLYC++D+  R
Sbjct: 2  MVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRR 59
Plays an essential role in the regulation of neuronal differentiation and migration during development of the central nervous system.
Rattus norvegicus (taxid: 10116)
>sp|P61375|LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus GN=Lhx5 PE=2 SV=1 Back     alignment and function description
>sp|Q9H2C1|LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens GN=LHX5 PE=2 SV=1 Back     alignment and function description
>sp|P53411|LHX1_CHICK LIM/homeobox protein Lhx1 OS=Gallus gallus GN=LHX1 PE=2 SV=1 Back     alignment and function description
>sp|P29674|LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis GN=lhx1 PE=1 SV=1 Back     alignment and function description
>sp|Q5IS89|LHX1_SAIBB LIM/homeobox protein Lhx1 OS=Saimiri boliviensis boliviensis GN=LHX1 PE=2 SV=1 Back     alignment and function description
>sp|P63007|LHX1_RAT LIM/homeobox protein Lhx1 OS=Rattus norvegicus GN=Lhx1 PE=2 SV=1 Back     alignment and function description
>sp|Q5IS44|LHX1_PANTR LIM/homeobox protein Lhx1 OS=Pan troglodytes GN=LHX1 PE=2 SV=1 Back     alignment and function description
>sp|P63006|LHX1_MOUSE LIM/homeobox protein Lhx1 OS=Mus musculus GN=Lhx1 PE=1 SV=1 Back     alignment and function description
>sp|P63008|LHX1_MESAU LIM/homeobox protein Lhx1 OS=Mesocricetus auratus GN=Lhx1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
189234898 368 PREDICTED: similar to lim homeobox prote 0.427 0.144 0.622 1e-13
91077954 472 PREDICTED: similar to CG32105 CG32105-PB 0.427 0.112 0.622 4e-13
270002859 388 LIM homeobox transcription factor 1, bet 0.427 0.136 0.622 4e-13
242007292 396 Insulin gene enhancer protein ISL-2, put 0.475 0.148 0.593 1e-12
307204532 402 LIM homeobox transcription factor 1 beta 0.427 0.131 0.584 1e-12
332025158 400 LIM homeobox transcription factor 1-beta 0.427 0.132 0.584 2e-12
198464778 553 GA18112 [Drosophila pseudoobscura pseudo 0.467 0.104 0.551 2e-12
170032117 453 lim homeobox protein [Culex quinquefasci 0.403 0.110 0.603 2e-12
195160501 458 GL25001 [Drosophila persimilis] gi|19411 0.467 0.126 0.551 3e-12
307189897 402 LIM homeobox transcription factor 1 beta 0.427 0.131 0.584 3e-12
>gi|189234898|ref|XP_967153.2| PREDICTED: similar to lim homeobox protein, partial [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%)

Query: 7  CGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYD 59
          CG C RPI DR+LLR+ D+SYHE+CV C  CG  L H+CF +++KLYCR DYD
Sbjct: 3  CGMCCRPINDRFLLRIMDVSYHEHCVQCCACGDRLHHTCFVKDSKLYCRLDYD 55

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91077954|ref|XP_967240.1| PREDICTED: similar to CG32105 CG32105-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002859|gb|EEZ99306.1| LIM homeobox transcription factor 1, beta [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007292|ref|XP_002424475.1| Insulin gene enhancer protein ISL-2, putative [Pediculus humanus corporis] gi|212507893|gb|EEB11737.1| Insulin gene enhancer protein ISL-2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307204532|gb|EFN83212.1| LIM homeobox transcription factor 1 beta [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332025158|gb|EGI65338.1| LIM homeobox transcription factor 1-beta [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|198464778|ref|XP_001353365.2| GA18112 [Drosophila pseudoobscura pseudoobscura] gi|198149875|gb|EAL30872.2| GA18112 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|170032117|ref|XP_001843929.1| lim homeobox protein [Culex quinquefasciatus] gi|167871878|gb|EDS35261.1| lim homeobox protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195160501|ref|XP_002021114.1| GL25001 [Drosophila persimilis] gi|194118227|gb|EDW40270.1| GL25001 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|307189897|gb|EFN74141.1| LIM homeobox transcription factor 1 beta [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
FB|FBgn0036274 544 CG4328 [Drosophila melanogaste 0.467 0.106 0.5 6e-14
UNIPROTKB|F1NX79 406 LHX1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 1.9e-13
UNIPROTKB|P53411 406 LHX1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 1.9e-13
UNIPROTKB|A7Z015 406 LHX1 "Uncharacterized protein" 0.443 0.135 0.509 2.4e-13
UNIPROTKB|E2RMA8 406 LHX1 "Uncharacterized protein" 0.443 0.135 0.509 2.4e-13
UNIPROTKB|P48742 406 LHX1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 2.4e-13
UNIPROTKB|F2Z531 406 LHX1 "Uncharacterized protein" 0.443 0.135 0.509 2.4e-13
UNIPROTKB|P63008 406 Lhx1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 2.4e-13
UNIPROTKB|Q5IS44 406 LHX1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 2.4e-13
UNIPROTKB|Q5IS89 406 LHX1 "LIM/homeobox protein Lhx 0.443 0.135 0.509 2.4e-13
FB|FBgn0036274 CG4328 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 6.0e-14, P = 6.0e-14
 Identities = 29/58 (50%), Positives = 39/58 (67%)

Query:     2 PNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYD 59
             P + +C  C +PI DRY++RV + S+HE C+ C  C   L HSC+ RE KLYCR DY+
Sbjct:   194 PQLSQCAHCCQPICDRYIMRVVENSFHEGCLKCTACSLHLVHSCYAREGKLYCRVDYE 251
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0006911 "phagocytosis, engulfment" evidence=IMP
UNIPROTKB|F1NX79 LHX1 "LIM/homeobox protein Lhx1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P53411 LHX1 "LIM/homeobox protein Lhx1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7Z015 LHX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMA8 LHX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P48742 LHX1 "LIM/homeobox protein Lhx1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z531 LHX1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P63008 Lhx1 "LIM/homeobox protein Lhx1" [Mesocricetus auratus (taxid:10036)] Back     alignment and assigned GO terms
UNIPROTKB|Q5IS44 LHX1 "LIM/homeobox protein Lhx1" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q5IS89 LHX1 "LIM/homeobox protein Lhx1" [Saimiri boliviensis boliviensis (taxid:39432)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P53411LHX1_CHICKNo assigned EC number0.50900.44350.1354yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
cd0937153 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b 5e-18
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 5e-16
cd0937354 cd09373, LIM1_AWH, The first LIM domain of Arrowhe 1e-14
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 1e-14
cd0937052 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a 3e-14
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 1e-13
cd0936655 cd09366, LIM1_Isl, The first LIM domain of Isl, a 4e-13
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 2e-12
cd0936852 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L 6e-12
pfam0041258 pfam00412, LIM, LIM domain 6e-12
cd0938655 cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( 3e-10
cd0946755 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b 4e-10
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 5e-10
cd0946852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 9e-10
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 2e-09
cd0938156 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L 4e-09
cd0946964 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 5e-09
cd0947054 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 1e-08
cd0938855 cd09388, LIM1_LMO1_LMO3, The first LIM domain of L 1e-08
cd0938054 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 2e-08
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 5e-08
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 2e-07
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 3e-06
cd0935460 cd09354, LIM2_LPP, The second LIM domain of lipoma 1e-05
cd0938456 cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( 2e-05
cd0935360 cd09353, LIM2_Zyxin, The second LIM domain of Zyxi 5e-05
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 9e-05
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 1e-04
cd0935553 cd09355, LIM2_Ajuba_like, The second LIM domain of 2e-04
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 2e-04
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 2e-04
cd0940061 cd09400, LIM_like_1, LIM domain in proteins of unk 3e-04
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 4e-04
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 4e-04
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 6e-04
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 7e-04
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 0.001
cd0984054 cd09840, LIM2_CRP2, The second LIM domain of Cyste 0.001
cd0942159 cd09421, LIM3_LIMPETin, The third LIM domain of pr 0.001
cd0939553 cd09395, LIM2_Rga, The second LIM domain of Rga GT 0.002
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 0.002
cd0935653 cd09356, LIM2_TRIP6, The second LIM domain of Thyr 0.002
cd0940752 cd09407, LIM2_Paxillin, The second LIM domain of p 0.002
cd0934864 cd09348, LIM4_FHL1, The fourth LIM domain of Four 0.003
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 0.003
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 0.003
cd0944355 cd09443, LIM_Ltd-1, The LIM domain of LIM and tran 0.003
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 0.004
>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b Back     alignment and domain information 
 Score = 71.3 bits (175), Expect = 5e-18
 Identities = 28/53 (52%), Positives = 35/53 (66%)

Query: 7  CGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYD 59
          C  C RPI+DRYLLRV + S+HE C+ C  C   L  SC+ R+ KLYC+ DY 
Sbjct: 1  CAGCQRPISDRYLLRVNERSWHEECLQCSVCQQPLTTSCYFRDRKLYCKQDYQ 53

The first LIM domain of Lmx1b: Lmx1b belongs to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. In mouse, Lmx1b functions in the developing limbs and eyes, the kidneys, the brain, and in cranial mesenchyme. The disruption of Lmx1b gene results kidney and limb defects. In the brain, Lmx1b is important for generation of mesencephalic dopamine neurons and the differentiation of serotonergic neurons. In the mouse eye, Lmx1b regulates anterior segment (cornea, iris, ciliary body, trabecular meshwork, and lens) development. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 53
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich Protein 2 (CRP2) Back     alignment and domain information
>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188781 cd09395, LIM2_Rga, The second LIM domain of Rga GTPase-Activating Proteins Back     alignment and domain information
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase domains protein (Ltd-1) Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
KOG1701|consensus468 99.94
KOG4577|consensus 383 99.67
KOG2272|consensus 332 99.56
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.56
KOG2272|consensus332 99.42
KOG1701|consensus468 99.4
KOG1703|consensus479 99.39
KOG1703|consensus479 99.34
KOG1044|consensus 670 99.27
KOG1044|consensus 670 98.93
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.7
KOG4577|consensus 383 98.16
KOG1700|consensus200 97.9
KOG1700|consensus200 97.84
KOG1702|consensus 264 97.5
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 96.79
KOG0490|consensus 235 94.69
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 88.87
>KOG1701|consensus Back     alignment and domain information 
Probab=99.94  E-value=6.1e-29  Score=192.15  Aligned_cols=118  Identities=19%  Similarity=0.372  Sum_probs=103.9

Q ss_pred             CCCCCCCccccCCc-cEEEcCceecCCCeecCccCCCCC-CceeeeCCeecccchhhhhcC-CCCcee-----eecccCe
Q psy15439          5 KECGSCGRPITDRY-LLRVADISYHENCVACVECGHSLA-HSCFTRENKLYCRSDYDSRKK-GSQLVT-----VLFYSMY   76 (124)
Q Consensus         5 ~~C~~C~~~I~~~~-~i~~~~~~~H~~Cf~C~~C~~~L~-~~~~~~~g~~yC~~~y~~~f~-~~~c~~-----~i~~~~~   76 (124)
                      ..|.+|+|.|.++. .++||++.||..||+|..|++.|. ..||..|+++||+.||...+. |..|.+     .|.+.+.
T Consensus       275 ~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tlekC~~Cg~~I~d~iLrA~Gk  354 (468)
T KOG1701|consen  275 GICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTLEKCNKCGEPIMDRILRALGK  354 (468)
T ss_pred             hhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHHHHHhhhhhHHHHHHHHhccc
Confidence            47999999998754 479999999999999999999999 789999999999999987765 677765     4567788


Q ss_pred             eeccCcEEeeeeC--CCCeeEe--EeCcEEEcccCccccCCCCCCCCCCc
Q psy15439         77 VHSVMKFHTITLP--LHTITIR--IQVTIIIIRNLSSLLAQPCTDSSRPI  122 (124)
Q Consensus        77 ~~h~~cf~c~~~~--~~~~~~~--~~~~~~~~~~~~~~~a~~c~~c~~~i  122 (124)
                      .||++||+|+++-  |+++.|+  .+++|||++|||++|||+|+.|++||
T Consensus       355 ayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI  404 (468)
T KOG1701|consen  355 AYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPI  404 (468)
T ss_pred             ccCCCceEEEEeccccCCccccccCCCceeeehhhhhhcCcchhhccCCc
Confidence            9999999999964  7777655  56999999999999999999999999

>KOG4577|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 4e-09
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 5e-08
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 6e-08
2l4z_A123 Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L 9e-06
1m3v_A122 Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And 1e-05
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 2e-05
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 2e-05
1j2o_A114 Structure Of Flin2, A Complex Containing The N-Term 9e-05
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 2e-04
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 36/61 (59%)
Query: 1  MPNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDS 60
          M  + +C  C + I D+++L+V D  +H +C+ C +C   LA  CF+R   +YC+ D+  
Sbjct: 3  MQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADCQMQLADRCFSRAGSVYCKEDFFK 62
Query: 61 R 61
          R
Sbjct: 63 R 63
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 Back     alignment and structure
>pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|1J2O|A Chain A, Structure Of Flin2, A Complex Containing The N-Terminal Lim Domain Of Lmo2 And Ldb1-Lid Length = 114 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 3e-19
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 9e-08
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 5e-19
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 6e-19
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 4e-07
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 7e-19
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 1e-18
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 7e-17
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 2e-07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 3e-16
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-15
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 8e-07
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 5e-14
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-13
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-13
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-07
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 3e-13
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 2e-12
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-11
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-11
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 6e-11
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 8e-11
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 1e-10
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-10
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 6e-10
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 1e-09
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-09
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-09
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 3e-09
2cor_A79 Pinch protein; LIM domain, particularly interestin 4e-09
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-09
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-08
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-08
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 3e-08
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 3e-08
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-07
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 7e-08
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 7e-08
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-07
2co8_A82 NEDD9 interacting protein with calponin homology a 2e-07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 3e-07
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 3e-07
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-06
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 3e-06
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 5e-06
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 6e-06
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
 Score = 77.7 bits (191), Expect = 3e-19
 Identities = 21/60 (35%), Positives = 33/60 (55%)

Query: 2   PNMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLAHSCFTRENKLYCRSDYDSR 61
           P +  C  C + I DR++L+  D  +H  C+ C +C   LA  CF+R   +YC+ D+  R
Sbjct: 58  PEIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKR 117
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.92
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.87
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.87
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.86
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.85
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.83
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.79
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.77
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.73
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.69
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.65
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.65
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.64
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.63
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.63
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.63
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.63
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.63
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.63
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.62
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.61
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.61
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.61
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.61
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.61
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.61
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.6
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.6
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.6
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.59
2co8_A82 NEDD9 interacting protein with calponin homology a 99.57
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.57
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.57
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.56
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.55
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.55
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.54
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.53
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.5
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.49
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.46
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.36
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.35
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.3
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.28
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.27
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.23
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.22
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.21
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.18
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.1
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.09
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.05
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.02
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 98.79
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 98.64
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 98.63
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.63
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 98.61
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 98.5
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 98.39
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 98.37
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 98.35
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 98.32
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 98.32
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 98.31
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 98.26
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 98.26
2cor_A79 Pinch protein; LIM domain, particularly interestin 98.25
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 98.13
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 98.12
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.04
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 98.04
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 98.03
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 98.0
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 97.92
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 97.86
2co8_A82 NEDD9 interacting protein with calponin homology a 97.85
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 97.75
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 97.75
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 97.5
3f6q_B72 LIM and senescent cell antigen-like-containing dom 97.16
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 97.14
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 96.58
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 96.16
2lo3_A44 SAGA-associated factor 73; zinc-finger, deubiquiti 80.6
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
Probab=99.92  E-value=7.5e-26  Score=161.06  Aligned_cols=122  Identities=15%  Similarity=0.241  Sum_probs=103.1

Q ss_pred             CCCCCCCCCccccCCccEEEcCceecCCCeecCccCCCCC-CceeeeCCeecccchhhhhcCCC----------------
Q psy15439          3 NMKECGSCGRPITDRYLLRVADISYHENCVACVECGHSLA-HSCFTRENKLYCRSDYDSRKKGS----------------   65 (124)
Q Consensus         3 ~~~~C~~C~~~I~~~~~i~~~~~~~H~~Cf~C~~C~~~L~-~~~~~~~g~~yC~~~y~~~f~~~----------------   65 (124)
                      +.++|.+|+++|...+.+.++++.||++||+|..|+++|. ..|+.++|++||+.||.++|+++                
T Consensus         6 ~~~~C~~C~~~I~~~~~v~a~g~~wH~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~f~~~c~~c~~~~g~~~~~~~   85 (192)
T 1b8t_A            6 GGKKCGVCQKAVYFAEEVQCEGSSFHKSCFLCMVCKKNLDSTTVAVHGDEIYCKSCYGKKYGPKGKGKGMGAGTLSTDKG   85 (192)
T ss_dssp             CCEECTTTCCEECSSCCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEEEHHHHHHHHSCCCCCCCCCCCCCCCCCC
T ss_pred             CCCcCccCCCeecceeEEEeCCceecCCCCcCcccCCcCCCCeeEecCCEeeChhhhHhhcCccccccccccccEecCCC
Confidence            3468999999998766789999999999999999999999 56889999999999999998643                


Q ss_pred             ----------------------------------Cceeee------cccCeeeccCcEEeeee--CCCCee-EeEeCcEE
Q psy15439         66 ----------------------------------QLVTVL------FYSMYVHSVMKFHTITL--PLHTIT-IRIQVTII  102 (124)
Q Consensus        66 ----------------------------------~c~~~i------~~~~~~~h~~cf~c~~~--~~~~~~-~~~~~~~~  102 (124)
                                                        +|.+.|      .+.+..||..||.|..+  +|.+.. +..++.+|
T Consensus        86 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~C~~C~~~I~~~~~v~a~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~y  165 (192)
T 1b8t_A           86 ESLGIKYEEGQSHRPTNPNASRMAQKVGGSDGCPRCGQAVYAAEKVIGAGKSWHKSCFRCAKCGKSLESTTLADKDGEIY  165 (192)
T ss_dssp             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECTTTSCEECSSSCEEETTEEECTTTCBCTTTCCBCCSSSEEEETTEEE
T ss_pred             cccccccccccccCCCCcCccccccccCCCCcCCCCCCEecCcEEEecCCCccchhcCCccccCCCCCCCcccccCCEEe
Confidence                                              455544      35567899999999885  464433 45668999


Q ss_pred             EcccCccccCCCCCCCCCCccC
Q psy15439        103 IIRNLSSLLAQPCTDSSRPIPV  124 (124)
Q Consensus       103 ~~~~~~~~~a~~c~~c~~~i~~  124 (124)
                      |.+|+.++|+++|.+|+++||+
T Consensus       166 C~~cy~~~f~~kc~~C~~~~g~  187 (192)
T 1b8t_A          166 CKGCYAKNFGPKGFGFGQGAGA  187 (192)
T ss_dssp             EHHHHHHHTCCCCCCCCCCCCC
T ss_pred             CHHHHHHhcCCcCCCCCCcccc
Confidence            9999999999999999999985
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2lo3_A SAGA-associated factor 73; zinc-finger, deubiquitination, transcription factor, SAGA CO transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d1rutx130 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m 9e-10
d1j2oa130 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m 4e-08
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: LIM only 4 (Lmo4)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 48.2 bits (115), Expect = 9e-10
 Identities = 12/30 (40%), Positives = 16/30 (53%)

Query: 3  NMKECGSCGRPITDRYLLRVADISYHENCV 32
          + K C  CG  I DR+LL   D  +H  C+
Sbjct: 1  SWKRCAGCGGKIADRFLLYAMDSYWHSRCL 30
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.83
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.59
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.58
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.5
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.45
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.42
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.37
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.36
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.35
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.27
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.23
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.21
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.14
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.14
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.13
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.07
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.0
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.95
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.95
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.92
d2co8a236 Nedd9 interacting protein with calponin homology, 97.91
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.88
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.87
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.82
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.78
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.77
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.77
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.74
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.72
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.69
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.69
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.66
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.65
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.61
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.58
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.55
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.51
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.48
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.46
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.39
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.36
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.34
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.33
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.19
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.13
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.05
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.98
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.98
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 96.96
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.95
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 96.95
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 96.93
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.85
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 96.82
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 96.7
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.47
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.05
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 95.95
d1g47a235 Pinch (particularly interesting new Cys-His) prote 95.35
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 94.85
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 94.83
d2cora131 Pinch (particularly interesting new Cys-His) prote 93.76
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 93.19
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 92.2
d1g47a135 Pinch (particularly interesting new Cys-His) prote 92.07
d2cora235 Pinch (particularly interesting new Cys-His) prote 91.75
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 90.61
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 89.05
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 88.11
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 86.05
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Pinch (particularly interesting new Cys-His) protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.83  E-value=6.2e-10  Score=56.84  Aligned_cols=33  Identities=18%  Similarity=0.475  Sum_probs=31.0

Q ss_pred             eecCccCCCCC-CceeeeCCeecccchhhhhcCC
Q psy15439         32 VACVECGHSLA-HSCFTRENKLYCRSDYDSRKKG   64 (124)
Q Consensus        32 f~C~~C~~~L~-~~~~~~~g~~yC~~~y~~~f~~   64 (124)
                      |+|..|+++|+ ..+++++|++||+.||+++|++
T Consensus         1 F~C~~C~~~f~~~~F~e~~G~pYCe~~Y~~lFAP   34 (35)
T d1g47a2           1 FVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAP   34 (35)
T ss_dssp             CCCTTTCCCCGGGCSEEETTEEECHHHHHHHCCC
T ss_pred             CCCCCCcCCCCCCCeEEECCEecChHhHHhhcCC
Confidence            78999999999 7899999999999999999985
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure