Psyllid ID: psy15536

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MQARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
cEEEEEEcccHHHHHHccccccHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccEEEEEEcccEEEEEEEEEEcccEEEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEccEEEcccccEEEEEcccccccccccccHHHHHHHHHHHHccccccEEEEEEccccccc
ccHHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHcccEEccccccccccccccccccEEEEEEEEccccEEEEEEEEEccccEEEEEEEEcccHHHHccEHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccEEEEEccEEEEcccccccccEcccccEHHHHHHHHHHHHcccccEEEEEEcHHHHHc
MQARYQMDHLRgtllqgasldHKTAIGLILgtgsnacylekADKVKHweterhgeknnfprkieQGQFLALDLGGTNFRVILMHLKKglvtdeivkhyhipdelrlgsglkLFDFLAACISDFVHeyqvhdrvipmgftfsfpmhqrsldsGILVTWTKsfkssgvekEDVVKMLKDAIHRRQDNHVEIVCVlndttgty
MQARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETerhgeknnfprkieQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSfkssgvekeDVVKMLKDAihrrqdnhveivcvlndttgty
MQARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
*********LRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETE******NFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLN******
*QARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEI***YH**DELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
********HLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
*QARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQARYQMDHLRGTLLQGASLDHKTAIGLILGTGSNACYLEKADKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query200 2.2.26 [Sep-21-2011]
P52789 917 Hexokinase-2 OS=Homo sapi yes N/A 0.7 0.152 0.514 6e-36
O08528 917 Hexokinase-2 OS=Mus muscu yes N/A 0.7 0.152 0.507 2e-35
P27881 917 Hexokinase-2 OS=Rattus no yes N/A 0.7 0.152 0.507 2e-35
Q1W674 917 Hexokinase-2 OS=Sus scrof yes N/A 0.7 0.152 0.507 7e-35
Q9NFT7 486 Hexokinase type 2 OS=Dros no N/A 0.71 0.292 0.471 3e-34
P52790 923 Hexokinase-3 OS=Homo sapi no N/A 0.685 0.148 0.496 1e-33
A2PYL6 917 Hexokinase-2 OS=Equus cab yes N/A 0.7 0.152 0.492 1e-33
A2PYL7 917 Hexokinase-2 OS=Equus zeb N/A N/A 0.7 0.152 0.492 1e-33
A2PYL8 917 Hexokinase-2 OS=Equus gre N/A N/A 0.7 0.152 0.492 1e-33
P19367 917 Hexokinase-1 OS=Homo sapi no N/A 0.7 0.152 0.492 1e-33
>sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (69%), Gaps = 2/142 (1%)

Query: 60  PRKIEQGQFLALDLGGTNFRVILMHLK-KGLVTDEIVKH-YHIPDELRLGSGLKLFDFLA 117
           P   E G+FLALDLGGTNFRV+ + +   GL   E+    Y IP+++  GSG +LFD +A
Sbjct: 72  PDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIA 131

Query: 118 ACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKD 177
            C+++F+ + Q+ D+ +P+GFTFSFP HQ  LD   LV+WTK FKSSGVE  DVV +++ 
Sbjct: 132 ECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRK 191

Query: 178 AIHRRQDNHVEIVCVLNDTTGT 199
           AI RR D  ++IV V+NDT GT
Sbjct: 192 AIQRRGDFDIDIVAVVNDTVGT 213

Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 1
>sp|O08528|HXK2_MOUSE Hexokinase-2 OS=Mus musculus GN=Hk2 PE=1 SV=1 Back     alignment and function description
>sp|P27881|HXK2_RAT Hexokinase-2 OS=Rattus norvegicus GN=Hk2 PE=1 SV=1 Back     alignment and function description
>sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NFT7|HXK2_DROME Hexokinase type 2 OS=Drosophila melanogaster GN=Hex-t2 PE=2 SV=4 Back     alignment and function description
>sp|P52790|HXK3_HUMAN Hexokinase-3 OS=Homo sapiens GN=HK3 PE=1 SV=2 Back     alignment and function description
>sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 Back     alignment and function description
>sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
321462303 461 hypothetical protein DAPPUDRAFT_307951 [ 0.675 0.292 0.602 2e-43
380011126 452 PREDICTED: hexokinase-2-like [Apis flore 0.675 0.298 0.588 8e-40
328779857 447 PREDICTED: hexokinase-2-like [Apis melli 0.675 0.302 0.588 9e-40
126571555 484 kexokinase [Litopenaeus vannamei] 0.705 0.291 0.539 1e-39
383865855 470 PREDICTED: hexokinase-1-like [Megachile 0.81 0.344 0.493 5e-39
346471953 473 hypothetical protein [Amblyomma maculatu 0.705 0.298 0.574 6e-39
340712831 470 PREDICTED: hexokinase-1-like isoform 1 [ 0.675 0.287 0.573 2e-38
350422744 470 PREDICTED: hexokinase-1-like [Bombus imp 0.675 0.287 0.573 2e-38
307174516 443 Hexokinase-2 [Camponotus floridanus] 0.815 0.367 0.479 7e-38
170045020 449 hexokinase [Culex quinquefasciatus] gi|1 0.71 0.316 0.542 9e-38
>gi|321462303|gb|EFX73328.1| hypothetical protein DAPPUDRAFT_307951 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%)

Query: 64  EQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDF 123
           E+G +L+LDLGGTNFRVI + +K G V  E V++Y +P+++RLG G+KLFDFLA CI +F
Sbjct: 71  EEGDYLSLDLGGTNFRVIWLRIKSGAVVSEAVQYYQVPEDVRLGPGVKLFDFLAECIHNF 130

Query: 124 VHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQ 183
           +   Q+  + +P+GFTFSFPM Q+ LD GILV+WTKSF  SGV  ED VKML DAIHRR 
Sbjct: 131 MDGRQLKGQNLPLGFTFSFPMTQQGLDVGILVSWTKSFNCSGVVGEDAVKMLNDAIHRRG 190

Query: 184 DNHVEIVCVLNDTTGT 199
           D  V+++ VLNDTTGT
Sbjct: 191 DTDVDVIAVLNDTTGT 206

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380011126|ref|XP_003689663.1| PREDICTED: hexokinase-2-like [Apis florea] Back     alignment and taxonomy information
>gi|328779857|ref|XP_392350.3| PREDICTED: hexokinase-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|126571555|gb|ABO21409.1| kexokinase [Litopenaeus vannamei] Back     alignment and taxonomy information
>gi|383865855|ref|XP_003708388.1| PREDICTED: hexokinase-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|346471953|gb|AEO35821.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|340712831|ref|XP_003394957.1| PREDICTED: hexokinase-1-like isoform 1 [Bombus terrestris] gi|340712833|ref|XP_003394958.1| PREDICTED: hexokinase-1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350422744|ref|XP_003493269.1| PREDICTED: hexokinase-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307174516|gb|EFN64975.1| Hexokinase-2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170045020|ref|XP_001850122.1| hexokinase [Culex quinquefasciatus] gi|167868074|gb|EDS31457.1| hexokinase [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query200
ZFIN|ZDB-GENE-040426-2017 922 hk2 "hexokinase 2" [Danio reri 0.7 0.151 0.5 4e-39
UNIPROTKB|E9PB90 889 HK2 "Hexokinase-2" [Homo sapie 0.7 0.157 0.514 2e-33
UNIPROTKB|P52789 917 HK2 "Hexokinase-2" [Homo sapie 0.7 0.152 0.514 2.1e-33
UNIPROTKB|E1BME6 914 LOC614107 "Uncharacterized pro 0.7 0.153 0.507 1.9e-32
UNIPROTKB|F1PAZ2 889 HK2 "Uncharacterized protein" 0.7 0.157 0.514 1.1e-32
UNIPROTKB|F1SNW8 855 HK2 "Hexokinase-2" [Sus scrofa 0.7 0.163 0.507 1.7e-32
RGD|2797 917 Hk2 "hexokinase 2" [Rattus nor 0.7 0.152 0.507 4.4e-33
UNIPROTKB|H9KZN4 914 HK2 "Uncharacterized protein" 0.695 0.152 0.524 3.4e-38
UNIPROTKB|H9L0X2 920 HK2 "Uncharacterized protein" 0.695 0.151 0.524 3.5e-38
UNIPROTKB|H9L325 921 HK2 "Uncharacterized protein" 0.695 0.150 0.524 3.5e-38
ZFIN|ZDB-GENE-040426-2017 hk2 "hexokinase 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 4.0e-39, Sum P(2) = 4.0e-39
 Identities = 71/142 (50%), Positives = 97/142 (68%)

Query:    60 PRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIV--KHYHIPDELRLGSGLKLFDFLA 117
             P   E+G FLALDLGGTNFRV+L+ ++ G   +  +  K Y IP ++  G+G +LFD + 
Sbjct:   522 PDGTERGDFLALDLGGTNFRVLLVRVRGGKRRNVEMNNKIYTIPQDITQGTGEELFDHIV 581

Query:   118 ACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKD 177
              CI+DF+    +    +P+GFTFSFP HQ  LD GIL+ WTK FK+SG E EDV  +LKD
Sbjct:   582 HCIADFLEYMGMKGASLPLGFTFSFPCHQDKLDQGILIKWTKGFKASGCEGEDVASLLKD 641

Query:   178 AIHRRQDNHVEIVCVLNDTTGT 199
             AIHR ++  +++V V+NDT GT
Sbjct:   642 AIHRCEEFDLDVVAVVNDTVGT 663
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0004396 "hexokinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=IEA;IBA
GO:0001678 "cellular glucose homeostasis" evidence=IBA
GO:0004340 "glucokinase activity" evidence=IBA
GO:0019158 "mannokinase activity" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
GO:0008865 "fructokinase activity" evidence=IBA
GO:0016740 "transferase activity" evidence=IEA
GO:0016301 "kinase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0016310 "phosphorylation" evidence=IEA
UNIPROTKB|E9PB90 HK2 "Hexokinase-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P52789 HK2 "Hexokinase-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BME6 LOC614107 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAZ2 HK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNW8 HK2 "Hexokinase-2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|2797 Hk2 "hexokinase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZN4 HK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0X2 HK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L325 HK2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P27881HXK2_RAT2, ., 7, ., 1, ., 10.50700.70.1526yesN/A
O08528HXK2_MOUSE2, ., 7, ., 1, ., 10.50700.70.1526yesN/A
P52789HXK2_HUMAN2, ., 7, ., 1, ., 10.51400.70.1526yesN/A
Q1W674HXK2_PIG2, ., 7, ., 1, ., 10.50700.70.1526yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.1LOW CONFIDENCE prediction!
3rd Layer2.7.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
pfam00349205 pfam00349, Hexokinase_1, Hexokinase 3e-59
COG5026 466 COG5026, COG5026, Hexokinase [Carbohydrate transpo 2e-34
PTZ00107 464 PTZ00107, PTZ00107, hexokinase; Provisional 1e-32
PLN02914 490 PLN02914, PLN02914, hexokinase 1e-31
PLN02405 497 PLN02405, PLN02405, hexokinase 1e-26
PLN02362 509 PLN02362, PLN02362, hexokinase 3e-25
PLN02596 490 PLN02596, PLN02596, hexokinase-like 9e-09
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 3e-06
COG5026466 COG5026, COG5026, Hexokinase [Carbohydrate transpo 3e-05
PLN02362509 PLN02362, PLN02362, hexokinase 1e-04
pfam03727238 pfam03727, Hexokinase_2, Hexokinase 1e-04
PTZ00107464 PTZ00107, PTZ00107, hexokinase; Provisional 4e-04
PLN02914490 PLN02914, PLN02914, hexokinase 0.002
COG1940 314 COG1940, NagC, Transcriptional regulator/sugar kin 0.002
PLN02405497 PLN02405, PLN02405, hexokinase 0.003
>gnl|CDD|201171 pfam00349, Hexokinase_1, Hexokinase Back     alignment and domain information 
 Score =  184 bits (468), Expect = 3e-59
 Identities = 70/145 (48%), Positives = 94/145 (64%), Gaps = 2/145 (1%)

Query: 58  NFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLA 117
           + P   E+G FLALDLGGTNFRV+L+ L      +     Y +P+EL  G+G +LFDF+A
Sbjct: 54  STPTGTEKGDFLALDLGGTNFRVLLVKLTGNGKVEMTQSKYRLPEELMTGTGEQLFDFIA 113

Query: 118 ACISDFVHEYQVH--DRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKML 175
            C+ DF+ E         +P+GFTFSFP  Q S++ GIL+ WTK FK SGVE  DVV +L
Sbjct: 114 DCLKDFMDEQFPLGKKEPLPLGFTFSFPCSQTSINEGILIRWTKGFKISGVEGHDVVPLL 173

Query: 176 KDAIHRRQDNHVEIVCVLNDTTGTY 200
           ++AI RR    +++V V+NDT GT 
Sbjct: 174 QEAIKRRGIPDIDVVAVVNDTVGTL 198

Hexokinase (EC:2.7.1.1) contains two structurally similar domains represented by this family and pfam03727. Some members of the family have two copies of each of these domains. Length = 205
>gnl|CDD|227359 COG5026, COG5026, Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|240270 PTZ00107, PTZ00107, hexokinase; Provisional Back     alignment and domain information
>gnl|CDD|178502 PLN02914, PLN02914, hexokinase Back     alignment and domain information
>gnl|CDD|215226 PLN02405, PLN02405, hexokinase Back     alignment and domain information
>gnl|CDD|215206 PLN02362, PLN02362, hexokinase Back     alignment and domain information
>gnl|CDD|178206 PLN02596, PLN02596, hexokinase-like Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information
>gnl|CDD|227359 COG5026, COG5026, Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215206 PLN02362, PLN02362, hexokinase Back     alignment and domain information
>gnl|CDD|202746 pfam03727, Hexokinase_2, Hexokinase Back     alignment and domain information
>gnl|CDD|240270 PTZ00107, PTZ00107, hexokinase; Provisional Back     alignment and domain information
>gnl|CDD|178502 PLN02914, PLN02914, hexokinase Back     alignment and domain information
>gnl|CDD|224851 COG1940, NagC, Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215226 PLN02405, PLN02405, hexokinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 200
PF00349206 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo 100.0
PLN02405 497 hexokinase 100.0
PLN02914 490 hexokinase 100.0
PLN02362 509 hexokinase 100.0
PLN02596 490 hexokinase-like 100.0
PTZ00107 464 hexokinase; Provisional 100.0
KOG1369|consensus 474 100.0
COG5026 466 Hexokinase [Carbohydrate transport and metabolism] 100.0
PLN02405497 hexokinase 99.69
PLN02914490 hexokinase 99.69
PLN02362509 hexokinase 99.68
PLN02596490 hexokinase-like 99.68
KOG1369|consensus474 99.66
PTZ00107464 hexokinase; Provisional 99.53
COG5026466 Hexokinase [Carbohydrate transport and metabolism] 99.49
PF03727243 Hexokinase_2: Hexokinase; InterPro: IPR022673 Hexo 98.9
PRK09698 302 D-allose kinase; Provisional 97.94
PF00480179 ROK: ROK family; InterPro: IPR000600 A family of b 97.79
COG1940 314 NagC Transcriptional regulator/sugar kinase [Trans 97.67
smart0073299 YqgFc Likely ribonuclease with RNase H fold. YqgF 97.61
PRK13311 256 N-acetyl-D-glucosamine kinase; Provisional 97.48
PRK12408 336 glucokinase; Provisional 97.24
PRK13310 303 N-acetyl-D-glucosamine kinase; Provisional 97.21
PRK05082 291 N-acetylmannosamine kinase; Provisional 97.18
TIGR00744 318 ROK_glcA_fam ROK family protein (putative glucokin 97.17
PRK09557 301 fructokinase; Reviewed 97.16
PRK14101 638 bifunctional glucokinase/RpiR family transcription 96.81
PRK00292 316 glk glucokinase; Provisional 96.62
PF00370 245 FGGY_N: FGGY family of carbohydrate kinases, N-ter 96.44
TIGR00749 316 glk glucokinase, proteobacterial type. This model 96.43
PTZ00288 405 glucokinase 1; Provisional 96.08
TIGR01314 505 gntK_FGGY gluconate kinase, FGGY type. Gluconate i 95.34
PF02685 316 Glucokinase: Glucokinase; InterPro: IPR003836 Gluc 95.24
PRK10939 520 autoinducer-2 (AI-2) kinase; Provisional 94.26
TIGR01311 493 glycerol_kin glycerol kinase. This model describes 94.08
PRK00047 498 glpK glycerol kinase; Provisional 93.73
TIGR01234 536 L-ribulokinase L-ribulokinase. This enzyme catalyz 93.68
TIGR01315 541 5C_CHO_kinase FGGY-family pentulose kinase. This m 93.68
PLN02295 512 glycerol kinase 93.67
PRK15027 484 xylulokinase; Provisional 93.45
PTZ00294 504 glycerol kinase-like protein; Provisional 93.25
COG1070 502 XylB Sugar (pentulose and hexulose) kinases [Carbo 92.9
PRK10331 470 L-fuculokinase; Provisional 92.78
PRK13318 258 pantothenate kinase; Reviewed 92.5
TIGR01312 481 XylB D-xylulose kinase. D-xylulose kinase (XylB) g 92.45
PRK13321 256 pantothenate kinase; Reviewed 92.02
TIGR01174 371 ftsA cell division protein FtsA. This bacterial ce 91.64
TIGR02628 465 fuculo_kin_coli L-fuculokinase. Members of this fa 91.58
PRK04123 548 ribulokinase; Provisional 91.34
TIGR01175 348 pilM type IV pilus assembly protein PilM. This pro 90.87
TIGR02627 454 rhamnulo_kin rhamnulokinase. This model describes 88.53
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 87.92
COG0837 320 Glk Glucokinase [Carbohydrate transport and metabo 85.53
PRK15080 267 ethanolamine utilization protein EutJ; Provisional 82.8
>PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information 
Probab=100.00  E-value=2.3e-54  Score=359.49  Aligned_cols=153  Identities=47%  Similarity=0.803  Sum_probs=135.0

Q ss_pred             cccccccccCCcccccccCccccceEEEecCCceeEEEEEEEcCCceEEEEEEEeecCcccccccchhHHHHHHHHHHHH
Q psy15536         44 KVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIVKHYHIPDELRLGSGLKLFDFLAACISDF  123 (200)
Q Consensus        44 ~i~k~~~~~~~~v~~~P~g~E~G~f~alDlGGTnlRv~~v~l~g~~~~~~~~~~~~ip~~~~~~~~~~lFd~ia~~i~~f  123 (200)
                      +++|+|+    |+..+|+|.|+|.|||||+|||||||++|+|.|++.+++.+++|+||++++.+++++||||||+||++|
T Consensus        45 ~l~MlPs----~v~~~P~G~E~G~~LalDlGGTnlRv~~V~L~g~~~~~~~~~~~~ip~~~~~~~~~~lFd~ia~~i~~f  120 (206)
T PF00349_consen   45 SLKMLPS----YVTSLPTGNEKGDFLALDLGGTNLRVALVELSGNGKVEIEQEKYKIPEELMNGSGEELFDFIADCIAEF  120 (206)
T ss_dssp             SS-EEEE----SEESSTTSTTEEEEEEEEESSSSEEEEEEEEESSSEEEEEEEEEE--HHHHTSBHHHHHHHHHHHHHHH
T ss_pred             eeecccc----ccccCCCCCCCceEEEEeecCcEEEEEEEEEcCCCCceeeeccccCChHHhcCCcccHHHHHHHHHHHH
Confidence            3889988    678899999999999999999999999999999988899999999999999999999999999999999


Q ss_pred             HhhccC--CCcceeeeEEeecccccccCCceEEEeeccceecCCCCCccHHHHHHHHHHHcCCCCceEEEEEccCceeC
Q psy15536        124 VHEYQV--HDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTGTY  200 (200)
Q Consensus       124 ~~~~~~--~~~~l~lGftFSFP~~q~~~~~~~li~wtKgf~~~~~~g~dv~~~L~~al~r~~~~~v~v~aivNDTVatL  200 (200)
                      +++++.  .++++||||||||||+|+++++|+|++|||||.+++++|+|++++|++||+|++..+++|+||+|||||||
T Consensus       121 ~~~~~~~~~~~~l~lGfTFSFP~~q~~~~~g~li~wtKgf~~~~~~G~dv~~lL~~al~r~~~~~v~v~aivNDTVgTL  199 (206)
T PF00349_consen  121 LKEHNLESRDEKLPLGFTFSFPVEQTSLNSGTLIRWTKGFDISGVVGKDVVELLQDALKRRGLPNVKVVAIVNDTVGTL  199 (206)
T ss_dssp             HHHTTTTSTTSEEEEEEEEESSEEESSTTEEEE----TT---BTGTTSBHHHHHHHHHHHHTSSEEEEEEEE-HHHHHH
T ss_pred             HHHhcccccccccceEEEEEEEEEeccCCCeEEEEeeccccccCCCCCccchhHHHHHHHhcccCcceEEEEECCHHHh
Confidence            999876  57899999999999999999999999999999999999999999999999999955599999999999996

The enzyme can catalyse this reaction on glucose, fructose, sorbitol and glucosamine, and as such is the first step in a number of metabolic pathways []. The addition of a phosphate group to the sugar acts to trap it in a cell, since the negatively charged phosphate cannot easily traverse the plasma membrane. The enzyme is widely distributed in eukaryotes. There are three isozymes of hexokinase in yeast (PI, PII and glucokinase): isozymes PI and PII phosphorylate both aldo- and keto-sugars; glucokinase is specific for aldo-hexoses. All three isozymes contain two domains []. Structural studies of yeast hexokinase reveal a well-defined catalytic pocket that binds ATP and hexose, allowing easy transfer of the phosphate from ATP to the sugar []. Vertebrates contain four hexokinase isozymes, designated I to IV, where types I to III contain a duplication of the two-domain yeast-type hexokinases. Both the N- and C-terminal halves bind hexose and H6P, though in types I an III only the C-terminal half supports catalysis, while both halves support catalysis in type II. The N-terminal half is the regulatory region. Type IV hexokinase is similar to the yeast enzyme in containing only the two domains, and is sometimes incorrectly referred to as glucokinase. The different vertebrate isozymes differ in their catalysis, localisation and regulation, thereby contributing to the different patterns of glucose metabolism in different tissues []. Whereas types I to III can phosphorylate a variety of hexose sugars and are inhibited by glucose-6-phosphate (G6P), type IV is specific for glucose and shows no G6P inhibition. Type I enzyme may have a catabolic function, producing H6P for energy production in glycolysis; it is bound to the mitochondrial membrane, which enables the coordination of glycolysis with the TCA cycle. Types II and III enzyme may have anabolic functions, providing H6P for glycogen or lipid synthesis. Type IV enzyme is found in the liver and pancreatic beta-cells, where it is controlled by insulin (activation) and glucagon (inhibition). In pancreatic beta-cells, type IV enzyme acts as a glucose sensor to modify insulin secretion. Mutations in type IV hexokinase have been associated with diabetes mellitus. Hexokinase (2.7.1.1 from EC), a fructose and glucose phosphorylating enzyme, contains two structurally similar domains represented by this family and PF03727 from PFAM. Some hexokinases have two copies of each of these domains. This entry represents the N-terminal domain.; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0005975 carbohydrate metabolic process; PDB: 3O1W_A 3O6W_A 3O4W_B 3O08_B 3O80_A 3O5B_A 3O8M_A 3O1B_A 1BG3_A 4DHY_A ....
>PLN02405 hexokinase Back     alignment and domain information
>PLN02914 hexokinase Back     alignment and domain information
>PLN02362 hexokinase Back     alignment and domain information
>PLN02596 hexokinase-like Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>KOG1369|consensus Back     alignment and domain information
>COG5026 Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02405 hexokinase Back     alignment and domain information
>PLN02914 hexokinase Back     alignment and domain information
>PLN02362 hexokinase Back     alignment and domain information
>PLN02596 hexokinase-like Back     alignment and domain information
>KOG1369|consensus Back     alignment and domain information
>PTZ00107 hexokinase; Provisional Back     alignment and domain information
>COG5026 Hexokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03727 Hexokinase_2: Hexokinase; InterPro: IPR022673 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) Back     alignment and domain information
>PRK09698 D-allose kinase; Provisional Back     alignment and domain information
>PF00480 ROK: ROK family; InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames [] Back     alignment and domain information
>COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00732 YqgFc Likely ribonuclease with RNase H fold Back     alignment and domain information
>PRK13311 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK12408 glucokinase; Provisional Back     alignment and domain information
>PRK13310 N-acetyl-D-glucosamine kinase; Provisional Back     alignment and domain information
>PRK05082 N-acetylmannosamine kinase; Provisional Back     alignment and domain information
>TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) Back     alignment and domain information
>PRK09557 fructokinase; Reviewed Back     alignment and domain information
>PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK00292 glk glucokinase; Provisional Back     alignment and domain information
>PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related Back     alignment and domain information
>TIGR00749 glk glucokinase, proteobacterial type Back     alignment and domain information
>PTZ00288 glucokinase 1; Provisional Back     alignment and domain information
>TIGR01314 gntK_FGGY gluconate kinase, FGGY type Back     alignment and domain information
>PF02685 Glucokinase: Glucokinase; InterPro: IPR003836 Glucokinases 2 Back     alignment and domain information
>PRK10939 autoinducer-2 (AI-2) kinase; Provisional Back     alignment and domain information
>TIGR01311 glycerol_kin glycerol kinase Back     alignment and domain information
>PRK00047 glpK glycerol kinase; Provisional Back     alignment and domain information
>TIGR01234 L-ribulokinase L-ribulokinase Back     alignment and domain information
>TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase Back     alignment and domain information
>PLN02295 glycerol kinase Back     alignment and domain information
>PRK15027 xylulokinase; Provisional Back     alignment and domain information
>PTZ00294 glycerol kinase-like protein; Provisional Back     alignment and domain information
>COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10331 L-fuculokinase; Provisional Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR01312 XylB D-xylulose kinase Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>TIGR02628 fuculo_kin_coli L-fuculokinase Back     alignment and domain information
>PRK04123 ribulokinase; Provisional Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>TIGR02627 rhamnulo_kin rhamnulokinase Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>COG0837 Glk Glucokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
2nzt_A 902 Crystal Structure Of Human Hexokinase Ii Length = 9 5e-37
3hm8_A 445 Crystal Structure Of The C-Terminal Hexokinase Doma 4e-35
1hkc_A 917 Recombinant Human Hexokinase Type I Complexed With 1e-34
1hkb_A 917 Crystal Structure Of Recombinant Human Brain Hexoki 1e-34
1cza_N 917 Mutant Monomer Of Recombinant Human Hexokinase Type 1e-34
1bg3_A 918 Rat Brain Hexokinase Type I Complex With Glucose An 1e-34
1dgk_N 917 Mutant Monomer Of Recombinant Human Hexokinase Type 4e-34
4dch_A 473 Insights Into Glucokinase Activation Mechanism: Obs 2e-33
3qic_A 470 The Structure Of Human Glucokinase E339k Mutation L 2e-33
3imx_A 455 Crystal Structure Of Human Glucokinase In Complex W 2e-33
3f9m_A 470 Human Pancreatic Glucokinase In Complex With Glucos 2e-33
3s41_A 469 Glucokinase In Complex With Activator And Glucose L 2e-33
3fr0_A 455 Human Glucokinase In Complex With 2-Amino Benzamide 2e-33
1v4t_A 451 Crystal Structure Of Human Glucokinase Length = 451 2e-33
1v4s_A 455 Crystal Structure Of Human Glucokinase Length = 455 2e-33
3o08_A 485 Crystal Structure Of Dimeric Klhxk1 In Crystal Form 3e-29
1ig8_A 486 Crystal Structure Of Yeast Hexokinase Pii With The 3e-26
1bdg_A 451 Hexokinase From Schistosoma Mansoni Complexed With 1e-25
3b8a_X 485 Crystal Structure Of Yeast Hexokinase Pi In Complex 4e-24
>pdb|2NZT|A Chain A, Crystal Structure Of Human Hexokinase Ii Length = 902 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (379), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (69%), Gaps = 2/142 (1%)
Query: 60  PRKIEQGQFLALDLGGTNFRVILMHLK-KGLVTDEIVKH-YHIPDELRLGSGLKLFDFLA 117
           P   E G+FLALDLGGTNFRV+ + +   GL   E+    Y IP+++  GSG +LFD +A
Sbjct: 58  PDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIA 117
Query: 118 ACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKD 177
            C+++F+ + Q+ D+ +P+GFTFSFP HQ  LD   LV+WTK FKSSGVE  DVV +++ 
Sbjct: 118 ECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRK 177
Query: 178 AIHRRQDNHVEIVCVLNDTTGT 199
           AI RR D  ++IV V+NDT GT
Sbjct: 178 AIQRRGDFDIDIVAVVNDTVGT 199
>pdb|3HM8|A Chain A, Crystal Structure Of The C-Terminal Hexokinase Domain Of Human Hk3 Length = 445 Back     alignment and structure
>pdb|1HKC|A Chain A, Recombinant Human Hexokinase Type I Complexed With Glucose And Phosphate Length = 917 Back     alignment and structure
>pdb|1HKB|A Chain A, Crystal Structure Of Recombinant Human Brain Hexokinase Type I Complexed With Glucose And Glucose-6-Phosphate Length = 917 Back     alignment and structure
>pdb|1CZA|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I Complexed With Glucose, Glucose-6-Phosphate, And Adp Length = 917 Back     alignment and structure
>pdb|1BG3|A Chain A, Rat Brain Hexokinase Type I Complex With Glucose And Inhibitor Glucose-6-Phosphate Length = 918 Back     alignment and structure
>pdb|1DGK|N Chain N, Mutant Monomer Of Recombinant Human Hexokinase Type I With Glucose And Adp In The Active Site Length = 917 Back     alignment and structure
>pdb|4DCH|A Chain A, Insights Into Glucokinase Activation Mechanism: Observation Of Multiple Distinct Protein Conformations Length = 473 Back     alignment and structure
>pdb|3QIC|A Chain A, The Structure Of Human Glucokinase E339k Mutation Length = 470 Back     alignment and structure
>pdb|3IMX|A Chain A, Crystal Structure Of Human Glucokinase In Complex With A Synthetic Activator Length = 455 Back     alignment and structure
>pdb|3F9M|A Chain A, Human Pancreatic Glucokinase In Complex With Glucose And Activator Showing A Mobile Flap Length = 470 Back     alignment and structure
>pdb|3S41|A Chain A, Glucokinase In Complex With Activator And Glucose Length = 469 Back     alignment and structure
>pdb|3FR0|A Chain A, Human Glucokinase In Complex With 2-Amino Benzamide Activator Length = 455 Back     alignment and structure
>pdb|1V4T|A Chain A, Crystal Structure Of Human Glucokinase Length = 451 Back     alignment and structure
>pdb|1V4S|A Chain A, Crystal Structure Of Human Glucokinase Length = 455 Back     alignment and structure
>pdb|3O08|A Chain A, Crystal Structure Of Dimeric Klhxk1 In Crystal Form I Length = 485 Back     alignment and structure
>pdb|1IG8|A Chain A, Crystal Structure Of Yeast Hexokinase Pii With The Correct Amino Acid Sequence Length = 486 Back     alignment and structure
>pdb|1BDG|A Chain A, Hexokinase From Schistosoma Mansoni Complexed With Glucose Length = 451 Back     alignment and structure
>pdb|3B8A|X Chain X, Crystal Structure Of Yeast Hexokinase Pi In Complex With Glucose Length = 485 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query200
3f9m_A 470 Glucokinase; hexokinase IV, ATP-binding, diabetes 2e-45
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 2e-08
3hm8_A 445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 1e-43
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 6e-08
1cza_N 917 Hexokinase type I; structurally homologous domains 6e-43
1cza_N 917 Hexokinase type I; structurally homologous domains 2e-42
1cza_N917 Hexokinase type I; structurally homologous domains 3e-08
1cza_N 917 Hexokinase type I; structurally homologous domains 6e-08
1bdg_A 451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 1e-42
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 8e-09
3o8m_A 485 Hexokinase; rnaseh-like fold, glycolysis, glucose 2e-40
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 1e-08
2yhx_A 457 Hexokinase B; transferase(phosphoryl,alcohol accep 9e-35
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 2e-08
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Length = 470 Back     alignment and structure
 Score =  155 bits (393), Expect = 2e-45
 Identities = 65/148 (43%), Positives = 97/148 (65%), Gaps = 4/148 (2%)

Query: 57  NNFPRKIEQGQFLALDLGGTNFRVILMHLKKGLVTDEIV----KHYHIPDELRLGSGLKL 112
            + P   E G FL+LDLGGTNFRV+L+ + +G      V    + Y IP++   G+   L
Sbjct: 68  RSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEML 127

Query: 113 FDFLAACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVV 172
           FD+++ CISDF+ ++Q+  + +P+GFTFSFP+    +D GIL+ WTK FK+SG E  +VV
Sbjct: 128 FDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVV 187

Query: 173 KMLKDAIHRRQDNHVEIVCVLNDTTGTY 200
            +L+DAI RR D  +++V ++NDT  T 
Sbjct: 188 GLLRDAIKRRGDFEMDVVAMVNDTVATM 215
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Length = 470 Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Length = 445 Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Length = 445 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Length = 917 Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Length = 451 Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Length = 451 Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Length = 485 Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Length = 485 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Length = 457 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
3f9m_A 470 Glucokinase; hexokinase IV, ATP-binding, diabetes 100.0
3hm8_A 445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 100.0
3o8m_A 485 Hexokinase; rnaseh-like fold, glycolysis, glucose 100.0
1bdg_A 451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 100.0
1cza_N 917 Hexokinase type I; structurally homologous domains 100.0
2yhx_A 457 Hexokinase B; transferase(phosphoryl,alcohol accep 100.0
1cza_N 917 Hexokinase type I; structurally homologous domains 100.0
3f9m_A470 Glucokinase; hexokinase IV, ATP-binding, diabetes 99.69
3hm8_A445 Hexokinase-3; glucose, glucose-6-phosphate, non-pr 99.59
3o8m_A485 Hexokinase; rnaseh-like fold, glycolysis, glucose 99.49
1bdg_A451 Hexokinase; phosphotransferase; HET: GLC; 2.60A {S 99.32
2yhx_A457 Hexokinase B; transferase(phosphoryl,alcohol accep 99.1
2qm1_A 326 Glucokinase; alpha-beta structure, putative helix- 98.24
1z6r_A 406 MLC protein; transcriptional repressor, ROK family 98.17
1z05_A 429 Transcriptional regulator, ROK family; structural 98.09
2hoe_A 380 N-acetylglucosamine kinase; TM1224, structural gen 97.96
1woq_A 267 Inorganic polyphosphate/ATP-glucomannokinase; tran 97.86
4db3_A 327 Glcnac kinase, N-acetyl-D-glucosamine kinase; stru 97.75
2ap1_A 327 Putative regulator protein; zinc binding protein, 97.75
3mcp_A 366 Glucokinase; structural genomics, joint center for 97.58
2yhw_A 343 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N 97.56
2ch5_A 347 NAGK protein; transferase, N-acetylglucosamine, gl 97.52
3r8e_A 321 Hypothetical sugar kinase; ribonuclease H-like mot 97.5
3vov_A 302 Glucokinase, hexokinase; ROK, sugar kinase, transf 97.39
4htl_A 297 Beta-glucoside kinase; structural genomics, sugar 97.38
3htv_A 310 D-allose kinase, allokinase; NP_418508.1, structur 97.33
3vgl_A 321 Glucokinase; ROK family, transferase; HET: BGC ANP 97.27
2aa4_A 289 Mannac kinase, putative N-acetylmannosamine kinase 97.25
3epq_A 302 Putative fructokinase; SCRK, ADP binding, PSI2, MC 97.15
1zc6_A 305 Probable N-acetylglucosamine kinase; NESG, Q7NU07_ 96.87
1zbs_A 291 Hypothetical protein PG1100; alpha-beta protein., 96.61
2gup_A 292 ROK family protein; sugar kinase, streptococcus pn 96.61
1zxo_A 291 Conserved hypothetical protein Q8A1P1; NESG, BTR25 96.33
2q2r_A 373 Glucokinase 1, putative; ATPase hexose kinase fami 96.21
2e2o_A 299 Hexokinase; acetate and sugar kinases, HSP70, acti 95.88
2p3r_A 510 Glycerol kinase; glycerol metabolism, allosteric r 95.77
3ll3_A 504 Gluconate kinase; xylulose kinase, nysgx, ATP, ADP 95.62
4e1j_A 520 Glycerol kinase; structural genomics, PSI-biology, 95.59
2itm_A 484 Xylulose kinase, xylulokinase; ATPase, FGGY kinase 95.55
3h3n_X 506 Glycerol kinase; ATP-binding, glycerol metabolism, 95.53
3g25_A 501 Glycerol kinase; IDP00743, ATP-binding, glycerol m 95.49
2w40_A 503 Glycerol kinase, putative; closed conformation, ma 95.39
3ifr_A 508 Carbohydrate kinase, FGGY; xylulose kinase, SGX, s 95.37
2dpn_A 495 Glycerol kinase; thermus thermophilus HB8, structu 95.37
1sz2_A 332 Glucokinase, glucose kinase; ATP-dependent, glucos 95.36
2zf5_O 497 Glycerol kinase; hyperthermophilic archaeon, ATP-b 95.28
3l0q_A 554 Xylulose kinase; xlylulose kinase, SGX, PSI, struc 95.03
1saz_A 381 Probable butyrate kinase 2; askha (acetate and sug 95.01
2d4w_A 504 Glycerol kinase; alpha and beta protein, ribonucle 94.99
3hz6_A 511 Xylulokinase; xylulose, structural genomic, chromo 94.74
3jvp_A 572 Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su 94.67
3ezw_A 526 Glycerol kinase; glycerol metabolism, allosteric r 94.6
3lm2_A226 Putative kinase; structural genomics, joint center 93.51
2uyt_A 489 Rhamnulokinase; rhamnose degradation, IN-LINE phos 93.49
3h6e_A 482 Carbohydrate kinase, FGGY; novosphingobium aromati 93.31
3i8b_A 515 Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 90.8
3djc_A 266 Type III pantothenate kinase; structural genomics, 88.83
3bex_A 249 Type III pantothenate kinase; actin-like fold, ATP 84.19
2h3g_X 268 Biosynthetic protein; pantothenate kinase, anthrax 82.52
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
Probab=100.00  E-value=2.8e-54  Score=394.34  Aligned_cols=154  Identities=44%  Similarity=0.790  Sum_probs=145.7

Q ss_pred             ccccccccccCCcccccccCccccceEEEecCCceeEEEEEEEcCCc----eEEEEEEEeecCcccccccchhHHHHHHH
Q psy15536         43 DKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGL----VTDEIVKHYHIPDELRLGSGLKLFDFLAA  118 (200)
Q Consensus        43 ~~i~k~~~~~~~~v~~~P~g~E~G~f~alDlGGTnlRv~~v~l~g~~----~~~~~~~~~~ip~~~~~~~~~~lFd~ia~  118 (200)
                      ++++|+|+    |+..+|+|+|+|.|||||+|||||||++|+|.|++    .+++.+++|+||+++|.+++++||||||+
T Consensus        58 s~~~MlPT----yV~~lP~G~E~G~fLAlDlGGTNfRV~~V~L~g~~~~~~~~~~~~~~~~Ip~~l~~gt~~eLFd~IA~  133 (470)
T 3f9m_A           58 ASVKMLPT----YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISE  133 (470)
T ss_dssp             CSSCCEEE----EEESSCCCCCCEEEEEEEESSSEEEEEEEEEEC----CEEEEEEEEEEECCHHHHSSBHHHHHHHHHH
T ss_pred             CCcccccC----ccccCCCCCcceEEEEEEecCceEEEEEEEECCCCCCcceEEEEEEeecCChHhccCCHHHHHHHHHH
Confidence            45889998    67889999999999999999999999999999876    68889999999999999999999999999


Q ss_pred             HHHHHHhhccCCCcceeeeEEeecccccccCCceEEEeeccceecCCCCCccHHHHHHHHHHHcCCCCceEEEEEccCce
Q psy15536        119 CISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTG  198 (200)
Q Consensus       119 ~i~~f~~~~~~~~~~l~lGftFSFP~~q~~~~~~~li~wtKgf~~~~~~g~dv~~~L~~al~r~~~~~v~v~aivNDTVa  198 (200)
                      ||++|+++++...+++||||||||||+|+++++|+|++|||||++++++|+||+++|++|++|++.++++|+||+|||||
T Consensus       134 ~i~~fl~~~~~~~~~lpLGfTFSFP~~Q~sl~~g~Li~WTKGF~~~~v~G~DVv~lL~~al~r~g~~~v~v~AlvNDTVg  213 (470)
T 3f9m_A          134 CISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVA  213 (470)
T ss_dssp             HHHHHHHHTTCSSSCCEEEEEECSCEEEEETTEEEECCCCTTCCCBTCBTSBHHHHHHHHHHHHCSCCCEEEEEECHHHH
T ss_pred             HHHHHHhhccccccccceEEEEeccccccCCCceEEEeccccccCCCcCCccHHHHHHHHHHhcCCCCCcEEEEEEcCHH
Confidence            99999999887778999999999999999999999999999999999999999999999999998789999999999999


Q ss_pred             eC
Q psy15536        199 TY  200 (200)
Q Consensus       199 tL  200 (200)
                      ||
T Consensus       214 TL  215 (470)
T 3f9m_A          214 TM  215 (470)
T ss_dssp             HH
T ss_pred             HH
Confidence            96
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* Back     alignment and structure
>3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* Back     alignment and structure
>3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} Back     alignment and structure
>3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* Back     alignment and structure
>1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 Back     alignment and structure
>2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A Back     alignment and structure
>2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A Back     alignment and structure
>1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 Back     alignment and structure
>1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} Back     alignment and structure
>2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} Back     alignment and structure
>2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A Back     alignment and structure
>2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* Back     alignment and structure
>3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} Back     alignment and structure
>3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} Back     alignment and structure
>4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} Back     alignment and structure
>3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} Back     alignment and structure
>3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* Back     alignment and structure
>2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 Back     alignment and structure
>1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 Back     alignment and structure
>2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* Back     alignment and structure
>3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Back     alignment and structure
>4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Back     alignment and structure
>2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Back     alignment and structure
>3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Back     alignment and structure
>3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Back     alignment and structure
>2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Back     alignment and structure
>3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* Back     alignment and structure
>2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Back     alignment and structure
>3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Back     alignment and structure
>1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* Back     alignment and structure
>2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Back     alignment and structure
>3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Back     alignment and structure
>3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* Back     alignment and structure
>3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens} Back     alignment and structure
>2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Back     alignment and structure
>3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 200
d1bdga1208 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schis 5e-54
d1czan1207 c.55.1.3 (N:16-222) Mammalian type I hexokinase {H 3e-53
d1v4sa1205 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapie 3e-53
d1czan3205 c.55.1.3 (N:466-670) Mammalian type I hexokinase { 4e-52
d1ig8a1207 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Sac 3e-49
d1bdga2237 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schi 4e-09
d1ig8a2262 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Sa 8e-09
d1v4sa2243 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapi 1e-07
d1czan4243 c.55.1.3 (N:671-913) Mammalian type I hexokinase { 2e-07
d1czan2243 c.55.1.3 (N:223-465) Mammalian type I hexokinase { 3e-07
d1woqa1129 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-g 3e-04
>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Hexokinase
domain: Hexokinase
species: Blood fluke (Schistosoma mansoni) [TaxId: 6183]

 Score =  169 bits (429), Expect = 5e-54
 Identities = 60/144 (41%), Positives = 86/144 (59%), Gaps = 2/144 (1%)

Query: 58  NFPRKIEQGQFLALDLGGTNFRVILMHLK-KGLVTDEIVKHYHIPDELRLGSGLKLFDFL 116
             P   E G FLALDLGGTN+RV+ + L+ KG       + Y IP E   GSG +LF ++
Sbjct: 58  KTPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYCIPAEKMSGSGTELFKYI 117

Query: 117 AACISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLK 176
           A  ++DF+    + D+   +GFTFSFP  Q+ L    LV WTK F + GVE  +V ++L+
Sbjct: 118 AETLADFLENNGMKDKKFDLGFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQ 177

Query: 177 DAIHRRQDNHVEIVCVLNDTTGTY 200
             + +R + +V+ V V+NDT GT 
Sbjct: 178 TELDKR-ELNVKCVAVVNDTVGTL 200
>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 205 Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Length = 207 Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Length = 237 Back     information, alignment and structure
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Length = 262 Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query200
d1v4sa1205 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1bdga1208 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 100.0
d1czan3205 Mammalian type I hexokinase {Human (Homo sapiens) 100.0
d1czan1207 Mammalian type I hexokinase {Human (Homo sapiens) 100.0
d1ig8a1207 Hexokinase {Baker's yeast (Saccharomyces cerevisia 100.0
d1ig8a2262 Hexokinase {Baker's yeast (Saccharomyces cerevisia 98.95
d1v4sa2243 Glucokinase {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1czan2243 Mammalian type I hexokinase {Human (Homo sapiens) 98.92
d1czan4243 Mammalian type I hexokinase {Human (Homo sapiens) 98.88
d1bdga2237 Hexokinase {Blood fluke (Schistosoma mansoni) [Tax 98.88
d2ap1a2117 Putative regulator protein YcfX {Salmonella typhim 98.5
d1z6ra2129 Mlc protein {Escherichia coli [TaxId: 562]} 98.44
d1woqa1129 Inorganic polyphosphate/ATP-glucomannokinase PPGMK 98.43
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 98.42
d2hoea3128 N-acetylglucosamine kinase {Thermotoga maritima [T 98.39
d1z05a3128 Transcriptional regulator VC2007 {Vibrio cholerae 98.38
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 97.92
d2gupa1114 Hypothetical protein SP2142 {Streptococcus pneumon 97.86
d1xc3a1118 Putative fructokinase YhdR {Bacillus subtilis [Tax 97.75
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 97.74
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 97.3
d1sz2a1 319 Glucokinase Glk {Escherichia coli [TaxId: 562]} 96.68
d2p3ra1 252 Glycerol kinase {Escherichia coli [TaxId: 562]} 95.68
d1huxa_ 259 Hydroxyglutaryl-CoA dehydratase component A {Acida 92.84
d1r59o1 252 Glycerol kinase {Enterococcus casseliflavus [TaxId 85.16
d2ewsa1 267 Type II pantothenate kinase, CoaW {Staphylococcus 84.75
d1u6za2124 Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 82.64
d1t6ca1126 Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 82.31
>d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Hexokinase
domain: Glucokinase
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9.2e-57  Score=370.16  Aligned_cols=154  Identities=44%  Similarity=0.790  Sum_probs=145.3

Q ss_pred             ccccccccccCCcccccccCccccceEEEecCCceeEEEEEEEcCCc----eEEEEEEEeecCcccccccchhHHHHHHH
Q psy15536         43 DKVKHWETERHGEKNNFPRKIEQGQFLALDLGGTNFRVILMHLKKGL----VTDEIVKHYHIPDELRLGSGLKLFDFLAA  118 (200)
Q Consensus        43 ~~i~k~~~~~~~~v~~~P~g~E~G~f~alDlGGTnlRv~~v~l~g~~----~~~~~~~~~~ip~~~~~~~~~~lFd~ia~  118 (200)
                      ++++|+|+    |+..+|+|+|.|.|||||+|||||||++|+|.++.    .+++.++.|+||++++.+++++||||||+
T Consensus        40 ssl~MlPt----~v~~lPtG~E~G~flalDlGGTn~Rv~~V~L~~~~~~~~~~~~~~~~~~ip~~~~~~t~~~LFd~iA~  115 (205)
T d1v4sa1          40 ASVKMLPT----YVRSTPEGSEVGDFLSLDLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISE  115 (205)
T ss_dssp             CSSCCEEE----EEESCCCCCCCEEEEEEEESSSEEEEEEEEECCCSSSCCEEEEEEEEEECCSTTTSSBHHHHHHHHHH
T ss_pred             Ccceeeee----ecccCCCCcccceEEEEecCCceEEEEEEEeCCCCCCCceeEEEeecccCChhhccCCHHHHHHHHHH
Confidence            56899998    67889999999999999999999999999996542    46778999999999999999999999999


Q ss_pred             HHHHHHhhccCCCcceeeeEEeecccccccCCceEEEeeccceecCCCCCccHHHHHHHHHHHcCCCCceEEEEEccCce
Q psy15536        119 CISDFVHEYQVHDRVIPMGFTFSFPMHQRSLDSGILVTWTKSFKSSGVEKEDVVKMLKDAIHRRQDNHVEIVCVLNDTTG  198 (200)
Q Consensus       119 ~i~~f~~~~~~~~~~l~lGftFSFP~~q~~~~~~~li~wtKgf~~~~~~g~dv~~~L~~al~r~~~~~v~v~aivNDTVa  198 (200)
                      ||++|+++++..++++||||||||||+|+++++|+|++|||||++++++|+|++++|++|++|++.++++|+||+|||||
T Consensus       116 ~i~~fl~~~~~~~~~lplGfTFSFP~~Q~sl~~g~Li~wtKgf~~~~~~g~dv~~lL~~al~r~~~~~v~v~aivNDTvg  195 (205)
T d1v4sa1         116 CISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVA  195 (205)
T ss_dssp             HHHHHHHTTTCTTCCCEEEEEECSCEEEEETTEEEECCCCTTCCCBTCTTSBHHHHHHHHHTTTCSCCCEEEEEECHHHH
T ss_pred             HHHHHHHhhCCCCCccccEEEEcCccccCCCCcEEEEEcccccccCccccchHHHHHHHHHHhcCCCCceEEEEEEchHH
Confidence            99999999888888999999999999999999999999999999999999999999999999998899999999999999


Q ss_pred             eC
Q psy15536        199 TY  200 (200)
Q Consensus       199 tL  200 (200)
                      ||
T Consensus       196 TL  197 (205)
T d1v4sa1         196 TM  197 (205)
T ss_dssp             HH
T ss_pred             HH
Confidence            96
>d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1ig8a2 c.55.1.3 (A:225-486) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} Back     information, alignment and structure
>d1v4sa2 c.55.1.3 (A:219-461) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan2 c.55.1.3 (N:223-465) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1czan4 c.55.1.3 (N:671-913) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdga2 c.55.1.3 (A:223-460) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} Back     information, alignment and structure
>d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Back     information, alignment and structure
>d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure