Psyllid ID: psy15556
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 288 | ||||||
| 345492695 | 1354 | PREDICTED: LOW QUALITY PROTEIN: kinesin- | 0.670 | 0.142 | 0.706 | 3e-77 | |
| 380024868 | 1328 | PREDICTED: kinesin-like protein KIF16B-l | 0.677 | 0.146 | 0.714 | 1e-76 | |
| 328784285 | 1326 | PREDICTED: hypothetical protein LOC41317 | 0.677 | 0.147 | 0.714 | 1e-76 | |
| 328784283 | 1327 | PREDICTED: hypothetical protein LOC41317 | 0.677 | 0.146 | 0.714 | 2e-76 | |
| 383859873 | 1332 | PREDICTED: kinesin-like protein KIF16B-l | 0.677 | 0.146 | 0.710 | 4e-76 | |
| 189239408 | 1932 | PREDICTED: similar to AGAP003925-PA [Tri | 0.663 | 0.098 | 0.705 | 1e-75 | |
| 350409654 | 1328 | PREDICTED: kinesin-like protein KIF16B-l | 0.677 | 0.146 | 0.696 | 2e-75 | |
| 332018583 | 1335 | Kinesin-like protein KIF16B [Acromyrmex | 0.677 | 0.146 | 0.696 | 3e-75 | |
| 380024870 | 1324 | PREDICTED: kinesin-like protein KIF16B-l | 0.649 | 0.141 | 0.686 | 5e-75 | |
| 307201498 | 1359 | Kinesin-like protein KIF16B [Harpegnatho | 0.649 | 0.137 | 0.677 | 8e-74 |
| >gi|345492695|ref|XP_001599413.2| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein KIF16B, partial [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 294 bits (752), Expect = 3e-77, Method: Compositional matrix adjust.
Identities = 154/218 (70%), Positives = 171/218 (78%), Gaps = 25/218 (11%)
Query: 59 TGDRLKEGAHINKSLVTLGSVISSLAELST------KKSTFIPYRDSVLTWLLKDSLGGN 112
TG RLKEGAHINKSLVTLGSVIS+LAELS+ ++S FIPYRDSVLTWLLKDSLGGN
Sbjct: 274 TGQRLKEGAHINKSLVTLGSVISALAELSSTDSNCSRRSIFIPYRDSVLTWLLKDSLGGN 333
Query: 113 SKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRIIRELHDEITKLKAM 172
SKTIMIAAISPAD NY ETLSTLRYANRAKNIINKPT+NEDPN ++IREL +EI KLK++
Sbjct: 334 SKTIMIAAISPADCNYGETLSTLRYANRAKNIINKPTINEDPNVKLIRELREEIQKLKSL 393
Query: 173 LTSVKVNSVARQQLLSKAQQTQGNQPQMLAALQAKQEQEKVLTEEWAEKWRETQKILQEQ 232
+ + +P +LA + KQEQEKVLTEEWAEKWRETQKIL EQ
Sbjct: 394 I----------------GKDVSTERP-LLAQIYEKQEQEKVLTEEWAEKWRETQKILSEQ 436
Query: 233 QALGLRMGKDGTGVVLDSDRPHLVRIDDDLYSTGVTLY 270
+ALGLR K G GVVLDS+ PHLV IDDDL STGVTLY
Sbjct: 437 RALGLR--KSGVGVVLDSEMPHLVGIDDDLLSTGVTLY 472
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|380024868|ref|XP_003696211.1| PREDICTED: kinesin-like protein KIF16B-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328784285|ref|XP_396621.4| PREDICTED: hypothetical protein LOC413170 isoform 2 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|328784283|ref|XP_003250427.1| PREDICTED: hypothetical protein LOC413170 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383859873|ref|XP_003705416.1| PREDICTED: kinesin-like protein KIF16B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|189239408|ref|XP_973885.2| PREDICTED: similar to AGAP003925-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350409654|ref|XP_003488806.1| PREDICTED: kinesin-like protein KIF16B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332018583|gb|EGI59168.1| Kinesin-like protein KIF16B [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|380024870|ref|XP_003696212.1| PREDICTED: kinesin-like protein KIF16B-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307201498|gb|EFN81261.1| Kinesin-like protein KIF16B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 288 | ||||||
| FB|FBgn0004387 | 1299 | Klp98A "Kinesin-like protein a | 0.586 | 0.130 | 0.616 | 6.6e-60 | |
| UNIPROTKB|F1NUI7 | 1306 | KIF16B "Uncharacterized protei | 0.690 | 0.152 | 0.627 | 2.1e-59 | |
| ZFIN|ZDB-GENE-090313-233 | 1318 | kif16ba "kinesin family member | 0.687 | 0.150 | 0.601 | 1.9e-58 | |
| ZFIN|ZDB-GENE-070424-241 | 1309 | kif16bb "kinesin family member | 0.690 | 0.152 | 0.608 | 4e-58 | |
| UNIPROTKB|F1PJY0 | 1313 | KIF16B "Uncharacterized protei | 0.690 | 0.151 | 0.618 | 4e-58 | |
| UNIPROTKB|F1PJW5 | 1317 | KIF16B "Uncharacterized protei | 0.690 | 0.151 | 0.618 | 4.1e-58 | |
| UNIPROTKB|Q96L93 | 1317 | KIF16B "Kinesin-like protein K | 0.690 | 0.151 | 0.618 | 4.1e-58 | |
| UNIPROTKB|F1SBI9 | 1318 | KIF16B "Uncharacterized protei | 0.690 | 0.150 | 0.618 | 5.2e-58 | |
| UNIPROTKB|I3LQ03 | 1329 | KIF16B "Uncharacterized protei | 0.690 | 0.149 | 0.618 | 5.3e-58 | |
| MGI|MGI:1098240 | 1312 | Kif16b "kinesin family member | 0.690 | 0.151 | 0.618 | 6.6e-58 |
| FB|FBgn0004387 Klp98A "Kinesin-like protein at 98A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 535 (193.4 bits), Expect = 6.6e-60, Sum P(2) = 6.6e-60
Identities = 114/185 (61%), Positives = 140/185 (75%)
Query: 78 SVISSLAELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRY 137
S +++ ++K+ +IPYRDS+LTWLLKDSLGGNSKTIMIAA+SPAD NYSETLSTLRY
Sbjct: 298 SALATTPNGASKRVLYIPYRDSILTWLLKDSLGGNSKTIMIAALSPADCNYSETLSTLRY 357
Query: 138 ANRAKNIINKPTVNEDPNTRIIRELHDEITKLKAMLTSVKVNSVARQQLLSKAQQTQGNQ 197
ANRAKNIINKPTVNED N ++IREL +EI KLK+ML ++S+ Q L
Sbjct: 358 ANRAKNIINKPTVNEDTNVKLIRELREEINKLKSMLAG-DIHSL--QPSL---------- 404
Query: 198 PQMLAALQAKQEQEKVLTEEWAEKWRETQKILQEQQALGLRMGKDGTGVVLDSDRPHLVR 257
++LA LQ K+ QEKVLTEEW EKW+ Q ILQEQ++LGLR K G GVVLDS+ PHL+
Sbjct: 405 -KVLADLQKKEAQEKVLTEEWTEKWKVAQSILQEQKSLGLR--KSGVGVVLDSEMPHLIG 461
Query: 258 IDDDL 262
I +D+
Sbjct: 462 IHNDV 466
|
|
| UNIPROTKB|F1NUI7 KIF16B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-233 kif16ba "kinesin family member 16Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070424-241 kif16bb "kinesin family member 16Bb" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJY0 KIF16B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJW5 KIF16B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96L93 KIF16B "Kinesin-like protein KIF16B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBI9 KIF16B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQ03 KIF16B "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098240 Kif16b "kinesin family member 16B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 288 | |||
| cd01365 | 356 | cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K | 3e-57 | |
| smart00129 | 335 | smart00129, KISc, Kinesin motor, catalytic domain | 1e-48 | |
| pfam00225 | 326 | pfam00225, Kinesin, Kinesin motor domain | 2e-47 | |
| cd01371 | 333 | cd01371, KISc_KIF3, Kinesin motor domain, kinesins | 9e-44 | |
| cd01372 | 341 | cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik | 4e-42 | |
| cd01370 | 338 | cd01370, KISc_KIP3_like, Kinesin motor domain, KIP | 5e-42 | |
| cd00106 | 328 | cd00106, KISc, Kinesin motor domain | 8e-41 | |
| cd01364 | 352 | cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC | 2e-37 | |
| cd01366 | 329 | cd01366, KISc_C_terminal, Kinesin motor domain, KI | 9e-36 | |
| PLN03188 | 1320 | PLN03188, PLN03188, kinesin-12 family protein; Pro | 9e-34 | |
| cd01374 | 321 | cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E | 1e-32 | |
| COG5059 | 568 | COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | 2e-31 | |
| cd01369 | 325 | cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine | 2e-31 | |
| cd01373 | 337 | cd01373, KISc_KLP2_like, Kinesin motor domain, KLP | 7e-31 | |
| cd01367 | 322 | cd01367, KISc_KIF2_like, Kinesin motor domain, KIF | 2e-24 | |
| cd01375 | 334 | cd01375, KISc_KIF9_like, Kinesin motor domain, KIF | 7e-21 | |
| cd01376 | 319 | cd01376, KISc_KID_like, Kinesin motor domain, KIF2 | 3e-20 | |
| cd01363 | 186 | cd01363, Motor_domain, Myosin and Kinesin motor do | 4e-20 | |
| cd01368 | 345 | cd01368, KISc_KIF23_like, Kinesin motor domain, KI | 1e-16 |
| >gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
Score = 187 bits (476), Expect = 3e-57
Identities = 71/97 (73%), Positives = 82/97 (84%), Gaps = 4/97 (4%)
Query: 59 TGDRLKEGAHINKSLVTLGSVISSLAELST----KKSTFIPYRDSVLTWLLKDSLGGNSK 114
GDRLKEG++INKSL TLG VIS+LA+ S+ KKS+FIPYRDSVLTWLLK++LGGNSK
Sbjct: 260 EGDRLKEGSNINKSLTTLGKVISALADNSSAKSKKKSSFIPYRDSVLTWLLKENLGGNSK 319
Query: 115 TIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVN 151
T MIA ISPAD+NY ETLSTLRYA+RAK I+N VN
Sbjct: 320 TAMIATISPADINYEETLSTLRYADRAKKIVNVAVVN 356
|
KIF1A (Unc104) transports synaptic vesicles to the nerve terminal, KIF1B has been implicated in transport of mitochondria. Both proteins are expressed in neurons. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type). N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. In contrast to the majority of dimeric kinesins, most KIF1A/Unc104 kinesins are monomeric motors. A lysine-rich loop in KIF1A binds to the negatively charged C-terminus of tubulin and compensates for the lack of a second motor domain, allowing KIF1A to move processively. Length = 356 |
| >gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238054 cd00106, KISc, Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| KOG0245|consensus | 1221 | 100.0 | ||
| KOG0241|consensus | 1714 | 100.0 | ||
| KOG4280|consensus | 574 | 100.0 | ||
| KOG0243|consensus | 1041 | 100.0 | ||
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 100.0 | |
| KOG0242|consensus | 675 | 100.0 | ||
| KOG0240|consensus | 607 | 100.0 | ||
| cd01373 | 337 | KISc_KLP2_like Kinesin motor domain, KLP2-like sub | 100.0 | |
| KOG0244|consensus | 913 | 100.0 | ||
| cd01370 | 338 | KISc_KIP3_like Kinesin motor domain, KIP3-like sub | 100.0 | |
| cd01364 | 352 | KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind | 100.0 | |
| cd01365 | 356 | KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p | 100.0 | |
| cd01368 | 345 | KISc_KIF23_like Kinesin motor domain, KIF23-like s | 100.0 | |
| cd01371 | 333 | KISc_KIF3 Kinesin motor domain, kinesins II or KIF | 100.0 | |
| cd01372 | 341 | KISc_KIF4 Kinesin motor domain, KIF4-like subfamil | 100.0 | |
| cd01376 | 319 | KISc_KID_like Kinesin motor domain, KIF22/Kid-like | 100.0 | |
| KOG0247|consensus | 809 | 100.0 | ||
| cd01369 | 325 | KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy | 100.0 | |
| cd01375 | 334 | KISc_KIF9_like Kinesin motor domain, KIF9-like sub | 100.0 | |
| cd01374 | 321 | KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like | 100.0 | |
| cd01367 | 322 | KISc_KIF2_like Kinesin motor domain, KIF2-like gro | 100.0 | |
| cd01366 | 329 | KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ | 100.0 | |
| smart00129 | 335 | KISc Kinesin motor, catalytic domain. ATPase. Micr | 100.0 | |
| KOG0239|consensus | 670 | 100.0 | ||
| PF00225 | 335 | Kinesin: Kinesin motor domain; InterPro: IPR001752 | 100.0 | |
| cd01363 | 186 | Motor_domain Myosin and Kinesin motor domain. Thes | 99.97 | |
| cd00106 | 328 | KISc Kinesin motor domain. This catalytic (head) d | 99.97 | |
| KOG0246|consensus | 676 | 99.97 | ||
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 99.97 | |
| COG5059 | 568 | KIP1 Kinesin-like protein [Cytoskeleton] | 84.85 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 81.14 |
| >KOG0245|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-71 Score=561.10 Aligned_cols=270 Identities=43% Similarity=0.599 Sum_probs=237.5
Q ss_pred ceecccccCCCCCceeEEEEEEEeeeeeecCCCCCCceeeeeeEEeec--CCccccccccchhhcchhccccchhhHHHH
Q psy15556 2 AVGDTMLNGCLTKDKQRFPWFVSGWVTIWSHGDFWGQYLKGLFHLIPQ--YNQGIFYSITGDRLKEGAHINKSLVTLGSV 79 (288)
Q Consensus 2 ~v~~T~~N~~SSRSH~Iftl~V~~~~~~~s~~~~~~~~~~s~l~lVDL--sEr~~~~~~~g~rl~E~~~IN~SL~~L~~v 79 (288)
+||||+||+.|||||+||||...+... ....+......|+|+|||| |||+..+|+.|+|++||.+|||||++||+|
T Consensus 203 TtAATnMNdtSSRSHaVFtIvftQk~~--~~~~~l~sek~SKIsLVDLAGSERasstGa~G~RLKEGa~INKSLtTLGkV 280 (1221)
T KOG0245|consen 203 TTAATNMNDTSSRSHAVFTIVFTQKKH--DQDTGLDSEKVSKISLVDLAGSERASSTGANGDRLKEGANINKSLTTLGKV 280 (1221)
T ss_pred hhhhhccccccccceeEEEEEEEeeec--cccCCCcceeeeeeeEEeccCcccccccCCCccchhcccccchHHHHHHHH
Confidence 689999999999999999999999543 2233345789999999999 999999999999999999999999999999
Q ss_pred HHHHhhhhc---CCCccccCCCcchhhhhcccCCCCcceEEEeecCCCCCChHhHHHHHHHHHHhccccccccccCCccH
Q psy15556 80 ISSLAELST---KKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNT 156 (288)
Q Consensus 80 I~~L~~~~~---~~~~~iPyRdSkLT~lL~d~LgGn~kt~~I~~isp~~~~~~ETlsTL~fa~rak~i~~~~~~n~~~~~ 156 (288)
|+||++.++ ++..+||||||.|||||++.||||+||+|||+|||++.||+|||||||||+|||+|+|+|+||+||++
T Consensus 281 ISALAe~~~~k~~ks~fIPYRDSVLTWLLkEnLGGNSKTaMIAAlSPAdiNyeETLSTLRYAdRAK~Iv~~avVNEdpna 360 (1221)
T KOG0245|consen 281 ISALAESQKGKKKKSDFIPYRDSVLTWLLKENLGGNSKTAMIAALSPADINYEETLSTLRYADRAKQIVNNAVVNEDPNA 360 (1221)
T ss_pred HHHHHHHhccCCCCCccccchHHHHHHHHHHhcCCcchhhhhhccChhhcChHHHHHHHHHhhHhhhhhccceeCCCccH
Confidence 999999775 45569999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHhhhhhchHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Q psy15556 157 RIIRELHDEITKLKAMLTSVKVNSVARQQLLSKAQQTQGNQPQMLAALQAKQEQEKVLTEEWAEKWRETQKILQEQQALG 236 (288)
Q Consensus 157 ~~i~~l~~ei~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~e~~~e~~~~~~e~~~l~ 236 (288)
++||+|++|+.+||..+............ .......+.+.++++++|++.|+.+++++++|+|||++++++..+++++
T Consensus 361 KLIRELreEv~rLksll~~~~~~~~~~~~-~p~~~~~~~~~e~~~~~L~E~Ek~mael~etW~EKl~~aEair~e~~~~- 438 (1221)
T KOG0245|consen 361 KLIRELREEVARLKSLLRAQGLGDIAVEG-SPSALLSQPEIEELRERLQETEKIMAELNETWEEKLREAEAIRMEREAL- 438 (1221)
T ss_pred HHHHHHHHHHHHHHHHHhccccccccccC-CcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH-
Confidence 99999999999999999765443221000 0001123456788999999999999999999999999999999988766
Q ss_pred cccccCCcceeeCC--CCCceeecCCCccccceEEEEecCCcc
Q psy15556 237 LRMGKDGTGVVLDS--DRPHLVRIDDDLYSTGVTLYDSVLPSF 277 (288)
Q Consensus 237 ~~~~~~~~~~~~~~--~~p~LvnlneDp~~s~~~~y~~~~~~~ 277 (288)
+ .+.|+++..|. ++||||||||||+|||||+|+||-+.|
T Consensus 439 L--~emGva~~~D~~kk~phLVNLneDPllSe~LlY~ikeG~T 479 (1221)
T KOG0245|consen 439 L--AEMGVAVREDGGKKTPHLVNLNEDPLLSECLLYYIKEGET 479 (1221)
T ss_pred H--HhcCceeeecCCccCcceeccCCCchhhccEEEEeccCce
Confidence 2 36788888888 999999999999999999999998865
|
|
| >KOG0241|consensus | Back alignment and domain information |
|---|
| >KOG4280|consensus | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0242|consensus | Back alignment and domain information |
|---|
| >KOG0240|consensus | Back alignment and domain information |
|---|
| >cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup | Back alignment and domain information |
|---|
| >KOG0244|consensus | Back alignment and domain information |
|---|
| >cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup | Back alignment and domain information |
|---|
| >cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division | Back alignment and domain information |
|---|
| >cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins | Back alignment and domain information |
|---|
| >cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup | Back alignment and domain information |
|---|
| >cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins | Back alignment and domain information |
|---|
| >cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily | Back alignment and domain information |
|---|
| >cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup | Back alignment and domain information |
|---|
| >KOG0247|consensus | Back alignment and domain information |
|---|
| >cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup | Back alignment and domain information |
|---|
| >cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling | Back alignment and domain information |
|---|
| >cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis | Back alignment and domain information |
|---|
| >cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group | Back alignment and domain information |
|---|
| >cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins | Back alignment and domain information |
|---|
| >smart00129 KISc Kinesin motor, catalytic domain | Back alignment and domain information |
|---|
| >KOG0239|consensus | Back alignment and domain information |
|---|
| >PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >cd01363 Motor_domain Myosin and Kinesin motor domain | Back alignment and domain information |
|---|
| >cd00106 KISc Kinesin motor domain | Back alignment and domain information |
|---|
| >KOG0246|consensus | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5059 KIP1 Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 288 | ||||
| 1i5s_A | 367 | Crystal Structure Of The Kif1a Motor Domain Complex | 5e-31 | ||
| 1i6i_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 5e-31 | ||
| 1vfv_A | 366 | Crystal Structure Of The Kif1a Motor Domain Complex | 5e-31 | ||
| 1ia0_K | 394 | Kif1a Head-Microtubule Complex Structure In Atp-For | 5e-31 | ||
| 3b6u_A | 372 | Crystal Structure Of The Motor Domain Of Human Kine | 2e-30 | ||
| 3gbj_A | 354 | Crystal Structure Of The Motor Domain Of Kinesin Ki | 1e-29 | ||
| 3b6v_A | 395 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-28 | ||
| 2vvg_A | 350 | Crystal Structure Of The G.Intestinalis Kinesin 2 G | 4e-28 | ||
| 2owm_A | 443 | Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 | 1e-25 | ||
| 3lre_A | 355 | Crystal Structure Analysis Of Human Kinesin-8 Motor | 2e-23 | ||
| 4a28_A | 368 | Eg5-2 Length = 368 | 5e-23 | ||
| 1ii6_A | 368 | Crystal Structure Of The Mitotic Kinesin Eg5 In Com | 5e-23 | ||
| 1q0b_A | 367 | Crystal Structure Of The Motor Protein Ksp In Compl | 5e-23 | ||
| 4aqv_C | 373 | Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma | 5e-23 | ||
| 1x88_A | 359 | Human Eg5 Motor Domain Bound To Mg-Adp And Monastro | 5e-23 | ||
| 4a1z_A | 368 | Eg5-1 Length = 368 | 5e-23 | ||
| 3hqd_A | 369 | Human Kinesin Eg5 Motor Domain In Complex With Ampp | 5e-23 | ||
| 4ap0_A | 370 | The Mitotic Kinesin Eg5 In Complex With Mg-Adp And | 5e-23 | ||
| 4a14_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 8e-22 | ||
| 3zcw_A | 348 | Eg5 - New Allosteric Binding Site Length = 348 | 9e-22 | ||
| 2wbe_C | 373 | Kinesin-5-Tubulin Complex With Amppnp Length = 373 | 7e-21 | ||
| 2xt3_A | 344 | Human Kif7, A Kinesin Involved In Hedgehog Signalli | 9e-20 | ||
| 1goj_A | 355 | Structure Of A Fast Kinesin: Implications For Atpas | 3e-19 | ||
| 1mkj_A | 349 | Human Kinesin Motor Domain With Docked Neck Linker | 9e-19 | ||
| 1sdm_A | 369 | Crystal Structure Of Kinesin-Like Calmodulin Bindin | 9e-19 | ||
| 4atx_C | 340 | Rigor Kinesin Motor Domain With An Ordered Neck-Lin | 1e-18 | ||
| 2y5w_A | 365 | Crystal Structure Of Drosophila Melanogaster Kinesi | 4e-18 | ||
| 1bg2_A | 325 | Human Ubiquitous Kinesin Motor Domain Length = 325 | 1e-17 | ||
| 3h4s_A | 386 | Structure Of The Complex Of A Mitotic Kinesin With | 2e-17 | ||
| 4h1g_A | 715 | Structure Of Candida Albicans Kar3 Motor Domain Fus | 3e-17 | ||
| 2h58_A | 330 | Crystal Structure Of The Kifc3 Motor Domain In Comp | 3e-17 | ||
| 1t5c_A | 349 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-17 | ||
| 3bfn_A | 388 | Crystal Structure Of The Motor Domain Of Human Kine | 1e-16 | ||
| 3kin_B | 117 | Kinesin (Dimeric) From Rattus Norvegicus Length = 1 | 2e-15 | ||
| 2kin_B | 100 | Kinesin (Monomeric) From Rattus Norvegicus Length = | 4e-15 | ||
| 1f9t_A | 358 | Crystal Structures Of Kinesin Mutants Reveal A Sign | 4e-15 | ||
| 1f9v_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-15 | ||
| 3kar_A | 346 | The Motor Domain Of Kinesin-Like Protein Kar3, A Sa | 4e-15 | ||
| 1f9w_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 4e-15 | ||
| 4etp_A | 403 | C-Terminal Motor And Motor Homology Domain Of Kar3v | 5e-15 | ||
| 4gkr_A | 371 | Structure Of The C-Terminal Motor Domain Of Kar3 Fr | 2e-14 | ||
| 1f9u_A | 347 | Crystal Structures Of Mutants Reveal A Signalling P | 3e-14 | ||
| 2rep_A | 376 | Crystal Structure Of The Motor Domain Of Human Kine | 4e-14 | ||
| 3t0q_A | 349 | Motor Domain Structure Of The Kar3-Like Kinesin Fro | 7e-14 | ||
| 2gry_A | 420 | Crystal Structure Of The Human Kif2 Motor Domain In | 5e-13 | ||
| 1v8j_A | 410 | The Crystal Structure Of The Minimal Functional Dom | 3e-12 | ||
| 2heh_A | 387 | Crystal Structure Of The Kif2c Motor Domain (Casp T | 4e-12 | ||
| 3edl_D | 331 | Kinesin13-Microtubule Ring Complex Length = 331 | 5e-12 | ||
| 1ry6_A | 360 | Crystal Structure Of Internal Kinesin Motor Domain | 1e-11 | ||
| 3pxn_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 3e-11 | ||
| 3dc4_A | 344 | Crystal Structure Of The Drosophila Kinesin Family | 4e-11 | ||
| 2ncd_A | 420 | Ncd (Non-Claret Disjunctional) Dimer From D. Melano | 5e-11 | ||
| 3l1c_A | 383 | Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | 5e-11 | ||
| 3u06_A | 412 | Crystal Structure Of The Kinesin-14 Ncdg347d Length | 5e-11 | ||
| 1cz7_A | 406 | The Crystal Structure Of A Minus-End Directed Micro | 5e-11 | ||
| 3nwn_A | 359 | Crystal Structure Of The Human Kif9 Motor Domain In | 2e-10 | ||
| 1n6m_A | 409 | Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY | 3e-10 |
| >pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 | Back alignment and structure |
|
| >pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 | Back alignment and structure |
| >pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 | Back alignment and structure |
| >pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 | Back alignment and structure |
| >pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 | Back alignment and structure |
| >pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 | Back alignment and structure |
| >pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 | Back alignment and structure |
| >pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 | Back alignment and structure |
| >pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 | Back alignment and structure |
| >pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 | Back alignment and structure |
| >pdb|4A28|A Chain A, Eg5-2 Length = 368 | Back alignment and structure |
| >pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 | Back alignment and structure |
| >pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 | Back alignment and structure |
| >pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 | Back alignment and structure |
| >pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 | Back alignment and structure |
| >pdb|4A1Z|A Chain A, Eg5-1 Length = 368 | Back alignment and structure |
| >pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 | Back alignment and structure |
| >pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 | Back alignment and structure |
| >pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 | Back alignment and structure |
| >pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 | Back alignment and structure |
| >pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 | Back alignment and structure |
| >pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 | Back alignment and structure |
| >pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 | Back alignment and structure |
| >pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 | Back alignment and structure |
| >pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 | Back alignment and structure |
| >pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 | Back alignment and structure |
| >pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 | Back alignment and structure |
| >pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 | Back alignment and structure |
| >pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 | Back alignment and structure |
| >pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 | Back alignment and structure |
| >pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 | Back alignment and structure |
| >pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 | Back alignment and structure |
| >pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 | Back alignment and structure |
| >pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 | Back alignment and structure |
| >pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 | Back alignment and structure |
| >pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 | Back alignment and structure |
| >pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 | Back alignment and structure |
| >pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 | Back alignment and structure |
| >pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 | Back alignment and structure |
| >pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 | Back alignment and structure |
| >pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 | Back alignment and structure |
| >pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 | Back alignment and structure |
| >pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 | Back alignment and structure |
| >pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 | Back alignment and structure |
| >pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 | Back alignment and structure |
| >pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 | Back alignment and structure |
| >pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 | Back alignment and structure |
| >pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 | Back alignment and structure |
| >pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 | Back alignment and structure |
| >pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 | Back alignment and structure |
| >pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 | Back alignment and structure |
| >pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 | Back alignment and structure |
| >pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 | Back alignment and structure |
| >pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 288 | |||
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 3e-72 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 6e-71 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 8e-70 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 3e-69 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 2e-67 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 3e-67 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 1e-66 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 3e-65 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 2e-64 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 3e-63 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 2e-62 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 2e-62 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 2e-60 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 3e-60 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 7e-57 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 1e-55 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 5e-55 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 9e-55 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 2e-54 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 1e-53 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 4e-52 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 5e-52 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 7e-52 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 9e-52 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 4e-51 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 8e-50 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 4e-48 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 2e-46 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 7e-04 |
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 | Back alignment and structure |
|---|
Score = 225 bits (576), Expect = 3e-72
Identities = 67/105 (63%), Positives = 82/105 (78%), Gaps = 8/105 (7%)
Query: 59 TGDRLKEGAHINKSLVTLGSVISSLAELST--------KKSTFIPYRDSVLTWLLKDSLG 110
G RLKEGA+INKSL TLG VIS+LAE+ + KK+ FIPYRDSVLTWLL+++LG
Sbjct: 261 KGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLG 320
Query: 111 GNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPN 155
GNS+T M+AA+SPAD+NY ETLSTLRYA+RAK I N +VN +
Sbjct: 321 GNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVSVNHHHH 365
|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 100.0 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 100.0 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 100.0 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 100.0 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 100.0 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 100.0 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 100.0 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 100.0 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 100.0 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 100.0 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 100.0 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 100.0 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 100.0 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 100.0 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 100.0 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 100.0 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 100.0 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 100.0 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 100.0 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 100.0 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 100.0 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 100.0 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 100.0 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 100.0 | |
| 4h1g_A | 715 | Maltose binding protein-cakar3 motor domain fusio; | 100.0 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 100.0 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 100.0 | |
| 2kin_B | 100 | Kinesin; motor protein, cytoskeleton; HET: ADP; 2. | 100.0 | |
| 3kin_B | 117 | Kinesin heavy chain; motor protein, cytoskeleton; | 99.97 | |
| 4egx_A | 184 | Kinesin-like protein KIF1A; FHA domain, transport | 99.68 | |
| 4ejq_A | 154 | Kinesin-like protein KIF1A; homodimer, FHA domain, | 99.14 | |
| 3fm8_A | 124 | Kinesin-like protein KIF13B; kinesin, GAP, GTPase | 98.25 | |
| 1wln_A | 120 | Afadin; beta sandwich, FHA domain, structural geno | 95.97 |
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.4e-46 Score=355.43 Aligned_cols=158 Identities=32% Similarity=0.468 Sum_probs=140.3
Q ss_pred ceecccccCCCCCceeEEEEEEEeeeeeecCCCCCCceeeeeeEEeec--CCccccccccchhhcchhccccchhhHHHH
Q psy15556 2 AVGDTMLNGCLTKDKQRFPWFVSGWVTIWSHGDFWGQYLKGLFHLIPQ--YNQGIFYSITGDRLKEGAHINKSLVTLGSV 79 (288)
Q Consensus 2 ~v~~T~~N~~SSRSH~Iftl~V~~~~~~~s~~~~~~~~~~s~l~lVDL--sEr~~~~~~~g~rl~E~~~IN~SL~~L~~v 79 (288)
++|+|.+|..|||||+||+|+|++... ..+....|+|+|||| |||..++++.|.|++||++||+||++||+|
T Consensus 193 ~~~~T~~N~~SSRSH~if~i~v~~~~~------~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~v 266 (369)
T 3cob_A 193 HTTGTLMNEQSSRSHLIVSVIIESTNL------QTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDV 266 (369)
T ss_dssp CCCSCCTTCHHHHSEEEEEEEEEEEET------TTCCEEEEEEEEEECCCSSCCCCCSSCSHHHHHHHHHTHHHHHHHHH
T ss_pred eeecccCCCCCCcceEEEEEEEEEecC------CCCcEEEEEEEEEeCCCCCcccccCccchhhHHHHHHHHHHHHHHHH
Confidence 589999999999999999999998543 234567899999999 999999999999999999999999999999
Q ss_pred HHHHhhhhcCCCccccCCCcchhhhhcccCCCCcceEEEeecCCCCCChHhHHHHHHHHHHhccccccccccCCccHHHH
Q psy15556 80 ISSLAELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRII 159 (288)
Q Consensus 80 I~~L~~~~~~~~~~iPyRdSkLT~lL~d~LgGn~kt~~I~~isp~~~~~~ETlsTL~fa~rak~i~~~~~~n~~~~~~~i 159 (288)
|.+|++ +..||||||||||+||+|+|||||+|+||+||||+..+++||++||+||+|||+|+|+|.+|+++ ..+
T Consensus 267 I~aL~~----~~~hvPyRdSkLT~lLqdsLgGnskt~mIa~isP~~~~~~ETl~TLrfA~rak~i~~~~~~n~~~--~ei 340 (369)
T 3cob_A 267 ISALSS----GNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSS--KEV 340 (369)
T ss_dssp HHHHHT----TCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHHTCBCCCCCCEEC--HHH
T ss_pred HHHHhc----CCCcCCCcCCHHHHHHHHhcCCCccEEEEEEeCCccccHHHHHHHHHHHHHHhhcccCCcccCCH--HHH
Confidence 999987 56799999999999999999999999999999999999999999999999999999999999988 334
Q ss_pred HHHHHHHHHHHH
Q psy15556 160 RELHDEITKLKA 171 (288)
Q Consensus 160 ~~l~~ei~~L~~ 171 (288)
.+|+.++..+++
T Consensus 341 ~~L~~~l~~~~~ 352 (369)
T 3cob_A 341 ARLKKLVSYWKE 352 (369)
T ss_dssp HHHHHHTTCC--
T ss_pred HHHHHHHHHHHH
Confidence 444444443333
|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A | Back alignment and structure |
|---|
| >3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* | Back alignment and structure |
|---|
| >1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 288 | ||||
| d1goja_ | 354 | c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 | 2e-41 | |
| d1sdma_ | 364 | c.37.1.9 (A:) Kinesin heavy chain-like protein {Po | 2e-39 | |
| d1bg2a_ | 323 | c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId | 3e-37 | |
| d1ry6a_ | 330 | c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu | 5e-37 | |
| d1f9va_ | 342 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 8e-37 | |
| d2zfia1 | 349 | c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), | 8e-37 | |
| d2ncda_ | 368 | c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun | 1e-36 | |
| d1x88a1 | 345 | c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), | 3e-35 | |
| d1v8ka_ | 362 | c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c | 1e-34 |
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin species: Neurospora crassa [TaxId: 5141]
Score = 144 bits (363), Expect = 2e-41
Identities = 61/170 (35%), Positives = 86/170 (50%), Gaps = 10/170 (5%)
Query: 2 AVGDTMLNGCLTKDKQRFPWFVSGWVTIWSHGDFWGQYLKGLFHLIPQYNQGIFYSITGD 61
AV T +N ++ F ++ +L L G +G
Sbjct: 194 AVAATNMNQESSRSHSIFVITITQKNVETGSAKSGQLFLVDLAGSEKVGKTGA----SGQ 249
Query: 62 RLKEGAHINKSLVTLGSVISSLAELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAI 121
L+E INKSL LG VI++L + KS+ +PYRDS LT +L++SLGGNS+T +I
Sbjct: 250 TLEEAKKINKSLSALGMVINAL---TDGKSSHVPYRDSKLTRILQESLGGNSRTTLIINC 306
Query: 122 SPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRIIRELHDEITKLKA 171
SP+ N +ETLSTLR+ RAK+I NK VN + + EL + K K
Sbjct: 307 SPSSYNDAETLSTLRFGMRAKSIKNKAKVNAELS---PAELKQMLAKAKT 353
|
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 288 | |||
| d1sdma_ | 364 | Kinesin heavy chain-like protein {Potato (Solanum | 100.0 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 100.0 | |
| d1x88a1 | 345 | Kinesin {Human (Homo sapiens), mitotic kinesin eg5 | 100.0 | |
| d1f9va_ | 342 | Kinesin motor Ncd (non-claret disjunctional) {Bake | 100.0 | |
| d1v8ka_ | 362 | Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 | 100.0 | |
| d2zfia1 | 349 | Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 | 100.0 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1ry6a_ | 330 | Kinesin {Malaria parasite (Plasmodium falciparum) | 100.0 | |
| d2ncda_ | 368 | Kinesin motor Ncd (non-claret disjunctional) {Frui | 100.0 | |
| d2g1la1 | 102 | Kinesin-like protein kif1c {Human (Homo sapiens) [ | 97.64 | |
| d1wlna1 | 107 | Afadin {Mouse (Mus musculus) [TaxId: 10090]} | 95.21 |
| >d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Kinesin heavy chain-like protein species: Potato (Solanum tuberosum) [TaxId: 4113]
Probab=100.00 E-value=5.6e-42 Score=323.70 Aligned_cols=160 Identities=32% Similarity=0.454 Sum_probs=133.2
Q ss_pred ceecccccCCCCCceeEEEEEEEeeeeeecCCCCCCceeeeeeEEeec--CCccccccccchhhcchhccccchhhHHHH
Q psy15556 2 AVGDTMLNGCLTKDKQRFPWFVSGWVTIWSHGDFWGQYLKGLFHLIPQ--YNQGIFYSITGDRLKEGAHINKSLVTLGSV 79 (288)
Q Consensus 2 ~v~~T~~N~~SSRSH~Iftl~V~~~~~~~s~~~~~~~~~~s~l~lVDL--sEr~~~~~~~g~rl~E~~~IN~SL~~L~~v 79 (288)
++++|.+|..|||||+||+|+|++... .......|+|+|||| |||..++++.|.+++|+.+||+||++|++|
T Consensus 188 ~~~~t~~n~~ssRsH~i~~i~v~~~~~------~~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~v 261 (364)
T d1sdma_ 188 HTTGTLMNEQSSRSHLIVSVIIESTNL------QTQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDV 261 (364)
T ss_dssp CCCSSCTTCHHHHSEEEEEEEEEEEET------TTCCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHH
T ss_pred ccccccccccccccceEEEEEEEEecc------CcceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHH
Confidence 478999999999999999999988543 235668899999999 999999999999999999999999999999
Q ss_pred HHHHhhhhcCCCccccCCCcchhhhhcccCCCCcceEEEeecCCCCCChHhHHHHHHHHHHhccccccccccCCccHHHH
Q psy15556 80 ISSLAELSTKKSTFIPYRDSVLTWLLKDSLGGNSKTIMIAAISPADVNYSETLSTLRYANRAKNIINKPTVNEDPNTRII 159 (288)
Q Consensus 80 I~~L~~~~~~~~~~iPyRdSkLT~lL~d~LgGn~kt~~I~~isp~~~~~~ETlsTL~fa~rak~i~~~~~~n~~~~~~~i 159 (288)
|.+|++ +..|||||+||||+||+|+|||||+|+||+||||+..+++||++||+||++|++|+|+|++|.... .+
T Consensus 262 i~aL~~----~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~--~~ 335 (364)
T d1sdma_ 262 ISALSS----GNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSK--EV 335 (364)
T ss_dssp HHHHHH----TCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECH--HH
T ss_pred HHHHHc----CCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCHH--HH
Confidence 999997 667999999999999999999999999999999999999999999999999999999999998653 35
Q ss_pred HHHHHHHHHHHHHH
Q psy15556 160 RELHDEITKLKAML 173 (288)
Q Consensus 160 ~~l~~ei~~L~~~l 173 (288)
.+|++++..|++++
T Consensus 336 ~~l~~~i~~l~~~~ 349 (364)
T d1sdma_ 336 ARLKKLVSYWKEQA 349 (364)
T ss_dssp HHHHTTTTCC----
T ss_pred HHHHHHHHHHHHHH
Confidence 56666666666554
|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|