Psyllid ID: psy15589

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQHFFQ
cccHHHHHHHHHHHcHHHHHHccccccccHHHHHHccccEEEccccEEEEccccccEEEEEEccEEEEEEcccEEEEEEcccccEEEEcccccccEEEEEEEEcccEEEEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccc
cccHHHHHHHHHHccccccccccEcccccEEEEEcccccHHHHccEEEEEccccccEEEEEEEcEEEEEEccccEEEEEcccccccEEEEEcccccEEEEEEEcccEEEEEEcHHHHHHHHccHHHHHHHHHHccccEEEEEEcccccccccccc
MARAGWVLRTLLlndesgtlrdrktsggrtIARRCASGSELVDWLMTMFhqgdegksWYIIIQGSVDVVIYGKGcvtslyagedfgklalvnnapraativtrednchflrvdKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVncsshqhffq
MARAGWVLRtlllndesgtlrdrktsggrtiarrcasgSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRaativtrednchflrvdkddfiRIMRDVEantvrlkehgkdvlvLERMVNCSSHQHFFQ
MARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQHFFQ
****GWVLRTLLLN***************TIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNC********
*****WVLRTLLLNDESGTLRDRKT**GRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKD******************
MARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQHFFQ
**RAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMV**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARAGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQHFFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query155 2.2.26 [Sep-21-2011]
Q9EQZ6 1011 Rap guanine nucleotide ex no N/A 0.574 0.088 0.762 5e-40
Q8WZA2 1011 Rap guanine nucleotide ex no N/A 0.574 0.088 0.762 5e-40
O95398 923 Rap guanine nucleotide ex no N/A 0.619 0.104 0.729 1e-37
Q8VCC8 918 Rap guanine nucleotide ex no N/A 0.619 0.104 0.718 5e-37
Q9Z1C8 926 Rap guanine nucleotide ex no N/A 0.619 0.103 0.718 7e-36
P34578 1038 Rap guanine nucleotide ex no N/A 0.767 0.114 0.488 9e-25
Q9HEP7 389 cAMP-dependent protein ki N/A N/A 0.567 0.226 0.343 1e-09
O42794 404 cAMP-dependent protein ki N/A N/A 0.490 0.188 0.367 1e-09
Q8TEU7 1601 Rap guanine nucleotide ex no N/A 0.606 0.058 0.315 3e-09
Q9C1C2 391 cAMP-dependent protein ki N/A N/A 0.567 0.225 0.343 3e-09
>sp|Q9EQZ6|RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus GN=Rapgef4 PE=1 SV=1 Back     alignment and function desciption
 Score =  163 bits (412), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 90/97 (92%)

Query: 48  MFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNC 107
           +F+QG+EG SWYII++GSV+VVIYGKG V +L+ G+DFGKLALVN+APRAA+IV REDNC
Sbjct: 384 LFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNC 443

Query: 108 HFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERM 144
           HFLRVDK+DF RI+RDVEANTVRLKEH +DVLVLE++
Sbjct: 444 HFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV 480
Guanine nucleotide exchange factor (GEF) for RAP1A, RAP1B and RAP2A small GTPases that is activated by binding cAMP. Seems not to activate RAB3A. Involved in cAMP-dependent, PKA-independent exocytosis through interaction with RIMS2.
Mus musculus (taxid: 10090)
>sp|Q8WZA2|RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens GN=RAPGEF4 PE=1 SV=1 Back     alignment and function description
>sp|O95398|RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens GN=RAPGEF3 PE=1 SV=6 Back     alignment and function description
>sp|Q8VCC8|RPGF3_MOUSE Rap guanine nucleotide exchange factor 3 OS=Mus musculus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description
>sp|Q9Z1C8|RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus GN=Rapgef3 PE=2 SV=2 Back     alignment and function description
>sp|P34578|RPGF1_CAEEL Rap guanine nucleotide exchange factor 1 OS=Caenorhabditis elegans GN=epac-1 PE=4 SV=3 Back     alignment and function description
>sp|Q9HEP7|KAPR_BLUGR cAMP-dependent protein kinase regulatory subunit OS=Blumeria graminis GN=pkar PE=3 SV=1 Back     alignment and function description
>sp|O42794|KAPR_COLTR cAMP-dependent protein kinase regulatory subunit OS=Colletotrichum trifolii GN=PKAR PE=3 SV=1 Back     alignment and function description
>sp|Q8TEU7|RPGF6_HUMAN Rap guanine nucleotide exchange factor 6 OS=Homo sapiens GN=RAPGEF6 PE=1 SV=2 Back     alignment and function description
>sp|Q9C1C2|KAPR_COLOR cAMP-dependent protein kinase regulatory subunit OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PKAR PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
270013336 883 hypothetical protein TcasGA2_TC011926 [T 0.677 0.118 0.735 8e-41
291238584 1089 PREDICTED: cAMP-regulated guanine nucleo 0.580 0.082 0.795 9e-41
189241119 1019 PREDICTED: similar to AGAP007307-PA [Tri 0.677 0.103 0.735 1e-40
241789371 713 cAMP-dependent rap1 guanine-nucleotide e 0.683 0.148 0.711 1e-40
405960606 978 Rap guanine nucleotide exchange factor 4 0.593 0.094 0.772 2e-40
427793251 885 Putative camp-regulated guanine nucleoti 0.612 0.107 0.783 3e-40
391334871 1113 PREDICTED: rap guanine nucleotide exchan 0.567 0.079 0.791 7e-40
443707267 986 hypothetical protein CAPTEDRAFT_111500 [ 0.574 0.090 0.793 9e-40
260811988 655 hypothetical protein BRAFLDRAFT_67768 [B 0.683 0.161 0.711 1e-39
432934641 1003 PREDICTED: rap guanine nucleotide exchan 0.580 0.089 0.775 2e-39
>gi|270013336|gb|EFA09784.1| hypothetical protein TcasGA2_TC011926 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 78/106 (73%), Positives = 96/106 (90%), Gaps = 1/106 (0%)

Query: 48  MFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNC 107
           +FHQGDEG+SWYII++GSVDVVI+GKG V +L+ G+DFGKLAL+N+APRAATIV RE+NC
Sbjct: 308 LFHQGDEGRSWYIIVRGSVDVVIHGKGTVNTLHEGDDFGKLALINDAPRAATIVLRENNC 367

Query: 108 HFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQHF 153
           HFLRVDK++F RI+RDVEANTVRLKEHGKDVL+LE+ +N  + Q F
Sbjct: 368 HFLRVDKENFNRILRDVEANTVRLKEHGKDVLILEK-INTPTKQIF 412

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|291238584|ref|XP_002739213.1| PREDICTED: cAMP-regulated guanine nucleotide exchange factor II-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|189241119|ref|XP_972857.2| PREDICTED: similar to AGAP007307-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|241789371|ref|XP_002400620.1| cAMP-dependent rap1 guanine-nucleotide exchange factor, putative [Ixodes scapularis] gi|215510804|gb|EEC20257.1| cAMP-dependent rap1 guanine-nucleotide exchange factor, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|405960606|gb|EKC26517.1| Rap guanine nucleotide exchange factor 4 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|427793251|gb|JAA62077.1| Putative camp-regulated guanine nucleotide exchange factor, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|391334871|ref|XP_003741822.1| PREDICTED: rap guanine nucleotide exchange factor 4-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|443707267|gb|ELU02945.1| hypothetical protein CAPTEDRAFT_111500 [Capitella teleta] Back     alignment and taxonomy information
>gi|260811988|ref|XP_002600703.1| hypothetical protein BRAFLDRAFT_67768 [Branchiostoma floridae] gi|229285992|gb|EEN56715.1| hypothetical protein BRAFLDRAFT_67768 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|432934641|ref|XP_004081968.1| PREDICTED: rap guanine nucleotide exchange factor 4-like [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query155
FB|FBgn0085421 998 Epac "Exchange protein directl 0.670 0.104 0.695 1e-46
UNIPROTKB|F1Q0Q1 496 RAPGEF3 "Uncharacterized prote 0.619 0.193 0.729 4e-39
UNIPROTKB|H9KZE9 766 H9KZE9 "Uncharacterized protei 0.670 0.135 0.663 1.1e-38
UNIPROTKB|F8VRX1 814 RAPGEF3 "Rap guanine nucleotid 0.619 0.117 0.729 5.5e-37
UNIPROTKB|F1PW07 905 RAPGEF3 "Uncharacterized prote 0.619 0.106 0.729 5.6e-37
UNIPROTKB|H7BYQ1 868 RAPGEF3 "Rap guanine nucleotid 0.619 0.110 0.729 7.5e-37
UNIPROTKB|E7EQC8 881 RAPGEF3 "Rap guanine nucleotid 0.619 0.108 0.729 8e-37
UNIPROTKB|O95398 923 RAPGEF3 "Rap guanine nucleotid 0.619 0.104 0.729 9.9e-37
UNIPROTKB|F1ME49 923 RAPGEF3 "Uncharacterized prote 0.619 0.104 0.718 3.5e-36
UNIPROTKB|B7Z278 791 RAPGEF4 "cDNA FLJ50956, highly 0.670 0.131 0.726 3.7e-36
FB|FBgn0085421 Epac "Exchange protein directly activated by cAMP ortholog (H. sapiens)" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 390 (142.3 bits), Expect = 1.0e-46, Sum P(2) = 1.0e-46
 Identities = 73/105 (69%), Positives = 91/105 (86%)

Query:    48 MFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNC 107
             +F+QGDEG+SWYI+++GSVDVVI+GKG V +L  G+DFGKLAL+N+APRAATIV +E+NC
Sbjct:   372 LFNQGDEGRSWYILLKGSVDVVIHGKGTVATLKTGDDFGKLALINDAPRAATIVLKENNC 431

Query:   108 HFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERMVNCSSHQH 152
             H LRVDK+ F RI+RDVEANT+RL+EHGKDVLVLER+      QH
Sbjct:   432 HLLRVDKEHFNRILRDVEANTLRLQEHGKDVLVLERVAK-QRGQH 475
GO:0017132 "cyclic nucleotide-dependent guanyl-nucleotide exchange factor activity" evidence=ISS
GO:0017034 "Rap guanyl-nucleotide exchange factor activity" evidence=ISS
GO:0008603 "cAMP-dependent protein kinase regulator activity" evidence=IEA
GO:0001932 "regulation of protein phosphorylation" evidence=IEA
GO:0005952 "cAMP-dependent protein kinase complex" evidence=IEA
GO:0051056 "regulation of small GTPase mediated signal transduction" evidence=IEA
UNIPROTKB|F1Q0Q1 RAPGEF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZE9 H9KZE9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F8VRX1 RAPGEF3 "Rap guanine nucleotide exchange factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PW07 RAPGEF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYQ1 RAPGEF3 "Rap guanine nucleotide exchange factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQC8 RAPGEF3 "Rap guanine nucleotide exchange factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O95398 RAPGEF3 "Rap guanine nucleotide exchange factor 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1ME49 RAPGEF3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z278 RAPGEF4 "cDNA FLJ50956, highly similar to Rap guanine nucleotide exchange factor 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 9e-18
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 1e-14
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 4e-12
cd04437125 cd04437, DEP_Epac, DEP (Dishevelled, Egl-10, and P 2e-11
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 3e-06
PRK11753211 PRK11753, PRK11753, DNA-binding transcriptional du 4e-05
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 73.5 bits (181), Expect = 9e-18
 Identities = 30/87 (34%), Positives = 45/87 (51%), Gaps = 5/87 (5%)

Query: 49  FHQGDEGKSWYIIIQGSVDVVIYGKG----CVTSLYAGEDFGKLALVNNAPRAATIVTRE 104
             QGD   S YI++ GSV+V    +      V  L  G+ FG+LAL+ N PR+AT+    
Sbjct: 29  IRQGDPADSLYIVLSGSVEVYKLDEDGREQIVGFLGPGDLFGELALLGNGPRSATVRALT 88

Query: 105 DNCHFLRVDKDDFIRIMRDVEANTVRL 131
           D    L + + DF R++++      RL
Sbjct: 89  D-SELLVLPRSDFRRLLQEYPELARRL 114

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|239884 cd04437, DEP_Epac, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in Epac-like proteins Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236969 PRK11753, PRK11753, DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 155
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.7
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.64
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.64
KOG1113|consensus 368 99.63
cd00038115 CAP_ED effector domain of the CAP family of transc 99.62
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.59
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.59
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.57
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.55
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.54
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.53
KOG0498|consensus 727 99.5
COG2905 610 Predicted signal-transduction protein containing c 99.49
KOG0500|consensus536 99.49
KOG0614|consensus 732 99.47
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.43
KOG0614|consensus 732 99.36
KOG0499|consensus 815 99.36
PLN02868 413 acyl-CoA thioesterase family protein 99.32
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.31
KOG1113|consensus368 99.07
KOG2968|consensus 1158 98.77
KOG0501|consensus 971 98.62
KOG2968|consensus 1158 98.12
PF04831153 Popeye: Popeye protein conserved region; InterPro: 98.06
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.96
KOG3542|consensus 1283 97.57
KOG2378|consensus 573 96.96
KOG3542|consensus 1283 93.43
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 88.52
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 88.25
cd04437125 DEP_Epac DEP (Dishevelled, Egl-10, and Pleckstrin) 83.21
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information 
Probab=99.70  E-value=1.6e-16  Score=118.44  Aligned_cols=119  Identities=16%  Similarity=0.193  Sum_probs=107.5

Q ss_pred             hhHHHhhhhhhhHHHHHHHhhcCHHHHHHhhcchhhHHHHhhcccccccCCeEEEEEecEEEEEEecCe---eEEEccCC
Q psy15589          6 WVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKG---CVTSLYAG   82 (155)
Q Consensus         6 ~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~g~~~~~lyii~~G~v~v~~~~~~---~~~~l~~G   82 (155)
                      .+-+.++|..+++...+.+...  ...+++.+|+.+       +.+|+.++++|+|++|.++++....+   .+..+.+|
T Consensus         8 ~l~~~~~f~~L~~~~~~~l~~~--~~~~~~~~ge~l-------~~~g~~~~~~~~v~~G~v~~~~~~~~~~~~i~~~~~g   78 (236)
T PRK09392          8 RLRNLPLFADMADATFERLMRG--AFLQRFPPGTML-------ITEGEPADFLFVVLDGLVELSASSQDRETTLAILRPV   78 (236)
T ss_pred             HHhcCccccCCCHHHHHHHHhh--cceeecCCCCEE-------EeCCCccceEEEEEeCEEEEEEcCCCceEEEEEeCCC
Confidence            3446889999999999997776  677889999999       99999999999999999999875443   78899999


Q ss_pred             CeeehhhhhcCCCceeEEEEecCcEEEEEEcHHHHHHHHHhhHHHHHHHHHh
Q psy15589         83 EDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEH  134 (155)
Q Consensus        83 ~~fGe~~ll~~~~~~~~~~a~~~~~~vl~l~~~~f~~l~~~~~~~~~~l~~~  134 (155)
                      ++||+.+++.+.++.++++|.++ |.++.+|.+.|.+++.++|.+...+...
T Consensus        79 ~~~g~~~~~~~~~~~~~~~A~~~-~~~~~i~~~~~~~l~~~~p~l~~~~~~~  129 (236)
T PRK09392         79 STFILAAVVLDAPYLMSARTLTR-SRVLMIPAELVREAMSEDPGFMRAVVFE  129 (236)
T ss_pred             chhhhHHHhCCCCCceEEEEcCc-eEEEEEeHHHHHHHHHHCHHHHHHHHHH
Confidence            99999999999999999999995 9999999999999999999999887666

>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>cd04437 DEP_Epac DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in Epac-like proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
3cf6_E 694 Structure Of Epac2 In Complex With Cyclic-Amp And R 3e-41
2byv_E 999 Structure Of The Camp Responsive Exchange Factor Ep 4e-41
1o7f_A469 Crystal Structure Of The Regulatory Domain Of Epac2 2e-40
4f7z_A 999 Conformational Dynamics Of Exchange Protein Directl 8e-40
4din_B 381 Novel Localization And Quaternary Structure Of The 1e-09
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 4e-09
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 4e-09
2qcs_B 291 A Complex Structure Between The Catalytic And Regul 4e-09
1rl3_A 288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 5e-09
1ne4_A 283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 5e-09
3of1_A246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 3e-08
2d93_A134 Solution Structure Of The Cnmp_binding Domain Of Hu 2e-06
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 1e-05
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 1e-05
1cx4_A 305 Crystal Structure Of A Deletion Mutant Of The Type 2e-05
3tnp_B 416 Structure And Allostery Of The Pka Riib Tetrameric 4e-05
2qvs_B 310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 4e-05
3tnq_A 416 Structure And Allostery Of The Pka Riib Tetrameric 4e-05
4ev0_A216 Crystal Structure Of Thermus Thermophilus Catabolit 1e-04
>pdb|3CF6|E Chain E, Structure Of Epac2 In Complex With Cyclic-Amp And Rap Length = 694 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (414), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 90/97 (92%)
Query: 48  MFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDNC 107
           +F+QG+EG SWYII++GSV+VVIYGKG V +L+ G+DFGKLALVN+APRAA+IV REDNC
Sbjct: 67  LFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNC 126
Query: 108 HFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLERM 144
           HFLRVDK+DF RI+RDVEANTVRLKEH +DVLVLE++
Sbjct: 127 HFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKV 163
>pdb|2BYV|E Chain E, Structure Of The Camp Responsive Exchange Factor Epac2 In Its Auto-Inhibited State Length = 999 Back     alignment and structure
>pdb|1O7F|A Chain A, Crystal Structure Of The Regulatory Domain Of Epac2 Length = 469 Back     alignment and structure
>pdb|4F7Z|A Chain A, Conformational Dynamics Of Exchange Protein Directly Activated By Camp Length = 999 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|2D93|A Chain A, Solution Structure Of The Cnmp_binding Domain Of Human Rap Guanine Nucleotide Exchange Factor 6 Length = 134 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|4EV0|A Chain A, Crystal Structure Of Thermus Thermophilus Catabolite Activator Protein Length = 216 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query155
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-41
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 5e-17
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 2e-41
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 5e-40
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-28
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 7e-07
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 8e-35
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-26
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 7e-25
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-22
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-19
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 6e-17
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 9e-18
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 5e-17
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 6e-17
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-16
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 4e-16
4din_B381 CAMP-dependent protein kinase type I-beta regulat 2e-16
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 3e-16
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 5e-16
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 3e-15
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 8e-15
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-14
2pqq_A149 Putative transcriptional regulator; APC7345, strep 4e-13
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 2e-12
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-12
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 6e-12
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 1e-10
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 2e-10
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 2e-10
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 5e-10
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 9e-10
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 2e-09
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 4e-09
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 4e-09
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 4e-09
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 7e-09
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 7e-09
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 2e-08
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 3e-08
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 3e-08
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 5e-08
3ukn_A212 Novel protein similar to vertebrate potassium VOL 7e-08
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 2e-07
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-07
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 5e-07
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 1e-06
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 3e-06
3b02_A195 Transcriptional regulator, CRP family; structural 8e-06
1ft9_A222 Carbon monoxide oxidation system transcription reg 2e-05
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 2e-04
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
 Score =  143 bits (360), Expect = 2e-41
 Identities = 74/97 (76%), Positives = 89/97 (91%)

Query: 47  TMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDN 106
            +F+QG+EG SWYII++GSV+VVIYGKG V +L+ G+DFGKLALVN+APRAA+IV REDN
Sbjct: 371 VLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDN 430

Query: 107 CHFLRVDKDDFIRIMRDVEANTVRLKEHGKDVLVLER 143
           CHFLRVDK+DF RI+RDVEANTVRLKEH +DVLVLE+
Sbjct: 431 CHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEK 467
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.83
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.8
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.79
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.79
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.79
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.78
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.78
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.78
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.78
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.78
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.78
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.77
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.77
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.77
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.76
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.76
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.76
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.75
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.74
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.74
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.74
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.72
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.72
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.71
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.71
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.71
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.71
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.71
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.71
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.7
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.7
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.69
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.69
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.69
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.68
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.67
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.67
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.67
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.66
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.65
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.65
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.63
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.62
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.62
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.61
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.59
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.59
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.56
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.56
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.55
3b02_A195 Transcriptional regulator, CRP family; structural 99.54
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.32
3lwc_A119 Uncharacterized protein; structural genomics, unkn 82.08
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
Probab=99.83  E-value=3.2e-20  Score=125.93  Aligned_cols=125  Identities=11%  Similarity=0.171  Sum_probs=108.6

Q ss_pred             hhhhHHHhhhhhhhHHHHHHHhhcCHHHHHHhhcchhhHHHHhhcccccccCCeEEEEEecEEEEEEecCe----e---E
Q psy15589          4 AGWVLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKG----C---V   76 (155)
Q Consensus         4 ~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~g~~~~~lyii~~G~v~v~~~~~~----~---~   76 (155)
                      ...+-+.++|..+++...+.+...  ...+.+.+|+.+       +.+|++++++|+|++|.++++..+.+    .   +
T Consensus         5 ~~~l~~~~~f~~l~~~~~~~l~~~--~~~~~~~~g~~i-------~~~g~~~~~~y~i~~G~v~~~~~~~~g~~~~~~~~   75 (142)
T 3mdp_A            5 PERLRVYRFFASLTDEQLKDIALI--SEEKSFPTGSVI-------FKENSKADNLMLLLEGGVELFYSNGGAGSAANSTV   75 (142)
T ss_dssp             TTGGGGSHHHHTSCHHHHHHHHHT--EEEEEECTTCEE-------ECTTSBCCEEEEEEESCEEEECC---------CEE
T ss_pred             HHHHhhCchhccCCHHHHHHHHHh--hcEEecCCCCEE-------EeCCCCCCcEEEEEeCEEEEEEECCCCCceEeeeE
Confidence            344567899999999999997766  677789999999       99999999999999999999875543    5   8


Q ss_pred             EEccCCCeeehhhhhcCCCceeEEEEecCcEEEEEEcHHHHHHHHHhhHHHHHHHHHhchhh
Q psy15589         77 TSLYAGEDFGKLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLKEHGKDV  138 (155)
Q Consensus        77 ~~l~~G~~fGe~~ll~~~~~~~~~~a~~~~~~vl~l~~~~f~~l~~~~~~~~~~l~~~~~~~  138 (155)
                      ..+++|++||+.+++.+.++.++++|.++ |.++.+++++|.+++.++|.+...+.+.+.+.
T Consensus        76 ~~~~~G~~fG~~~~~~~~~~~~~~~a~~~-~~~~~i~~~~~~~l~~~~p~~~~~l~~~l~~~  136 (142)
T 3mdp_A           76 CSVVPGAIFGVSSLIKPYHYTSSARATKP-VRVVDINGARLREMSENNQALGQVLMNNVAAA  136 (142)
T ss_dssp             EEECTTCEECGGGSSTTCBCSSEEEESSC-EEEEEEEHHHHHHHHHHCHHHHHHHHHHHHHH
T ss_pred             EEecCCCEechHHHcCCCCceEEEEECCc-EEEEEEeHHHHHHHHHHChHHHHHHHHHHHHH
Confidence            99999999999999999999999999995 99999999999999999999998887774443
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 155
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 2e-16
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-12
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 9e-10
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 5e-09
d1o7fa1142 a.4.5.31 (A:180-321) Regulatory domain of epac2, d 6e-08
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 1e-06
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 4e-06
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 7e-06
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-05
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 2e-04
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 3e-04
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory domain of Epac2, domains 1 and 3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 68.6 bits (167), Expect = 2e-16
 Identities = 61/81 (75%), Positives = 74/81 (91%)

Query: 47  TMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFGKLALVNNAPRAATIVTREDN 106
            +F+QG+EG SWYII++GSV+VVIYGKG V +L+ G+DFGKLALVN+APRAA+IV REDN
Sbjct: 44  VLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDN 103

Query: 107 CHFLRVDKDDFIRIMRDVEAN 127
           CHFLRVDK+DF RI+RDVEAN
Sbjct: 104 CHFLRVDKEDFNRILRDVEAN 124
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1o7fa1 a.4.5.31 (A:180-321) Regulatory domain of epac2, domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 142 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query155
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.84
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.82
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.81
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.81
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.81
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.8
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.79
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.79
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.79
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.76
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.74
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.74
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.73
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.72
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.71
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.69
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.62
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 86.11
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 85.55
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 85.54
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 82.12
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.84  E-value=1.7e-21  Score=131.59  Aligned_cols=115  Identities=27%  Similarity=0.497  Sum_probs=103.9

Q ss_pred             hHHHhhhhhhhHHHHHHHhhcCHHHHHHhhcchhhHHHHhhcccccccCCeEEEEEecEEEEEEecCeeEEEccCCCeee
Q psy15589          7 VLRTLLLNDESGTLRDRKTSGGRTIARRCASGSELVDWLMTMFHQGDEGKSWYIIIQGSVDVVIYGKGCVTSLYAGEDFG   86 (155)
Q Consensus         7 ~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~g~~~~~lyii~~G~v~v~~~~~~~~~~l~~G~~fG   86 (155)
                      +-++++|+++++..+.++...  ...+.+.+|+.+       +.+|+.++.+|+|++|.+++..... ....+++|++||
T Consensus        22 l~~~~lF~~l~~~~l~~l~~~--~~~~~~~~ge~I-------~~~gd~~~~~yiI~~G~v~v~~~~~-~~~~l~~G~~fG   91 (136)
T d1ne6a1          22 IEKNVLFSHLDDNERSDIFDA--MFPVSFIAGETV-------IQQGDEGDNFYVIDQGEMDVYVNNE-WATSVGEGGSFG   91 (136)
T ss_dssp             HHHCGGGTSCCHHHHHHHHHH--CEEEEECTTCEE-------ECTTSCCCEEEEEEESCEEEEETTE-EEEEECTTCEEC
T ss_pred             HhCCHhhhhCCHHHHHHHhcc--eEEEEECCCCEE-------EeCCCCcceeeeecCCceeeecccc-ccceeccccccc
Confidence            346779999999999997666  677889999999       9999999999999999999998665 778899999999


Q ss_pred             hhhhhcCCCceeEEEEecCcEEEEEEcHHHHHHHHHhhHHHHHHHH
Q psy15589         87 KLALVNNAPRAATIVTREDNCHFLRVDKDDFIRIMRDVEANTVRLK  132 (155)
Q Consensus        87 e~~ll~~~~~~~~~~a~~~~~~vl~l~~~~f~~l~~~~~~~~~~l~  132 (155)
                      |.+++.+.+++++++|.++ |.++.|++++|.++++++|...++++
T Consensus        92 e~~ll~~~~~~~tv~a~~~-~~l~~i~~~~f~~ll~~~~~~~r~~y  136 (136)
T d1ne6a1          92 ELALIYGTPRAATVKAKTN-VKLWGIDRDSYRRILMGSTLRKRKMY  136 (136)
T ss_dssp             CHHHHHCCCCCSEEEESSC-EEEEEEEHHHHHHHTHHHHHHHHHHH
T ss_pred             cHHHcCCCcceEEEEEccC-EEEEEEEHHHHHHHHhhCHHHHHhhC
Confidence            9999999999999999995 99999999999999999998877654
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure