Psyllid ID: psy15592

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MSDSILFLTGSQEEFYSPSLNKKCRNSSLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHPVVSQSRTSPQAKGKSNIWNRPIDLLSVC
ccHHHHHHHccHHHHHcccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
cccEEEEEcccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHccccccHcHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccEEEccccccccccccccccHHEEccccHHcccccccHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccEEEEEEEccccccccccHcccccccccccccccccccccEEcc
MSDSILFLtgsqeefyspslnkkcrnsslrwrdpnLTEVISFLSNPNNVIKANAAAYLQHLcymddpnkqktrslggipplvkllghespdvfRNACGalrnlsygrqndeNKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLsscedlkksiiddglQVVVNHIIiphsgwdpvsagetcwsTIFRNTsgvlrnassaGEYARKKLRECEGLIDSLLYVVKSAIeksnignksvENCVCILRNLSfrcqevedpnydkhpvvsqsrtspqakgksniwnrpidllsvc
msdsilfltgsqeefyspslnkkcrnsslrwrDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIphsgwdpvsAGETCWSTIFRntsgvlrnassagEYARKKLRECEGLIDSLLYVVKSAIeksnignksveNCVCILRNLSFRCQEVedpnydkhpvvsqsrtspqakgksniwnrpidllsvc
MSDSILFLTGSQEEFYSPSLNKKCRNSSLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHPVVSQSRTSPQAKGKSNIWNRPIDLLSVC
***************************SLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDD*******SLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQ****KRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEV*************************************
********************************DPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSG*******ETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKS*********KSVENCVCILRNLSFRCQEVE*****************************IDLL*VC
MSDSILFLTGSQEEFYSPSLNKKCRNSSLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYD*****************SNIWNRPIDLLSVC
****************************LRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHP*V**************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDSILFLTGSQEEFYSPSLNKKCRNSSLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHPVVSQSRTSPQAKGKSNIWNRPIDLLSVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query294 2.2.26 [Sep-21-2011]
O35927 1247 Catenin delta-2 OS=Mus mu yes N/A 0.806 0.190 0.555 4e-71
Q9UQB3 1225 Catenin delta-2 OS=Homo s yes N/A 0.758 0.182 0.578 4e-71
O00192 962 Armadillo repeat protein no N/A 0.833 0.254 0.527 8e-71
P98203 962 Armadillo repeat protein no N/A 0.877 0.268 0.509 1e-70
Q68FH0 1190 Plakophilin-4 OS=Mus musc no N/A 0.829 0.205 0.537 1e-69
Q99569 1192 Plakophilin-4 OS=Homo sap no N/A 0.829 0.204 0.537 4e-69
O35116264 Catenin delta-2 (Fragment no N/A 0.693 0.772 0.588 3e-65
P30999 938 Catenin delta-1 OS=Mus mu no N/A 0.857 0.268 0.457 2e-60
O60716 968 Catenin delta-1 OS=Homo s no N/A 0.758 0.230 0.489 1e-59
Q9U308 1254 Juxtamembrane domain-asso yes N/A 0.853 0.200 0.438 4e-58
>sp|O35927|CTND2_MOUSE Catenin delta-2 OS=Mus musculus GN=Ctnnd2 PE=1 SV=1 Back     alignment and function desciption
 Score =  268 bits (685), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 172/243 (70%), Gaps = 6/243 (2%)

Query: 17  SPSLNKKCRNS-SLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSL 75
           SPS++   ++     WRDP L EVI  L +    +++NAAAYLQHLC+ D+  K + R  
Sbjct: 529 SPSIDSIQKDPREFGWRDPELPEVIQMLQHQFPSVQSNAAAYLQHLCFGDNKIKAEIRRQ 588

Query: 76  GGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADA 135
           GGI  LV LL H   +V R+ACGALRNL YG+ ND+NK A+KN GGIP L+ LLRKT D 
Sbjct: 589 GGIQLLVDLLDHRMTEVHRSACGALRNLVYGKANDDNKIALKNCGGIPALVRLLRKTTDL 648

Query: 136 EVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWD--PVSAGETCW---STI 190
           E++ELVTGVLWNLSSC+ LK  II D L V+ N +IIPHSGW+  P+          S +
Sbjct: 649 EIRELVTGVLWNLSSCDALKMPIIQDALAVLTNAVIIPHSGWENSPLQDDRKIQLHSSQV 708

Query: 191 FRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNL 250
            RN +G LRN SSAGE AR+++REC+GL D+LLYV++SA+  S I +K+VENCVCILRNL
Sbjct: 709 LRNATGCLRNVSSAGEEARRRMRECDGLTDALLYVIQSALGSSEIDSKTVENCVCILRNL 768

Query: 251 SFR 253
           S+R
Sbjct: 769 SYR 771
May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules. Functions as a transcriptional activator when bound to ZBTB33.
Mus musculus (taxid: 10090)
>sp|Q9UQB3|CTND2_HUMAN Catenin delta-2 OS=Homo sapiens GN=CTNND2 PE=1 SV=3 Back     alignment and function description
>sp|O00192|ARVC_HUMAN Armadillo repeat protein deleted in velo-cardio-facial syndrome OS=Homo sapiens GN=ARVCF PE=1 SV=1 Back     alignment and function description
>sp|P98203|ARVC_MOUSE Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog OS=Mus musculus GN=Arvcf PE=1 SV=2 Back     alignment and function description
>sp|Q68FH0|PKP4_MOUSE Plakophilin-4 OS=Mus musculus GN=Pkp4 PE=1 SV=1 Back     alignment and function description
>sp|Q99569|PKP4_HUMAN Plakophilin-4 OS=Homo sapiens GN=PKP4 PE=1 SV=2 Back     alignment and function description
>sp|O35116|CTND2_RAT Catenin delta-2 (Fragment) OS=Rattus norvegicus GN=Ctnnd2 PE=1 SV=1 Back     alignment and function description
>sp|P30999|CTND1_MOUSE Catenin delta-1 OS=Mus musculus GN=Ctnnd1 PE=1 SV=2 Back     alignment and function description
>sp|O60716|CTND1_HUMAN Catenin delta-1 OS=Homo sapiens GN=CTNND1 PE=1 SV=1 Back     alignment and function description
>sp|Q9U308|JAC1_CAEEL Juxtamembrane domain-associated catenin OS=Caenorhabditis elegans GN=jac-1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
383860564 890 PREDICTED: catenin delta-2-like [Megachi 0.860 0.284 0.847 1e-127
328786946 895 PREDICTED: catenin delta-2-like [Apis me 0.860 0.282 0.847 1e-127
350426164 894 PREDICTED: catenin delta-2-like [Bombus 0.860 0.282 0.843 1e-127
380016012 915 PREDICTED: catenin delta-2-like [Apis fl 0.860 0.276 0.843 1e-127
340721767 896 PREDICTED: catenin delta-2-like [Bombus 0.860 0.282 0.843 1e-127
345491297 894 PREDICTED: catenin delta-2 isoform 1 [Na 0.867 0.285 0.837 1e-126
345491299 893 PREDICTED: catenin delta-2 isoform 2 [Na 0.867 0.285 0.837 1e-126
332021960 558 Catenin delta-2 [Acromyrmex echinatior] 0.860 0.453 0.839 1e-125
345491301 900 PREDICTED: catenin delta-2 isoform 3 [Na 0.860 0.281 0.839 1e-125
328710154 896 PREDICTED: catenin delta-2-like isoform 0.857 0.281 0.833 1e-124
>gi|383860564|ref|XP_003705759.1| PREDICTED: catenin delta-2-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 217/256 (84%), Positives = 241/256 (94%), Gaps = 3/256 (1%)

Query: 28  SLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGH 87
           S+RWRDPNL+EVI FLSNPNN+IKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLV+LL H
Sbjct: 268 SMRWRDPNLSEVIGFLSNPNNIIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVQLLDH 327

Query: 88  ESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWN 147
           ++PDV+RNACGALRNLSYGRQNDENKRAIKNAGG+P LINLLR+T+DA+VKELVTGVLWN
Sbjct: 328 DNPDVYRNACGALRNLSYGRQNDENKRAIKNAGGVPALINLLRRTSDADVKELVTGVLWN 387

Query: 148 LSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDP-VSAGETCWSTIFRNTSGVLRNASSAGE 206
           LSSCEDLKKSIIDDG+ +VVN+IIIPHSGWDP  S+GETCWST+FRN SGVLRN SSAGE
Sbjct: 388 LSSCEDLKKSIIDDGVTMVVNNIIIPHSGWDPSSSSGETCWSTVFRNASGVLRNVSSAGE 447

Query: 207 YARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHP 266
           YARKKLRECEGL+D+LLYVV+SAIEKSNIGNK VENCVCILRNLS+RCQEVEDPNYDKHP
Sbjct: 448 YARKKLRECEGLVDALLYVVRSAIEKSNIGNKIVENCVCILRNLSYRCQEVEDPNYDKHP 507

Query: 267 VVS--QSRTSPQAKGK 280
           + S  Q+R +  AKG+
Sbjct: 508 IQSTVQNRVAAPAKGE 523

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328786946|ref|XP_391862.4| PREDICTED: catenin delta-2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350426164|ref|XP_003494353.1| PREDICTED: catenin delta-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380016012|ref|XP_003691987.1| PREDICTED: catenin delta-2-like [Apis florea] Back     alignment and taxonomy information
>gi|340721767|ref|XP_003399286.1| PREDICTED: catenin delta-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345491297|ref|XP_001603430.2| PREDICTED: catenin delta-2 isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345491299|ref|XP_003426565.1| PREDICTED: catenin delta-2 isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332021960|gb|EGI62290.1| Catenin delta-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345491301|ref|XP_003426566.1| PREDICTED: catenin delta-2 isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328710154|ref|XP_003244181.1| PREDICTED: catenin delta-2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
FB|FBgn0260799 781 p120ctn "Adherens junction pro 0.911 0.343 0.697 3.7e-103
UNIPROTKB|F1NVG1 983 ARVCF "Uncharacterized protein 0.863 0.258 0.555 6.1e-71
UNIPROTKB|F1RHN2 961 ARVCF "Uncharacterized protein 0.833 0.254 0.531 1.2e-67
MGI|MGI:109620 962 Arvcf "armadillo repeat gene d 0.877 0.268 0.512 1e-66
RGD|1306655 898 Arvcf "armadillo repeat gene d 0.891 0.291 0.505 1.3e-66
UNIPROTKB|O00192 962 ARVCF "Armadillo repeat protei 0.833 0.254 0.531 1.8e-66
UNIPROTKB|E1C7G4 877 CTNND2 "Uncharacterized protei 0.806 0.270 0.555 2.8e-66
UNIPROTKB|D6R9A8 792 CTNND2 "Catenin delta-2" [Homo 0.806 0.299 0.555 2.8e-66
UNIPROTKB|E1BPV1 958 ARVCF "Uncharacterized protein 0.863 0.265 0.513 3.7e-66
UNIPROTKB|E7EPC8 1134 CTNND2 "Catenin delta-2" [Homo 0.806 0.208 0.555 1.8e-65
FB|FBgn0260799 p120ctn "Adherens junction protein p120" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1022 (364.8 bits), Expect = 3.7e-103, P = 3.7e-103
 Identities = 189/271 (69%), Positives = 231/271 (85%)

Query:    12 QEEFYSPSLNKKCRNSSLRWRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQK 71
             ++++   S N  C  S++RWRDPNL+EVISFLSNP++ IKANAAAYLQHLCYMDDPNKQ+
Sbjct:   205 KDDYIEGSENDIC--STMRWRDPNLSEVISFLSNPSSAIKANAAAYLQHLCYMDDPNKQR 262

Query:    72 TRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRK 131
             TRSLGGIPPLV+LL ++SP++ +NACGALRNLSYGRQNDENKR IKNAGGI  L++LL +
Sbjct:   263 TRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALVHLLCR 322

Query:   132 TADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAGETCWSTIF 191
             + + EVKELVTGVLWN+SSCEDLK+SIID+ L  VV  +I PHSGWD V  GETC+ST+F
Sbjct:   323 SQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGETCFSTVF 382

Query:   192 RNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLS 251
             RN SGVLRN SSAGE+AR  LR CE L++ LLYVV+++IEK+NIGNK+VENCVCILRNLS
Sbjct:   383 RNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKTVENCVCILRNLS 442

Query:   252 FRCQEVEDPNYDKHPVVSQSRTSPQA-KGKS 281
             +RCQEV+DPNYDKHP ++  R  P + KG++
Sbjct:   443 YRCQEVDDPNYDKHPFITPERVIPSSSKGEN 473
GO:0005912 "adherens junction" evidence=ISS;IDA;IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0005813 "centrosome" evidence=IDA
GO:0007155 "cell adhesion" evidence=IGI
GO:0001745 "compound eye morphogenesis" evidence=IGI;IMP
GO:0034334 "adherens junction maintenance" evidence=IMP
UNIPROTKB|F1NVG1 ARVCF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHN2 ARVCF "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:109620 Arvcf "armadillo repeat gene deleted in velo-cardio-facial syndrome" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306655 Arvcf "armadillo repeat gene deleted in velo-cardio-facial syndrome" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O00192 ARVCF "Armadillo repeat protein deleted in velo-cardio-facial syndrome" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7G4 CTNND2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D6R9A8 CTNND2 "Catenin delta-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPV1 ARVCF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EPC8 CTNND2 "Catenin delta-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9UQB3CTND2_HUMANNo assigned EC number0.57890.75850.1820yesN/A
O35927CTND2_MOUSENo assigned EC number0.55550.80610.1900yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-25
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-17
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 2e-09
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-09
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-08
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 4e-07
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 9e-07
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 9e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-05
pfam1364688 pfam13646, HEAT_2, HEAT repeats 4e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 6e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 0.001
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.002
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 97.4 bits (243), Expect = 2e-25
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 38  EVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNAC 97
            ++S LS+ +  ++  AA  L +L   ++ N Q     GG+P LV+LL  E  +V + A 
Sbjct: 11  ALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLLKSEDEEVVKAAL 70

Query: 98  GALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSS 150
            ALRNL+ G   ++NK  +  AGG+P L+NLL  +++ ++++  TG L NL+S
Sbjct: 71  WALRNLAAG--PEDNKLIVLEAGGVPKLVNLLD-SSNEDIQKNATGALSNLAS 120

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 294
KOG1048|consensus 717 100.0
KOG0166|consensus514 99.91
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.89
KOG4224|consensus 550 99.89
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.88
KOG4224|consensus 550 99.88
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.88
KOG2122|consensus 2195 99.86
KOG0166|consensus 514 99.81
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.76
KOG2122|consensus 2195 99.76
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.71
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.7
KOG4199|consensus461 99.58
KOG1048|consensus717 99.57
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.57
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.55
KOG4199|consensus461 99.55
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.54
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.39
KOG4500|consensus 604 99.28
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.14
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.05
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.97
KOG2160|consensus342 98.94
KOG1222|consensus 791 98.94
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 98.91
KOG2160|consensus342 98.86
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.72
KOG1293|consensus 678 98.7
KOG1293|consensus678 98.63
KOG4500|consensus 604 98.61
KOG1222|consensus 791 98.57
KOG4646|consensus173 98.56
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.51
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.48
KOG0168|consensus 1051 98.45
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.29
KOG0168|consensus 1051 98.21
KOG0946|consensus 970 98.17
KOG4646|consensus173 98.16
KOG2973|consensus 353 98.16
KOG2759|consensus442 98.12
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 98.11
PRK09687280 putative lyase; Provisional 98.05
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 98.03
PRK09687280 putative lyase; Provisional 98.03
KOG3678|consensus 832 98.02
KOG2171|consensus 1075 97.94
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.9
PF05536 543 Neurochondrin: Neurochondrin 97.8
KOG2759|consensus442 97.8
KOG0946|consensus 970 97.76
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 97.72
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.71
KOG2171|consensus 1075 97.51
KOG3678|consensus 832 97.5
COG5369743 Uncharacterized conserved protein [Function unknow 97.47
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.44
COG5369743 Uncharacterized conserved protein [Function unknow 97.43
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 97.4
PF05536 543 Neurochondrin: Neurochondrin 97.37
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 97.26
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.22
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.11
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.97
KOG2973|consensus 353 96.91
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.81
KOG2023|consensus 885 96.74
KOG2734|consensus536 96.66
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.64
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.52
PTZ00429 746 beta-adaptin; Provisional 96.36
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.31
PTZ00429 746 beta-adaptin; Provisional 96.25
KOG1517|consensus 1387 96.24
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.24
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.2
KOG2734|consensus 536 96.19
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.07
KOG4413|consensus 524 96.05
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 96.0
KOG4413|consensus 524 95.97
KOG4151|consensus748 95.96
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.92
KOG1789|consensus 2235 95.64
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.63
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.62
KOG1059|consensus 877 95.56
KOG2023|consensus 885 95.24
KOG0212|consensus 675 95.04
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 95.01
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 94.77
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.7
TIGR02270 410 conserved hypothetical protein. Members are found 94.69
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 94.56
KOG1241|consensus 859 94.49
KOG0212|consensus 675 94.44
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 94.44
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.21
KOG1789|consensus 2235 94.17
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 94.16
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.14
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.14
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.14
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.11
KOG1062|consensus 866 94.1
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.08
TIGR02270410 conserved hypothetical protein. Members are found 94.06
KOG3036|consensus293 93.78
PF08045257 CDC14: Cell division control protein 14, SIN compo 93.47
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 93.36
KOG1242|consensus569 93.15
KOG1991|consensus 1010 91.84
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 91.79
KOG2259|consensus 823 91.58
KOG2999|consensus 713 91.45
KOG1242|consensus 569 91.4
COG5096 757 Vesicle coat complex, various subunits [Intracellu 91.32
COG5096 757 Vesicle coat complex, various subunits [Intracellu 91.28
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 91.18
KOG3036|consensus293 91.06
KOG1241|consensus 859 91.0
COG1413335 FOG: HEAT repeat [Energy production and conversion 90.95
KOG1061|consensus 734 90.58
KOG2611|consensus 698 90.38
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 90.12
KOG2999|consensus 713 89.39
PF11701157 UNC45-central: Myosin-binding striated muscle asse 89.2
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 89.11
COG1413335 FOG: HEAT repeat [Energy production and conversion 88.83
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 88.82
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 88.62
KOG2025|consensus 892 87.32
KOG4151|consensus748 87.09
KOG2611|consensus 698 86.78
KOG0213|consensus1172 86.3
KOG1517|consensus 1387 86.08
KOG1062|consensus 866 85.91
KOG4464|consensus 532 85.8
PF11701157 UNC45-central: Myosin-binding striated muscle asse 85.68
KOG1077|consensus 938 84.93
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 84.64
KOG4535|consensus728 84.57
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 84.57
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 84.08
KOG3665|consensus699 83.55
KOG2676|consensus478 83.41
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 82.97
KOG1078|consensus 865 82.42
KOG1832|consensus 1516 82.31
KOG1991|consensus 1010 81.87
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 81.58
KOG4464|consensus 532 80.62
KOG4535|consensus728 80.24
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 80.21
>KOG1048|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.3e-34  Score=273.23  Aligned_cols=256  Identities=51%  Similarity=0.840  Sum_probs=234.8

Q ss_pred             ccCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhcCCcccHHHHHhcCChHHHHHhhCCCCHHHHHHHHHHHHHhhcCCCCh
Q psy15592         31 WRDPNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQND  110 (294)
Q Consensus        31 ~~~g~i~~Lv~lL~s~~~~~~~~a~~~L~nL~~~~~~~k~~i~~~g~i~~Lv~lL~s~~~~v~~~a~~aL~nLs~~~~~~  110 (294)
                      +..--++..+.+|.+.++.++.+|+..+.++||.+.+.|..+.+.|||+.||.+|.+.+.+++..||++|+||++++.++
T Consensus       230 w~d~~lpe~i~mL~~q~~~~qsnaaaylQHlcfgd~~ik~~vrqlggI~kLv~Ll~~~~~evq~~acgaLRNLvf~~~~~  309 (717)
T KOG1048|consen  230 WRDPTLPEVISMLMSQDPSVQSNAAAYLQHLCFGDNKIKSRVRQLGGIPKLVALLDHRNDEVQRQACGALRNLVFGKSTD  309 (717)
T ss_pred             ccccccHHHHHHHhccChhhhHHHHHHHHHHHhhhHHHHHHHHHhccHHHHHHHhcCCcHHHHHHHHHHHHhhhcccCCc
Confidence            56667899999999999999999999999999999999999999999999999999999999999999999999985566


Q ss_pred             hhHHHHHhcCChHHHHHHhccCCCHHHHHHHHHHHHHhcccchhhHHHHhhChHHHHHHhhccCCCCCCCCCC-ccchhh
Q psy15592        111 ENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDPVSAG-ETCWST  189 (294)
Q Consensus       111 ~~k~~i~~~g~i~~Lv~lL~~~~~~~~~~~a~~~L~nLs~~~~~r~~i~~~g~i~~L~~ll~~~s~~~~~~~~-~~~~~~  189 (294)
                      +||.+|.+.+||+.++++|+...|.++++.++++||||++++..|..|++..+-.+-..++.|++||..+... ...+.+
T Consensus       310 ~NKlai~~~~Gv~~l~~~Lr~t~D~ev~e~iTg~LWNLSS~D~lK~~ii~~al~tLt~~vI~P~Sgw~~~~~~~~~~~~~  389 (717)
T KOG1048|consen  310 SNKLAIKELNGVPTLVRLLRHTQDDEVRELITGILWNLSSNDALKMLIITSALSTLTDNVIIPHSGWEEEPAPRKAEDST  389 (717)
T ss_pred             ccchhhhhcCChHHHHHHHHhhcchHHHHHHHHHHhcccchhHHHHHHHHHHHHHHHHhhcccccccCCCCcccccccce
Confidence            7999999999999999999987799999999999999999999999999999999999999999999866443 556788


Q ss_pred             HHHhHhHHHHhhhccCHHHHHHHHhhcCcHHHHHHHHHHhHhhcCCCcchHHHHHHHHHHhccCCccccCCCCCCCCCcc
Q psy15592        190 IFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHPVVS  269 (294)
Q Consensus       190 v~~~a~~~L~nLa~~~~~~r~~~~~~~g~i~~Lv~lL~~~~~~~~~~~~~~e~a~~~L~nLs~~~~~~~~~~~~~~~~~~  269 (294)
                      +++++++||+|+++.+.+.|+.|+++.|+|+.|+.++.+..+.++.|.+.+|+|+|+|+||+|+. ++|+|+.|.+..+.
T Consensus       390 vf~n~tgcLRNlSs~~~eaR~~mr~c~GLIdaL~~~iq~~i~~~~~d~K~VENcvCilRNLSYrl-~~Evp~~~~~~~~~  468 (717)
T KOG1048|consen  390 VFRNVTGCLRNLSSAGQEAREQMRECDGLIDALLFSIQTAIQKSDLDSKSVENCVCILRNLSYRL-EAEVPPKYRQVLAN  468 (717)
T ss_pred             eeehhhhhhccccchhHHHHHHHhhccchHHHHHHHHHHHHHhccccchhHHHHHHHHhhcCchh-hhhcCHhhhhHhhc
Confidence            99999999999999888999999999999999999999999999999999999999999999999 69999999888888


Q ss_pred             cccCCCCCCC-CCCcccCC
Q psy15592        270 QSRTSPQAKG-KSNIWNRP  287 (294)
Q Consensus       270 ~~~~~~~~~~-~~~~~~~~  287 (294)
                      ..|.-...+. .+.|||.+
T Consensus       469 ~~~~~~~~~~~~~~gcf~~  487 (717)
T KOG1048|consen  469 IARLPGVGPPAESVGCFGF  487 (717)
T ss_pred             ccccccCCCcccccccccc
Confidence            8766555441 47778754

>KOG0166|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>KOG4464|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2676|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4464|consensus Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
3l6x_A 584 Crystal Structure Of P120 Catenin In Complex With E 7e-61
1xm9_A 457 Structure Of The Armadillo Repeat Domain Of Plakoph 7e-41
3tt9_A233 Crystal Structure Of The Stable Degradation Fragmen 2e-38
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 9e-09
2z6h_A 644 Crystal Structure Of Beta-Catenin Armadillo Repeat 6e-06
2z6g_A 780 Crystal Structure Of A Full-Length Zebrafish Beta-C 8e-06
2gl7_A 550 Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX 9e-06
3ouw_A 540 Structure Of Beta-Catenin With Lef-1 Length = 540 1e-05
1qz7_A 533 Beta-Catenin Binding Domain Of Axin In Complex With 1e-05
1i7x_A 538 Beta-CateninE-Cadherin Complex Length = 538 1e-05
1jpw_A 540 Crystal Structure Of A Human Tcf-4 BETA-Catenin Com 1e-05
1g3j_A 532 Crystal Structure Of The Xtcf3-CbdBETA-Catenin Arma 1e-05
1luj_A 514 Crystal Structure Of The Beta-CateninICAT COMPLEX L 1e-05
2bct_A 516 The Armadillo Repeat Region From Murine Beta-Cateni 1e-05
4djs_A 518 Structure Of Beta-Catenin In Complex With A Stapled 1e-05
1t08_A 519 Crystal Structure Of Beta-CateninICAT HELICAL Domai 1e-05
1jdh_A 529 Crystal Structure Of Beta-Catenin And Htcf-4 Length 1e-05
3tx7_A 527 Crystal Structure Of Lrh-1BETA-Catenin Complex Leng 1e-05
3t7u_A378 A New Crytal Structure Of Apc-Arm Length = 378 3e-05
3nmx_A354 Crystal Structure Of Apc Complexed With Asef Length 4e-05
3qhe_A337 Crystal Structure Of The Complex Between The Armadi 4e-05
3nmz_A458 Crytal Structure Of Apc Complexed With Asef Length 5e-05
3ifq_A 553 Interction Of Plakoglobin And Beta-Catenin With Des 1e-04
3nmw_A354 Crytal Structure Of Armadillo Repeats Domain Of Apc 3e-04
3au3_A344 Crystal Structure Of Armadillo Repeat Domain Of Apc 4e-04
2yns_A490 Rimp_alpha_b54nls Length = 490 5e-04
3sl9_A167 X-Ray Structure Of Beta Catenin In Complex With Bcl 6e-04
3sla_A168 X-Ray Structure Of First Four Repeats Of Human Beta 6e-04
4b8j_A528 Rimp_alpha1a Length = 528 6e-04
3bct_A 470 The Armadillo Repeat Region From Murine Beta-Cateni 8e-04
>pdb|3L6X|A Chain A, Crystal Structure Of P120 Catenin In Complex With E-Cadherin Length = 584 Back     alignment and structure 
Iteration: 1

 Score =  230 bits (586), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 128/299 (42%), Positives = 181/299 (60%), Gaps = 29/299 (9%)
Query: 7   FLTGSQ---EEFYSPSLNKKCRNS-----SLR--------WRDPNLTEVISFLSNPNNVI 50
           F+ G +   +++Y   L +  R S     SLR        WR P L EVI+ L    + +
Sbjct: 5   FMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPPPNWRQPELPEVIAMLGFRLDAV 64
Query: 51  KANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQND 110
           K+NAAAYLQHLCY +D  K   R L GIP LV LL H   +V   ACGAL+N+S+GR  D
Sbjct: 65  KSNAAAYLQHLCYRNDKVKTDVRKLKGIPVLVGLLDHPKKEVHLGACGALKNISFGRDQD 124
Query: 111 ENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHI 170
            NK AIKN  G+P L+ LLRK  D ++ E++TG LWNLSS + +K  I+D  L  + + +
Sbjct: 125 -NKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLSSHDSIKMEIVDHALHALTDEV 183
Query: 171 IIPHSGWDPVSAGETC------WSTIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLY 224
           IIPHSGW+     E C      W ++  NT+G LRN SS    AR+KLREC+GL+D+L++
Sbjct: 184 IIPHSGWE-REPNEDCKPRHIEWESVLTNTAGCLRNVSSERSEARRKLRECDGLVDALIF 242
Query: 225 VVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKH----PVVSQSRTSPQAKG 279
           +V++ I + +  +K VENCVC+LRNLS++    E P  +++    P V+ +  +  A+G
Sbjct: 243 IVQAEIGQKDSDSKLVENCVCLLRNLSYQVHR-EIPQAERYQEAAPNVANNTGTSPARG 300
>pdb|1XM9|A Chain A, Structure Of The Armadillo Repeat Domain Of Plakophilin 1 Length = 457 Back     alignment and structure
>pdb|3TT9|A Chain A, Crystal Structure Of The Stable Degradation Fragment Of Human Plakophilin 2 Isoform A (Pkp2a) C752r Variant Length = 233 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|2Z6H|A Chain A, Crystal Structure Of Beta-Catenin Armadillo Repeat Region And Its C-Terminal Domain Length = 644 Back     alignment and structure
>pdb|2Z6G|A Chain A, Crystal Structure Of A Full-Length Zebrafish Beta-Catenin Length = 780 Back     alignment and structure
>pdb|2GL7|A Chain A, Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX Length = 550 Back     alignment and structure
>pdb|3OUW|A Chain A, Structure Of Beta-Catenin With Lef-1 Length = 540 Back     alignment and structure
>pdb|1QZ7|A Chain A, Beta-Catenin Binding Domain Of Axin In Complex With Beta- Catenin Length = 533 Back     alignment and structure
>pdb|1I7X|A Chain A, Beta-CateninE-Cadherin Complex Length = 538 Back     alignment and structure
>pdb|1JPW|A Chain A, Crystal Structure Of A Human Tcf-4 BETA-Catenin Complex Length = 540 Back     alignment and structure
>pdb|1G3J|A Chain A, Crystal Structure Of The Xtcf3-CbdBETA-Catenin Armadillo Repeat Complex Length = 532 Back     alignment and structure
>pdb|1LUJ|A Chain A, Crystal Structure Of The Beta-CateninICAT COMPLEX Length = 514 Back     alignment and structure
>pdb|2BCT|A Chain A, The Armadillo Repeat Region From Murine Beta-Catenin Length = 516 Back     alignment and structure
>pdb|4DJS|A Chain A, Structure Of Beta-Catenin In Complex With A Stapled Peptide Inhibitor Length = 518 Back     alignment and structure
>pdb|1T08|A Chain A, Crystal Structure Of Beta-CateninICAT HELICAL DomainUNPHOSPHORYLATED APC R3 Length = 519 Back     alignment and structure
>pdb|1JDH|A Chain A, Crystal Structure Of Beta-Catenin And Htcf-4 Length = 529 Back     alignment and structure
>pdb|3TX7|A Chain A, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 527 Back     alignment and structure
>pdb|3T7U|A Chain A, A New Crytal Structure Of Apc-Arm Length = 378 Back     alignment and structure
>pdb|3NMX|A Chain A, Crystal Structure Of Apc Complexed With Asef Length = 354 Back     alignment and structure
>pdb|3QHE|A Chain A, Crystal Structure Of The Complex Between The Armadillo Repeat Domain Of Adenomatous Polyposis Coli And The Tyrosine-Rich Domain Of Sam68 Length = 337 Back     alignment and structure
>pdb|3NMZ|A Chain A, Crytal Structure Of Apc Complexed With Asef Length = 458 Back     alignment and structure
>pdb|3IFQ|A Chain A, Interction Of Plakoglobin And Beta-Catenin With Desmosomal Cadherins Length = 553 Back     alignment and structure
>pdb|3NMW|A Chain A, Crytal Structure Of Armadillo Repeats Domain Of Apc Length = 354 Back     alignment and structure
>pdb|3AU3|A Chain A, Crystal Structure Of Armadillo Repeat Domain Of Apc Length = 344 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|3SL9|A Chain A, X-Ray Structure Of Beta Catenin In Complex With Bcl9 Length = 167 Back     alignment and structure
>pdb|3SLA|A Chain A, X-Ray Structure Of First Four Repeats Of Human Beta-Catenin Length = 168 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|3BCT|A Chain A, The Armadillo Repeat Region From Murine Beta-Catenin Length = 470 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-80
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-68
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-14
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-14
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-06
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 7e-66
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-15
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-13
3nmz_A458 APC variant protein; protein-protein complex, arma 3e-48
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-23
3nmz_A 458 APC variant protein; protein-protein complex, arma 3e-22
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-19
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-48
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 2e-25
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 4e-24
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-44
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-27
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 5e-27
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-24
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-21
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-18
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-18
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-18
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-44
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-26
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-25
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-25
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-25
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-20
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-18
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 9e-44
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-26
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-25
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-24
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-22
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-20
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-19
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-17
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-12
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-31
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-23
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-05
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-29
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-26
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-22
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-20
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-20
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-20
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-18
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-17
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-17
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-14
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-20
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 5e-19
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-15
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 3e-15
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-14
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-08
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-18
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-18
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 5e-17
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 6e-15
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-13
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 2e-11
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 7e-08
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-18
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-13
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 2e-07
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-14
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-13
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-11
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 9e-10
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-08
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 7e-07
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 7e-05
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 7e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-04
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 8e-04
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 8e-04
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
 Score =  240 bits (614), Expect = 7e-80
 Identities = 90/233 (38%), Positives = 134/233 (57%), Gaps = 7/233 (3%)

Query: 28  SLRWRDPNLTEVISFLSNPNNV--IKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLL 85
           S    +  L   +S L   + +    + AA ++QH C+     +++   L GI  L++LL
Sbjct: 2   SNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLL 61

Query: 86  GHESPDVFRNACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVL 145
             ++ DV R  CGALRNL +   +++NK  +    G+P L+ +L++T D E K+ +TG+L
Sbjct: 62  KVQNEDVQRAVCGALRNLVFE--DNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITGLL 119

Query: 146 WNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGW---DPVSAGETCWSTIFRNTSGVLRNAS 202
           WNLSS + LK  +I + L  +  +IIIP SGW   D   A       IF N +G LRN S
Sbjct: 120 WNLSSNDKLKNLMITEALLTLTENIIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMS 179

Query: 203 SAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQ 255
           SAG   RK +R C+GLIDSL++ V+  I      +K+ ENCVCIL NLS++ +
Sbjct: 180 SAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLE 232
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 100.0
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.97
3nmz_A458 APC variant protein; protein-protein complex, arma 99.96
3nmz_A458 APC variant protein; protein-protein complex, arma 99.96
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.94
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.94
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.94
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.93
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.92
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.92
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.91
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.9
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.9
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.9
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.89
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.89
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.89
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.88
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.88
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.88
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.86
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.85
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.85
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.84
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.83
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 99.83
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.83
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.82
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.78
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.72
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.7
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.39
3grl_A 651 General vesicular transport factor P115; vesicle t 99.23
3grl_A 651 General vesicular transport factor P115; vesicle t 99.22
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.94
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.78
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.77
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.73
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.69
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.49
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.42
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.05
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.95
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 97.94
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.9
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 97.87
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 97.86
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.8
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.77
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.71
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.65
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.59
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.55
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.52
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.39
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.29
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.13
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 97.13
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 97.03
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.01
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 96.98
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 96.96
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 96.94
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.93
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 96.92
1qgr_A 876 Protein (importin beta subunit); transport recepto 96.91
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 96.72
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 96.71
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 96.71
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 96.46
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 96.26
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 96.12
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 95.9
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.42
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 95.24
2db0_A253 253AA long hypothetical protein; heat repeats, hel 94.78
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 94.51
2db0_A253 253AA long hypothetical protein; heat repeats, hel 94.01
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 92.5
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 92.49
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.44
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 91.54
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 90.32
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 88.92
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 88.67
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 87.94
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 87.34
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 87.28
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 86.85
2x19_B 963 Importin-13; nuclear transport, protein transport; 85.79
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 84.44
2x1g_F 971 Cadmus; transport protein, developmental protein, 83.21
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 83.2
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 83.09
2x19_B 963 Importin-13; nuclear transport, protein transport; 81.11
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 80.32
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.9e-38  Score=273.90  Aligned_cols=219  Identities=39%  Similarity=0.673  Sum_probs=194.7

Q ss_pred             CCHHHHHHhhcCCCH--HHHHHHHHHHHHhhcCCcccHHHHHhcCChHHHHHhhCCCCHHHHHHHHHHHHHhhcCCCChh
Q psy15592         34 PNLTEVISFLSNPNN--VIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDE  111 (294)
Q Consensus        34 g~i~~Lv~lL~s~~~--~~~~~a~~~L~nL~~~~~~~k~~i~~~g~i~~Lv~lL~s~~~~v~~~a~~aL~nLs~~~~~~~  111 (294)
                      -.++.||++|+++++  .++..|+++|.++++.++++|..|++.||||+|+++|++++++++..|+++|+||+++  +++
T Consensus         8 ~~i~~lV~lL~s~~~~~~~q~~Aa~~l~~L~~~~~~~r~~I~~~G~Ip~LV~lL~s~~~~vq~~Aa~aL~nLa~~--~~~   85 (233)
T 3tt9_A            8 MTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFE--DND   85 (233)
T ss_dssp             CCHHHHHHTCCSSCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHTTHHHHHHHGGGCCCHHHHHHHHHHHHHHHTT--CHH
T ss_pred             ccHHHHHHHhCCCCchHHHHHHHHHHHHHHHcCCcHHHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHhC--CHH
Confidence            458999999999988  8899999999999988889999999999999999999999999999999999999985  799


Q ss_pred             hHHHHHhcCChHHHHHHhccCCCHHHHHHHHHHHHHhcccchhhHHHHhhChHHHHHHhh-ccCCCCCCC---CCCccch
Q psy15592        112 NKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHII-IPHSGWDPV---SAGETCW  187 (294)
Q Consensus       112 ~k~~i~~~g~i~~Lv~lL~~~~~~~~~~~a~~~L~nLs~~~~~r~~i~~~g~i~~L~~ll-~~~s~~~~~---~~~~~~~  187 (294)
                      +|..|++.|+||+|+++|+++.+.+++++++++|||||..+++|..|++.| ++.|+.++ .|++|+...   ......+
T Consensus        86 nk~~I~~~GaI~~Lv~lL~~~~~~~~~e~a~~aL~nLS~~~~~k~~i~~~~-i~~Lv~ll~~p~sG~~~~~~~~~~~~~~  164 (233)
T 3tt9_A           86 NKLEVAELNGVPRLLQVLKQTRDLETKKQITGLLWNLSSNDKLKNLMITEA-LLTLTENIIIPFSGWPEGDYPKANGLLD  164 (233)
T ss_dssp             HHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTSGGGHHHHHHHH-HHHHCCCCCHHHHCCCGGGCCCCCTTCC
T ss_pred             HHHHHHHcCCHHHHHHHHccCCCHHHHHHHHHHHHHHHcChhhHHHHHhcc-HHHHHHHHhccccCCcccccccccccch
Confidence            999999999999999999864689999999999999999999999999865 55555544 466676421   1112346


Q ss_pred             hhHHHhHhHHHHhhhccCHHHHHHHHhhcCcHHHHHHHHHHhHhhcCCCcchHHHHHHHHHHhccCCc
Q psy15592        188 STIFRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQ  255 (294)
Q Consensus       188 ~~v~~~a~~~L~nLa~~~~~~r~~~~~~~g~i~~Lv~lL~~~~~~~~~~~~~~e~a~~~L~nLs~~~~  255 (294)
                      ..++++|++||+||++.++++|+.|++++|+|+.|+++++...++++++.+.+|+|+|+|+|||||.+
T Consensus       165 ~~v~~na~~~L~nLss~~~~~R~~~r~~~Gli~~Lv~~l~~~~~~~~~~~k~~En~v~~L~nLs~~~~  232 (233)
T 3tt9_A          165 FDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLE  232 (233)
T ss_dssp             HHHHHHHHHHHHHHTTSCHHHHHHHHTSTTHHHHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHCCCCC
T ss_pred             HHHHHHHHHHHHHHhcCCHHHHHHHHHCCCcHHHHHHHHHhhhhcccchhHHHHHHHHHHHHHHhhhc
Confidence            78999999999999998888999999988999999999999988889999999999999999999984
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 294
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-42
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-14
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-07
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-18
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-16
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-15
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 2e-13
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-08
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-12
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 8e-10
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-08
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-06
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 0.003
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-11
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 2e-05
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-04
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 2e-04
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  148 bits (374), Expect = 3e-42
 Identities = 90/245 (36%), Positives = 143/245 (58%), Gaps = 6/245 (2%)

Query: 36  LTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRN 95
           + + + +LS+ +   +A  A Y+QH C+ D+  KQ+   LGGI  LV LL   + +V + 
Sbjct: 4   IPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQA 63

Query: 96  ACGALRNLSYGRQNDENKRAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLK 155
           A GALRNL +   +  NK   +   GI   ++LLR+T +AE+++ +TG+LWNLSS ++LK
Sbjct: 64  AAGALRNLVFR--STTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELK 121

Query: 156 KSIIDDGLQVVVNHIIIPHSGWDP---VSAGETCWSTIFRNTSGVLRNASSAGEYARKKL 212
           + +I D L V+ + +IIP SGW       + E     +F N +G LRN SSA    R+ +
Sbjct: 122 EELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADA-GRQTM 180

Query: 213 RECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRCQEVEDPNYDKHPVVSQSR 272
           R   GLIDSL+  V++ +  S   +KSVENC+C+L NLS+R        Y +    +++ 
Sbjct: 181 RNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNA 240

Query: 273 TSPQA 277
            + ++
Sbjct: 241 YTEKS 245
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.83
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.82
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.8
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.8
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.79
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.78
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.72
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.59
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.52
d1b3ua_588 Constant regulatory domain of protein phosphatase 97.45
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.41
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.32
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.31
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.24
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.21
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.04
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 96.34
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 96.27
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 96.16
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.84
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 95.53
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 95.38
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 95.24
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 94.3
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 94.25
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 91.57
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 87.23
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 85.9
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 85.61
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 83.17
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.89  E-value=4.3e-22  Score=179.93  Aligned_cols=218  Identities=41%  Similarity=0.694  Sum_probs=182.4

Q ss_pred             CCHHHHHHhhcCCCHHHHHHHHHHHHHhhcCCcccHHHHHhcCChHHHHHhhCCCCHHHHHHHHHHHHHhhcCCCChhhH
Q psy15592         34 PNLTEVISFLSNPNNVIKANAAAYLQHLCYMDDPNKQKTRSLGGIPPLVKLLGHESPDVFRNACGALRNLSYGRQNDENK  113 (294)
Q Consensus        34 g~i~~Lv~lL~s~~~~~~~~a~~~L~nL~~~~~~~k~~i~~~g~i~~Lv~lL~s~~~~v~~~a~~aL~nLs~~~~~~~~k  113 (294)
                      +.||.||++|++++++++..|+.+|.|+|+.++++|..+.+.||||+|+++|++++++++..|+++|+||+.+  ++.++
T Consensus         2 ~~ip~lv~~L~~~~~~~~~~a~~~l~~l~~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~--~~~~~   79 (457)
T d1xm9a1           2 LTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFR--STTNK   79 (457)
T ss_dssp             CCHHHHHHHHHSSCTHHHHHHHHHHHHHTSSCSSHHHHHHHTTHHHHHHHHTTSSCHHHHHHHHHHHHHHHSS--CHHHH
T ss_pred             CCHHHHHHHhCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCcHHHHHHHHCCCCHHHHHHHHHHHHHHHcC--CHHHH
Confidence            4589999999999999999999999999998899999999999999999999999999999999999999974  89999


Q ss_pred             HHHHhcCChHHHHHHhccCCCHHHHHHHHHHHHHhcccchhhHHHHhhChHHHHHHhhccCCCCCC---CCCCccchhhH
Q psy15592        114 RAIKNAGGIPLLINLLRKTADAEVKELVTGVLWNLSSCEDLKKSIIDDGLQVVVNHIIIPHSGWDP---VSAGETCWSTI  190 (294)
Q Consensus       114 ~~i~~~g~i~~Lv~lL~~~~~~~~~~~a~~~L~nLs~~~~~r~~i~~~g~i~~L~~ll~~~s~~~~---~~~~~~~~~~v  190 (294)
                      ..+.+.|+++.|+.++....+..++..++++|++++..+..+......|+++++..++.++.+...   .......+..+
T Consensus        80 ~~i~~~g~v~~li~~l~~~~~~~~~~~a~~~l~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~v  159 (457)
T d1xm9a1          80 LETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEV  159 (457)
T ss_dssp             HHHHHTTCHHHHHHHHTTCCCHHHHHHHHHHHHHHHTSSSTHHHHHHHHHHHHHHHTTHHHHTCC---------CCCHHH
T ss_pred             HHHHHCCChHHHHHHHhccCcHHHHHHHHHHHHHHHhhhhhHHHHHhcccHHHHHHHHhhhhhhhcchhhhhcccccHHH
Confidence            999999999999999987778999999999999999998888888888888777776654333211   11123345778


Q ss_pred             HHhHhHHHHhhhccCHHHHHHHHhhcCcHHHHHHHHHHhHhhcCCCcchHHHHHHHHHHhccCC
Q psy15592        191 FRNTSGVLRNASSAGEYARKKLRECEGLIDSLLYVVKSAIEKSNIGNKSVENCVCILRNLSFRC  254 (294)
Q Consensus       191 ~~~a~~~L~nLa~~~~~~r~~~~~~~g~i~~Lv~lL~~~~~~~~~~~~~~e~a~~~L~nLs~~~  254 (294)
                      .+.++++|++++..++ ++..+....|+++.|+.++.+..............+...+.+.....
T Consensus       160 ~~~a~~~l~~~~~~~~-~~~~~~~~~~~i~~l~~ll~~~~~~~~~~~~~~~~~~~~l~~~~~~~  222 (457)
T d1xm9a1         160 FFNATGCLRNLSSADA-GRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRL  222 (457)
T ss_dssp             HHHHHHHHHHHTTSHH-HHHHHTTSTTHHHHHHHHHHHHHHHTCTTCTTHHHHHHHHHHHTTTH
T ss_pred             HHHHHHHHHHHhcCch-HHHHHHHHhccHHHHHHHHhcchhhhhhHHHHHHHHHHHHhhhhhhh
Confidence            9999999999998775 66666655799999999998877666666677777777777655443
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure