Psyllid ID: psy1565

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MLAHPAWGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHLKDSQL
cccccccccccHHHHcHHHHHcccccHHHHHHHHHcccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccc
cccccccccccHHHHcccEEEccHHcHHcHHHHHHccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHcccccc
mlahpawglptfagtFHHAIISvgrsdrvtegetkegvtegktkegvtegktiydepgynlskhfpdcftyidhchndqstvyvhcnagisRSATIVIAYIMKHMGLDLAQAHDLVkkvrpcikpnpgfLRQLKEWEQkhlkdsql
MLAHPAWGLPTFAGTFHHAIISvgrsdrvtegetkegvtegktkegvtegktiydepgyNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKeweqkhlkdsql
MLAHPAWGLPTFAGTFHHAIISVGRSDRvtegetkegvtegktkegvtegktIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHLKDSQL
*****AWGLPTFAGTFHHAIISVG**************************KTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQL*************
**A*PA*GLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHL*****
MLAHPAWGLPTFAGTFHHAIISVGRS********************VTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEW**********
***HPAWGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHLK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAHPAWGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHLKDSQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
Q8K4T5220 Dual specificity protein yes N/A 0.691 0.459 0.396 3e-17
Q8WTR2217 Dual specificity protein yes N/A 0.595 0.400 0.413 7e-17
Q54R42230 Probable dual specificity yes N/A 0.609 0.386 0.417 7e-17
Q54T76 394 Probable dual specificity no N/A 0.575 0.213 0.482 1e-16
Q6NN85 1045 Protein phosphatase Sling yes N/A 0.575 0.080 0.476 3e-16
Q54Y32856 MAP kinase phosphatase wi no N/A 0.575 0.098 0.470 4e-16
Q9ZR37198 Dual specificity protein yes N/A 0.589 0.434 0.453 4e-16
Q5SW75 1423 Protein phosphatase Sling no N/A 0.582 0.059 0.435 2e-15
Q76I76 1423 Protein phosphatase Sling no N/A 0.582 0.059 0.435 2e-15
Q4V7N3223 Serine/threonine/tyrosine N/A N/A 0.609 0.399 0.449 4e-15
>sp|Q8K4T5|DUS19_MOUSE Dual specificity protein phosphatase 19 OS=Mus musculus GN=Dusp19 PE=2 SV=1 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 56/101 (55%)

Query: 37  GVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATI 96
           GV      E   +  +I D P  N+  +FP+CF +I+        V VHCNAG+SR+A I
Sbjct: 100 GVENAFLSEFTYKTISILDVPETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAI 159

Query: 97  VIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWE 137
           VI ++M         A  LVK+ RP I PNPGF+ QL+ ++
Sbjct: 160 VIGFLMSSEEATFTTALSLVKEARPSICPNPGFMEQLRTYQ 200
Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q8WTR2|DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens GN=DUSP19 PE=1 SV=1 Back     alignment and function description
>sp|Q54R42|DUSP2_DICDI Probable dual specificity protein phosphatase DDB_G0283417 OS=Dictyostelium discoideum GN=DDB_G0283417 PE=3 SV=1 Back     alignment and function description
>sp|Q54T76|DUSP4_DICDI Probable dual specificity protein phosphatase DDB_G0281963 OS=Dictyostelium discoideum GN=DDB_G0281963 PE=3 SV=1 Back     alignment and function description
>sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 Back     alignment and function description
>sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 Back     alignment and function description
>sp|Q9ZR37|DUS1_ARATH Dual specificity protein phosphatase 1 OS=Arabidopsis thaliana GN=DSPTP1 PE=1 SV=1 Back     alignment and function description
>sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 Back     alignment and function description
>sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 Back     alignment and function description
>sp|Q4V7N3|STYXA_XENLA Serine/threonine/tyrosine-interacting protein A OS=Xenopus laevis GN=styx-a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
281201889207 putative protein tyrosine phosphatase [P 0.589 0.415 0.511 2e-19
118093238213 PREDICTED: dual specificity protein phos 0.726 0.497 0.405 1e-18
327278424216 PREDICTED: dual specificity protein phos 0.589 0.398 0.476 6e-18
440293925194 dual specificity protein phosphatase, pu 0.527 0.396 0.532 9e-18
326922439124 PREDICTED: dual specificity protein phos 0.726 0.854 0.386 3e-17
158292077 374 AGAP004353-PA [Anopheles gambiae str. PE 0.630 0.245 0.478 4e-17
145490899 257 hypothetical protein [Paramecium tetraur 0.541 0.307 0.537 6e-17
67483608199 dual specificity protein phosphatase [En 0.609 0.447 0.460 6e-17
224055986214 PREDICTED: dual specificity protein phos 0.726 0.495 0.377 7e-17
443685940202 hypothetical protein CAPTEDRAFT_93388 [C 0.595 0.430 0.477 8e-17
>gi|281201889|gb|EFA76097.1| putative protein tyrosine phosphatase [Polysphondylium pallidum PN500] Back     alignment and taxonomy information
 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 61/86 (70%)

Query: 53  IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
           IYD+  YN+  HF + F ++D   ++Q ++ +HCNAGISRS+TI+IAY+MK   L L  A
Sbjct: 122 IYDDVDYNIYDHFSEAFQFLDLAISEQRSILIHCNAGISRSSTILIAYLMKRHHLTLEHA 181

Query: 113 HDLVKKVRPCIKPNPGFLRQLKEWEQ 138
           + +VKK RP IKPN GF  QLK +E+
Sbjct: 182 YSIVKKARPLIKPNQGFYNQLKNYEK 207

Source: Polysphondylium pallidum PN500

Species: Polysphondylium pallidum

Genus: Polysphondylium

Family:

Order: Dictyosteliida

Class:

Phylum:

Superkingdom: Eukaryota
>gi|118093238|ref|XP_421855.2| PREDICTED: dual specificity protein phosphatase 19 [Gallus gallus] Back     alignment and taxonomy information
>gi|327278424|ref|XP_003223962.1| PREDICTED: dual specificity protein phosphatase 19-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|440293925|gb|ELP86972.1| dual specificity protein phosphatase, putative, partial [Entamoeba invadens IP1] Back     alignment and taxonomy information
>gi|326922439|ref|XP_003207456.1| PREDICTED: dual specificity protein phosphatase 19-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|158292077|ref|XP_001688457.1| AGAP004353-PA [Anopheles gambiae str. PEST] gi|157017262|gb|EDO64139.1| AGAP004353-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|145490899|ref|XP_001431449.1| hypothetical protein [Paramecium tetraurelia strain d4-2] gi|124398554|emb|CAK64051.1| unnamed protein product [Paramecium tetraurelia] Back     alignment and taxonomy information
>gi|67483608|ref|XP_657024.1| dual specificity protein phosphatase [Entamoeba histolytica HM-1:IMSS] gi|56474262|gb|EAL51641.1| dual specificity protein phosphatase, putative [Entamoeba histolytica HM-1:IMSS] gi|449706576|gb|EMD46395.1| dual specificity protein phosphatase, putative [Entamoeba histolytica KU27] Back     alignment and taxonomy information
>gi|224055986|ref|XP_002196677.1| PREDICTED: dual specificity protein phosphatase 19 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|443685940|gb|ELT89386.1| hypothetical protein CAPTEDRAFT_93388 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
UNIPROTKB|F1NG52207 DUSP19 "Uncharacterized protei 0.616 0.434 0.444 1.4e-18
UNIPROTKB|Q5VNG7199 OJ1460_H08.5 "Uncharacterized 0.589 0.432 0.441 1.8e-16
UNIPROTKB|E2RKL4227 DUSP19 "Uncharacterized protei 0.589 0.378 0.441 2.9e-16
ZFIN|ZDB-GENE-040502-1205 zgc:76883 "zgc:76883" [Danio r 0.561 0.4 0.426 2.9e-16
DICTYBASE|DDB_G0281963 394 DDB_G0281963 "putative protein 0.575 0.213 0.482 6.2e-16
DICTYBASE|DDB_G0283417230 DDB_G0283417 "putative protein 0.609 0.386 0.417 9.8e-16
MGI|MGI:1915332220 Dusp19 "dual specificity phosp 0.582 0.386 0.435 9.8e-16
FB|FBgn0039742212 CG15528 [Drosophila melanogast 0.582 0.400 0.4 1.3e-15
UNIPROTKB|A6H7A7227 DUSP19 "Uncharacterized protei 0.582 0.374 0.423 1.3e-15
UNIPROTKB|Q8WTR2217 DUSP19 "Dual specificity prote 0.589 0.396 0.418 1.3e-15
UNIPROTKB|F1NG52 DUSP19 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 224 (83.9 bits), Expect = 1.4e-18, P = 1.4e-18
 Identities = 40/90 (44%), Positives = 59/90 (65%)

Query:    53 IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
             I D P  +++ +FP+CF +I+        V VHCNAG+SR+A IVI ++M   GL  A A
Sbjct:   109 ILDLPETDITSYFPECFEFIEKAKIQDGVVLVHCNAGVSRAAAIVIGFLMNSEGLSFASA 168

Query:   113 HDLVKKVRPCIKPNPGFLRQLKEWEQKHLK 142
               LVK  RP I PNPGF+ QL +++++++K
Sbjct:   169 FSLVKSARPSICPNPGFMEQLHKYQEQNIK 198
GO:0000188 "inactivation of MAPK activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006470 "protein dephosphorylation" evidence=IEA
GO:0007254 "JNK cascade" evidence=IEA
GO:0008330 "protein tyrosine/threonine phosphatase activity" evidence=IEA
GO:0008579 "JUN kinase phosphatase activity" evidence=IEA
UNIPROTKB|Q5VNG7 OJ1460_H08.5 "Uncharacterized protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKL4 DUSP19 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040502-1 zgc:76883 "zgc:76883" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281963 DDB_G0281963 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283417 DDB_G0283417 "putative protein tyrosine phosphatase, dual specificity" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1915332 Dusp19 "dual specificity phosphatase 19" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0039742 CG15528 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7A7 DUSP19 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WTR2 DUSP19 "Dual specificity protein phosphatase 19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.737
3rd Layer3.1.30.691
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 1e-43
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 2e-34
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 5e-33
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 2e-11
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 1e-04
COG5350172 COG5350, COG5350, Predicted protein tyrosine phosp 4e-04
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 0.001
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 0.001
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 0.001
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 0.002
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 0.004
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information 
 Score =  140 bits (354), Expect = 1e-43
 Identities = 44/85 (51%), Positives = 58/85 (68%)

Query: 53  IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
           I D P  ++SK+F +   +ID        V VHC AG+SRSAT+VIAY+MK +GL L +A
Sbjct: 55  ILDLPSQDISKYFDEAVDFIDDAREKGGKVLVHCLAGVSRSATLVIAYLMKTLGLSLREA 114

Query: 113 HDLVKKVRPCIKPNPGFLRQLKEWE 137
           ++ VK  RP I PN GF+RQLKE+E
Sbjct: 115 YEFVKSRRPIISPNAGFMRQLKEYE 139

Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 99.96
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 99.96
KOG1718|consensus198 99.96
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.95
KOG1716|consensus285 99.94
PTZ00393241 protein tyrosine phosphatase; Provisional 99.93
PTZ00242166 protein tyrosine phosphatase; Provisional 99.93
KOG1717|consensus343 99.91
KOG1719|consensus183 99.9
PRK12361 547 hypothetical protein; Provisional 99.9
KOG1720|consensus225 99.86
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.81
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.71
KOG2836|consensus173 99.6
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.54
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.54
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.43
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.41
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.36
PHA02742303 protein tyrosine phosphatase; Provisional 99.29
PHA02740298 protein tyrosine phosphatase; Provisional 99.29
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.27
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.26
PHA02746323 protein tyrosine phosphatase; Provisional 99.23
PHA02747312 protein tyrosine phosphatase; Provisional 99.18
PHA02738320 hypothetical protein; Provisional 99.16
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.14
KOG0792|consensus1144 99.1
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.96
PLN02727 986 NAD kinase 98.95
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 98.95
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 98.94
COG5350172 Predicted protein tyrosine phosphatase [General fu 98.93
KOG0791|consensus374 98.72
KOG0790|consensus600 98.68
KOG2283|consensus 434 98.58
KOG0793|consensus1004 98.5
KOG2386|consensus 393 98.43
KOG0789|consensus415 98.43
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 98.43
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.28
KOG4228|consensus 1087 98.27
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.27
KOG1572|consensus249 98.25
KOG4228|consensus1087 98.13
COG3453130 Uncharacterized protein conserved in bacteria [Fun 97.58
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 97.06
KOG4471|consensus 717 96.96
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 94.93
KOG1089|consensus 573 94.79
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 86.19
PLN02160136 thiosulfate sulfurtransferase 85.97
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 84.53
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 83.89
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 80.05
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information 
Probab=99.96  E-value=1.9e-28  Score=169.52  Aligned_cols=132  Identities=34%  Similarity=0.478  Sum_probs=115.0

Q ss_pred             CCCCcccchhhhHHHHHHhccccccccCcccCCCCCCCCCCeEEEEEEecCCCCCCccccHHHHHHHHHHHhhCCCcEEE
Q psy1565           5 PAWGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYV   84 (146)
Q Consensus         5 ~~w~~~~l~~~~i~~l~~~g~~~~~~~~~~~~~~~~~~~~~i~~~~~p~~D~~~~~~~~~~~~~~~~i~~~~~~g~~vlV   84 (146)
                      +.|-...........+...|++++++.....+.   ....+++|+++|+.|....++.+.+.++++||+.....|++|||
T Consensus         7 ~l~~G~~~~~~~~~~l~~~gi~~Vi~l~~~~~~---~~~~~~~~~~ipi~D~~~~~~~~~~~~~~~~i~~~~~~~~~VlV   83 (138)
T smart00195        7 HLYLGSYSSALNLALLKKLGITHVINVTNEVPN---LNKKGFTYLGVPILDNTETKISPYFPEAVEFIEDAEKKGGKVLV   83 (138)
T ss_pred             CeEECChhHcCCHHHHHHcCCCEEEEccCCCCC---CCCCCCEEEEEECCCCCCCChHHHHHHHHHHHHHHhcCCCeEEE
Confidence            345455555556777888888888888765543   34688999999999977777778899999999999999999999


Q ss_pred             EcCCCCchhHHHHHHHHHHHcCCCHHHHHHHHHhHCCCCCCCHHHHHHHHHHHHH
Q psy1565          85 HCNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQK  139 (146)
Q Consensus        85 HC~~G~~RS~~~~~aylm~~~~~~~~~a~~~vr~~rp~~~p~~~~~~~L~~~~~~  139 (146)
                      ||.+|.|||++++++|+|...|+++++|+++++++||.+.||++|.++|.+||++
T Consensus        84 HC~~G~~RS~~v~~~yl~~~~~~~~~~A~~~v~~~R~~~~p~~~~~~qL~~~e~~  138 (138)
T smart00195       84 HCQAGVSRSATLIIAYLMKYRNLSLNDAYDFVKDRRPIISPNFGFLRQLIEYERK  138 (138)
T ss_pred             ECCCCCchHHHHHHHHHHHHhCCCHHHHHHHHHHHCCccCCCHhHHHHHHHHhhC
Confidence            9999999999999999999999999999999999999999999999999999973

>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1089|consensus Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 7e-17
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 1e-15
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 6e-15
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 6e-15
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 2e-14
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 3e-14
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 5e-14
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 9e-14
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 1e-12
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 1e-12
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 2e-12
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 3e-12
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 4e-12
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 4e-12
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 5e-12
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 2e-11
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 3e-11
2j16_B182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 8e-11
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 1e-10
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 2e-10
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 3e-10
2j17_A182 Ptyr Bound Form Of Sdp-1 Length = 182 8e-10
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 1e-09
2j16_A182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 1e-09
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 2e-09
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 2e-09
2gwo_A198 Crystal Structure Of Tmdp Length = 198 5e-09
3emu_A161 Crystal Structure Of A Leucine Rich Repeat And Phos 5e-07
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 6e-07
2rf6_A176 Crystal Structure Of The Vaccinia Virus Dual-Specif 2e-06
2q05_A195 Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO 4e-06
1ohe_A348 Structure Of Cdc14b Phosphatase With A Peptide Liga 8e-06
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 2e-05
2p4d_A172 Structure-Assisted Discovery Of Variola Major H1 Ph 3e-05
3rgq_A156 Crystal Structure Of Ptpmt1 In Complex With Pi(5)p 2e-04
2i6i_A161 Crystal Structures Of The Archaeal Sulfolobus Ptp-F 3e-04
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 49/86 (56%)
Query: 53  IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
           I D P  N+  +FP+CF +I+        V VH NAG+SR+A IVI ++M         A
Sbjct: 55  ILDLPETNILSYFPECFEFIEEAKRKDGVVLVHSNAGVSRAAAIVIGFLMNSEQTSFTSA 114
Query: 113 HDLVKKVRPCIKPNPGFLRQLKEWEQ 138
             LVK  RP I PN GF+ QL+ +++
Sbjct: 115 FSLVKNARPSICPNSGFMEQLRTYQE 140
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
>pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>pdb|3EMU|A Chain A, Crystal Structure Of A Leucine Rich Repeat And Phosphatase Domain Containing Protein From Entamoeba Histolytica Length = 161 Back     alignment and structure
>pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
>pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 Back     alignment and structure
>pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 Back     alignment and structure
>pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 Back     alignment and structure
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure
>pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 Back     alignment and structure
>pdb|3RGQ|A Chain A, Crystal Structure Of Ptpmt1 In Complex With Pi(5)p Length = 156 Back     alignment and structure
>pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 2e-48
2hxp_A155 Dual specificity protein phosphatase 9; human phos 3e-48
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 3e-48
2hcm_A164 Dual specificity protein phosphatase; structural g 6e-48
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 1e-47
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 2e-47
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 2e-47
3emu_A161 Leucine rich repeat and phosphatase domain contain 2e-47
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 3e-47
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 3e-47
2oud_A177 Dual specificity protein phosphatase 10; A central 5e-47
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 6e-47
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 7e-47
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 2e-46
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 5e-44
2q05_A195 Late protein H1, dual specificity protein phosphat 3e-43
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 4e-43
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 5e-43
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 6e-43
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 7e-43
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 8e-43
3cm3_A176 Late protein H1, dual specificity protein phosphat 1e-41
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 4e-20
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 6e-20
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-14
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 1e-13
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 3e-11
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 9e-10
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 3e-08
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 1e-07
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 2e-07
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 4e-07
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 7e-05
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 3e-04
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
 Score =  151 bits (385), Expect = 2e-48
 Identities = 35/87 (40%), Positives = 49/87 (56%)

Query: 53  IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
           I D P  N+  +FP+CF +I+        V VH NAG+SR+A IVI ++M         A
Sbjct: 55  ILDLPETNILSYFPECFEFIEEAKRKDGVVLVHSNAGVSRAAAIVIGFLMNSEQTSFTSA 114

Query: 113 HDLVKKVRPCIKPNPGFLRQLKEWEQK 139
             LVK  RP I PN GF+ QL+ +++ 
Sbjct: 115 FSLVKNARPSICPNSGFMEQLRTYQEG 141
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Length = 339 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
3emu_A161 Leucine rich repeat and phosphatase domain contain 99.97
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 99.97
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 99.97
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 99.97
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 99.97
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 99.97
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 99.96
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 99.96
2hcm_A164 Dual specificity protein phosphatase; structural g 99.96
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 99.96
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 99.96
2hxp_A155 Dual specificity protein phosphatase 9; human phos 99.96
2oud_A177 Dual specificity protein phosphatase 10; A central 99.96
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 99.96
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 99.96
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 99.96
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 99.96
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.96
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.95
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.95
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.94
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.94
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.93
2q05_A195 Late protein H1, dual specificity protein phosphat 99.92
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.9
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.89
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.89
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.88
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.88
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.88
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.87
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.86
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.84
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.72
1xri_A151 AT1G05000; structural genomics, protein structure 99.72
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.6
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.6
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.49
2f46_A156 Hypothetical protein; structural genomics, joint c 99.48
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.47
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.46
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.43
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.43
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.42
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.42
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.42
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.41
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.41
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.41
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.41
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.41
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.41
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.4
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.4
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.39
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.39
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.39
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.39
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.39
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.39
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.36
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.36
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.36
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.35
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.35
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.34
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.32
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.3
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.29
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.27
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.27
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.25
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.23
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.23
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.21
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.19
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.19
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.18
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.17
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 99.15
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 99.13
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.12
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 99.11
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 97.75
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 95.56
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 95.2
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 94.77
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 87.2
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 87.16
1tq1_A129 AT5G66040, senescence-associated family protein; C 84.47
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 84.33
1vee_A134 Proline-rich protein family; hypothetical protein, 84.17
1d0q_A103 DNA primase; zinc-binding motif, protein, transfer 80.37
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=99.97  E-value=1.6e-31  Score=188.67  Aligned_cols=137  Identities=21%  Similarity=0.217  Sum_probs=117.9

Q ss_pred             CCCcccchhhhHHHHHHhccccccccCcccCCCCCCCCCCeEEEEEEecCCCCCCccccHHHHHHHHHHHhhCCCcEEEE
Q psy1565           6 AWGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVH   85 (146)
Q Consensus         6 ~w~~~~l~~~~i~~l~~~g~~~~~~~~~~~~~~~~~~~~~i~~~~~p~~D~~~~~~~~~~~~~~~~i~~~~~~g~~vlVH   85 (146)
                      .|-...........|...|++++++......   .....+++|+++|+.|.+.+++.+.|+++++||++++..|++||||
T Consensus        17 LylG~~~~a~~~~~L~~~gIt~Vlnl~~~~~---~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~VlVH   93 (161)
T 3emu_A           17 IHLGSFLNAHNVDYIHNNNISSILLVGIEVP---SLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGVLII   93 (161)
T ss_dssp             EEEEETTGGGCHHHHHHTTEEEEEEEC----------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEEEEE
T ss_pred             EEECChHHhhCHHHHHHCCCCEEEEeCCCCc---cccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeEEEE
Confidence            4444445556777788899999998875432   3345689999999999998888888999999999999999999999


Q ss_pred             cCCCCchhHHHHHHHHHHHcCCCHHHHHHHHHhHCCCCCCCHHHHHHHHHHHHHhcCCCC
Q psy1565          86 CNAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKHLKDSQ  145 (146)
Q Consensus        86 C~~G~~RS~~~~~aylm~~~~~~~~~a~~~vr~~rp~~~p~~~~~~~L~~~~~~l~~~~~  145 (146)
                      |.+|+|||+++++||||...|+++++|+++|+++||.+.||++|++||.+||+.|.+++.
T Consensus        94 C~~G~sRS~~vv~ayLm~~~~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~~  153 (161)
T 3emu_A           94 SGTGVNKAPAIVIAFLMYYQRLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMNS  153 (161)
T ss_dssp             ESSSSSHHHHHHHHHHHHHTTCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHTC
T ss_pred             cCCCCcHHHHHHHHHHHHHhCCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCCC
Confidence            999999999999999999999999999999999999999999999999999999987653
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 7e-28
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 1e-26
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 2e-26
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 7e-19
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 8e-16
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-09
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 3e-09
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 2e-07
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

 Score = 98.7 bits (245), Expect = 7e-28
 Identities = 34/87 (39%), Positives = 51/87 (58%)

Query: 53  IYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHCNAGISRSATIVIAYIMKHMGLDLAQA 112
           I D    NLS+ FP+  ++ID        V VH  AGISRS T+ +AY+M+ + L +  A
Sbjct: 57  ISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHSLAGISRSVTVTVAYLMQKLNLSMNDA 116

Query: 113 HDLVKKVRPCIKPNPGFLRQLKEWEQK 139
           +D+VK  +  I PN  F+ QL ++E+ 
Sbjct: 117 YDIVKMKKSNISPNFNFMGQLLDFERT 143
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 99.97
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 99.97
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 99.97
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.92
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.91
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.87
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.86
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.73
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.55
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.36
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.29
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.28
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.28
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.25
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.21
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.2
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.2
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.18
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.18
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.16
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.13
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.81
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 97.33
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 95.42
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 92.1
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 83.25
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 82.14
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]

Probab=99.97  E-value=1.1e-30  Score=179.40  Aligned_cols=133  Identities=28%  Similarity=0.349  Sum_probs=115.0

Q ss_pred             CCcccchhhhHHHHHHhccccccccCcccCCCCCCCCCCeEEEEEEecCCCCCCccccHHHHHHHHHHHhhCCCcEEEEc
Q psy1565           7 WGLPTFAGTFHHAIISVGRSDRVTEGETKEGVTEGKTKEGVTEGKTIYDEPGYNLSKHFPDCFTYIDHCHNDQSTVYVHC   86 (146)
Q Consensus         7 w~~~~l~~~~i~~l~~~g~~~~~~~~~~~~~~~~~~~~~i~~~~~p~~D~~~~~~~~~~~~~~~~i~~~~~~g~~vlVHC   86 (146)
                      |-.....+.....|...|++++++....... ......++.|+++|+.|.+.+++.+.|+++.+||+.+.++|++|||||
T Consensus        12 ylG~~~~a~~~~~l~~~gI~~Iin~~~~~~~-~~~~~~~~~y~~~~~~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC   90 (144)
T d1mkpa_          12 YLGCAKDSTNLDVLEEFGIKYILNVTPNLPN-LFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHS   90 (144)
T ss_dssp             EEECTTSCCCHHHHHHTTEEEEEECCSSCCC-EEEEETTEEEEECCCCCSTTCCSGGGHHHHHHHHHHHHHTTCEEEEEC
T ss_pred             EECChhHhcCHHHHHhCCCcEEEEccccCCc-cccCCCceEEEEEEEecCCCCCHHHHHHHHHHHHHHhhhccceEEEEe
Confidence            3333344556677788899998887544322 224467899999999999988899999999999999999999999999


Q ss_pred             CCCCchhHHHHHHHHHHHcCCCHHHHHHHHHhHCCCCCCCHHHHHHHHHHHHHh
Q psy1565          87 NAGISRSATIVIAYIMKHMGLDLAQAHDLVKKVRPCIKPNPGFLRQLKEWEQKH  140 (146)
Q Consensus        87 ~~G~~RS~~~~~aylm~~~~~~~~~a~~~vr~~rp~~~p~~~~~~~L~~~~~~l  140 (146)
                      .+|+|||++++++|||...++++.+|+++|+++||.+.||.+|.+||.+||+.|
T Consensus        91 ~~G~~RS~~vv~aYLm~~~~~~~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L  144 (144)
T d1mkpa_          91 LAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTL  144 (144)
T ss_dssp             SSCSHHHHHHHHHHHHHHHTCCHHHHHHHHHHHCTTCCCCSTTHHHHHHHHHTC
T ss_pred             cccccchHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHhhC
Confidence            999999999999999999999999999999999999999999999999999865
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure