Psyllid ID: psy15726
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| 383862911 | 2958 | PREDICTED: filamin-B-like [Megachile rot | 0.771 | 0.044 | 0.544 | 3e-35 | |
| 307186374 | 2947 | Filamin-A [Camponotus floridanus] | 0.801 | 0.046 | 0.517 | 2e-34 | |
| 350423380 | 2952 | PREDICTED: filamin-C-like [Bombus impati | 0.801 | 0.046 | 0.525 | 2e-34 | |
| 340720217 | 2953 | PREDICTED: filamin-C-like [Bombus terres | 0.801 | 0.046 | 0.525 | 2e-34 | |
| 332021538 | 1764 | Filamin-A [Acromyrmex echinatior] | 0.801 | 0.077 | 0.517 | 2e-34 | |
| 322782475 | 127 | hypothetical protein SINV_02171 [Solenop | 0.736 | 0.992 | 0.563 | 3e-34 | |
| 345488442 | 2857 | PREDICTED: filamin-B-like [Nasonia vitri | 0.777 | 0.046 | 0.518 | 5e-34 | |
| 328786692 | 2970 | PREDICTED: filamin-A-like [Apis mellifer | 0.801 | 0.046 | 0.510 | 1e-33 | |
| 380017751 | 2943 | PREDICTED: LOW QUALITY PROTEIN: filamin- | 0.801 | 0.046 | 0.510 | 1e-33 | |
| 321458955 | 2095 | hypothetical protein DAPPUDRAFT_328543 [ | 0.754 | 0.061 | 0.492 | 3e-32 |
| >gi|383862911|ref|XP_003706926.1| PREDICTED: filamin-B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 152 bits (385), Expect = 3e-35, Method: Compositional matrix adjust.
Identities = 73/134 (54%), Positives = 91/134 (67%)
Query: 31 EETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSP 90
E P++V V P GRE + +GLGLYQ+ G V SFT+ET G EFDV+++ P
Sbjct: 2253 NEVHISGSPLDVTVRSPTGGREVTATGLGLYQSCVGKVTSFTIETLGRPGKEFDVVISGP 2312
Query: 91 QGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHK 150
QG AVPVRCYQ + NLLAEFT T G YKIDVLQGA+PV GSP+ CQ +D SKVK++
Sbjct: 2313 QGNAVPVRCYQHRDGNLLAEFTTNTVGTYKIDVLQGAKPVLGSPFFCQAFDVSKVKLQEL 2372
Query: 151 GLSNIVVNDPISFK 164
G + V+D I+FK
Sbjct: 2373 GPMTVSVHDHIAFK 2386
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307186374|gb|EFN72008.1| Filamin-A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|350423380|ref|XP_003493464.1| PREDICTED: filamin-C-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340720217|ref|XP_003398538.1| PREDICTED: filamin-C-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332021538|gb|EGI61903.1| Filamin-A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322782475|gb|EFZ10424.1| hypothetical protein SINV_02171 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|345488442|ref|XP_001599201.2| PREDICTED: filamin-B-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328786692|ref|XP_393655.4| PREDICTED: filamin-A-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380017751|ref|XP_003692810.1| PREDICTED: LOW QUALITY PROTEIN: filamin-B-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|321458955|gb|EFX70014.1| hypothetical protein DAPPUDRAFT_328543 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| FB|FBgn0028371 | 2955 | jbug "jitterbug" [Drosophila m | 0.754 | 0.043 | 0.418 | 2.9e-21 | |
| UNIPROTKB|B5FW90 | 2647 | FLNA "Filamin A, alpha isoform | 0.748 | 0.048 | 0.333 | 6.9e-09 | |
| RGD|1560614 | 2607 | Flna "filamin A, alpha" [Rattu | 0.748 | 0.049 | 0.326 | 1.4e-08 | |
| UNIPROTKB|Q5HY54 | 2607 | FLNA "Filamin-A" [Homo sapiens | 0.748 | 0.049 | 0.326 | 1.4e-08 | |
| UNIPROTKB|A9CB59 | 2639 | FLNA "Filamin A, alpha (Predic | 0.748 | 0.048 | 0.326 | 1.4e-08 | |
| UNIPROTKB|F1PWW0 | 2646 | FLNA "Uncharacterized protein" | 0.748 | 0.048 | 0.326 | 1.4e-08 | |
| MGI|MGI:95556 | 2647 | Flna "filamin, alpha" [Mus mus | 0.748 | 0.048 | 0.326 | 1.4e-08 | |
| UNIPROTKB|P21333 | 2647 | FLNA "Filamin-A" [Homo sapiens | 0.748 | 0.048 | 0.326 | 1.4e-08 | |
| UNIPROTKB|B0KWW5 | 2647 | FLNA "Filamin A, alpha isoform | 0.748 | 0.048 | 0.326 | 1.8e-08 | |
| UNIPROTKB|F1NG82 | 2506 | FLNB "Uncharacterized protein" | 0.719 | 0.049 | 0.330 | 2.2e-08 |
| FB|FBgn0028371 jbug "jitterbug" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 267 (99.0 bits), Expect = 2.9e-21, P = 2.9e-21
Identities = 54/129 (41%), Positives = 81/129 (62%)
Query: 39 PMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVR 98
P+E+ V+ + G+E S SGLGLYQ+R G SF ++T + EFDV+V+ P G A+PVR
Sbjct: 2272 PLEINVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVR 2331
Query: 99 CYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVN 158
CYQ K +L AEFT G I+VL ++P+ GSP+ C+ +D+SKV + + ++
Sbjct: 2332 CYQTKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALH 2391
Query: 159 DPISFKCKS 167
P SF ++
Sbjct: 2392 SPNSFTVRT 2400
|
|
| UNIPROTKB|B5FW90 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Otolemur garnettii (taxid:30611)] | Back alignment and assigned GO terms |
|---|
| RGD|1560614 Flna "filamin A, alpha" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5HY54 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A9CB59 FLNA "Filamin A, alpha (Predicted)" [Papio anubis (taxid:9555)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWW0 FLNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95556 Flna "filamin, alpha" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21333 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B0KWW5 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Callithrix jacchus (taxid:9483)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NG82 FLNB "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| smart00557 | 93 | smart00557, IG_FLMN, Filamin-type immunoglobulin d | 1e-17 | |
| pfam00630 | 93 | pfam00630, Filamin, Filamin/ABP280 repeat | 1e-13 |
| >gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
Score = 73.0 bits (180), Expect = 1e-17
Identities = 29/87 (33%), Positives = 38/87 (43%)
Query: 56 SGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTT 115
SG GL + G FT++T E +V VT P G VPV +TPT
Sbjct: 7 SGPGLEKGVVGEPAEFTVDTRDAGGGELEVEVTGPSGKKVPVEVKDNGDGTYTVSYTPTE 66
Query: 116 TGVYKIDVLQGARPVRGSPYLCQVYDA 142
G Y + V G + GSP+ +V A
Sbjct: 67 PGDYTVTVKFGGEHIPGSPFTVKVGPA 93
|
These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29). Length = 93 |
| >gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| KOG0518|consensus | 1113 | 99.96 | ||
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 99.95 | |
| KOG0518|consensus | 1113 | 99.95 | ||
| PF00630 | 101 | Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 | 99.91 | |
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 98.62 | |
| PF00630 | 101 | Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 | 98.19 | |
| PRK14081 | 667 | triple tyrosine motif-containing protein; Provisio | 97.17 | |
| KOG1428|consensus | 3738 | 96.92 | ||
| PRK14081 | 667 | triple tyrosine motif-containing protein; Provisio | 96.89 | |
| PF01835 | 99 | A2M_N: MG2 domain; InterPro: IPR002890 The protein | 96.68 | |
| TIGR03503 | 374 | conserved hypothetical protein TIGR03503. This set | 95.82 | |
| PF06312 | 219 | Neurexophilin: Neurexophilin | 95.8 | |
| PF13115 | 86 | YtkA: YtkA-like | 93.67 | |
| COG2373 | 1621 | Large extracellular alpha-helical protein [General | 93.43 | |
| PF02369 | 100 | Big_1: Bacterial Ig-like domain (group 1); InterPr | 93.3 | |
| PF13860 | 81 | FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A. | 92.5 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 91.44 | |
| PF04234 | 97 | CopC: CopC domain; InterPro: IPR007348 CopC is a b | 89.71 | |
| PF13473 | 104 | Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D | 89.45 | |
| PF11896 | 187 | DUF3416: Domain of unknown function (DUF3416); Int | 89.08 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 88.94 | |
| PF07705 | 101 | CARDB: CARDB; InterPro: IPR011635 The APHP (acidic | 87.85 | |
| smart00736 | 97 | CADG Dystroglycan-type cadherin-like domains. Cadh | 87.66 | |
| PRK06655 | 225 | flgD flagellar basal body rod modification protein | 87.05 | |
| PRK10301 | 124 | hypothetical protein; Provisional | 86.62 | |
| cd02858 | 85 | Esterase_N_term Esterase N-terminal domain. Estera | 85.37 | |
| COG2372 | 127 | CopC Uncharacterized protein, homolog of Cu resist | 84.63 | |
| PF05404 | 167 | TRAP-delta: Translocon-associated protein, delta s | 83.49 | |
| KOG1692|consensus | 201 | 83.26 | ||
| PF01483 | 87 | P_proprotein: Proprotein convertase P-domain; Inte | 82.95 | |
| COG1470 | 513 | Predicted membrane protein [Function unknown] | 82.69 | |
| PRK09619 | 218 | flgD flagellar basal body rod modification protein | 82.5 | |
| PRK12812 | 259 | flgD flagellar basal body rod modification protein | 82.21 | |
| PF04151 | 70 | PPC: Bacterial pre-peptidase C-terminal domain; In | 82.2 | |
| TIGR03096 | 135 | nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de | 81.76 | |
| PF13620 | 82 | CarboxypepD_reg: Carboxypeptidase regulatory-like | 81.66 | |
| PF07523 | 67 | Big_3: Bacterial Ig-like domain (group 3); InterPr | 80.24 |
| >KOG0518|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=2.3e-28 Score=221.82 Aligned_cols=154 Identities=19% Similarity=0.246 Sum_probs=141.0
Q ss_pred ccCCCCceeEEEEEEECCEEcCCCCeEEEecCC-CCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCC
Q psy15726 15 APSWISYGLVQARTLREETSFRSCPMEVPVVDP-AVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGA 93 (171)
Q Consensus 15 ~~~P~~~G~~~i~V~~~g~~I~gSPf~v~V~~~-~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~ 93 (171)
+|.|+|+|+|.|+|+.+|+||++|||.+.|... .|+++++++|.|+.....-++++|.||++++|.+-|++.+++|+
T Consensus 722 tF~P~e~GeH~I~Vk~~G~hVpgsPf~i~V~~~e~dAsk~~v~g~g~~~G~t~ep~~fivDtr~agyGgLsi~~~Gps-- 799 (1113)
T KOG0518|consen 722 TFTPREVGEHKINVKVAGKHVPGSPFSIKVSESEIDASKVRVSGQGLKEGHTFEPAEFIVDTRKAGYGGLSISVQGPS-- 799 (1113)
T ss_pred EECCCcCcceEEEEEEcceECCCCCeEEEeccccccceeEEEecccccccccccchheEeccccCCCCceEEEEeCCc--
Confidence 489999999999999999999999999999876 57999999999998876669999999999999999999999999
Q ss_pred ccceEEEEcCCCEEEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEecCCC----ceEEecCCcccEEcCCCEEEEEEccC
Q psy15726 94 AVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDAS----KVKIEHKGLSNIVVNDPISFKCKSTE 169 (171)
Q Consensus 94 ~~~~~v~~~~dg~y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V~d~s----kv~~~G~gl~~~~~g~~~~F~Vd~~~ 169 (171)
.++..+.|+.||+++|+|+|+++|.|.|+|+|+++||+||||.+++.+++ -+..+..++.-+.+|..++|.+++.+
T Consensus 800 kvd~~~~d~~dGt~kV~ytPtepG~Y~I~i~Fad~~I~gSPftVkv~~~~~vvesi~~~~~~~~va~~g~~~~l~lk~~~ 879 (1113)
T KOG0518|consen 800 KVDLNVEDREDGTCKVSYTPTEPGTYIINIKFADEHIKGSPFTVKVTGESRVVESITRDREAPSVARVGHTCSLDLKATE 879 (1113)
T ss_pred ccccceeecCCCeEEEEEeCCCCceEEEEEEEcCccCCCCceEEEecCCeeEeeeeeecccccceecccceeeeeeecCC
Confidence 46788999999999999999999999999999999999999999999988 34456666667999999999998875
Q ss_pred C
Q psy15726 170 E 170 (171)
Q Consensus 170 a 170 (171)
+
T Consensus 880 ~ 880 (1113)
T KOG0518|consen 880 A 880 (1113)
T ss_pred C
Confidence 4
|
|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >KOG0518|consensus | Back alignment and domain information |
|---|
| >PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod | Back alignment and domain information |
|---|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod | Back alignment and domain information |
|---|
| >PRK14081 triple tyrosine motif-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PRK14081 triple tyrosine motif-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF01835 A2M_N: MG2 domain; InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white | Back alignment and domain information |
|---|
| >TIGR03503 conserved hypothetical protein TIGR03503 | Back alignment and domain information |
|---|
| >PF06312 Neurexophilin: Neurexophilin | Back alignment and domain information |
|---|
| >PF13115 YtkA: YtkA-like | Back alignment and domain information |
|---|
| >COG2373 Large extracellular alpha-helical protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins | Back alignment and domain information |
|---|
| >PF13860 FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >PF04234 CopC: CopC domain; InterPro: IPR007348 CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule | Back alignment and domain information |
|---|
| >PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D | Back alignment and domain information |
|---|
| >PF11896 DUF3416: Domain of unknown function (DUF3416); InterPro: IPR021828 This presumed domain is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >PF07705 CARDB: CARDB; InterPro: IPR011635 The APHP (acidic peptide-dependent hydrolases/peptidase) domain is found in a variety of different proteins | Back alignment and domain information |
|---|
| >smart00736 CADG Dystroglycan-type cadherin-like domains | Back alignment and domain information |
|---|
| >PRK06655 flgD flagellar basal body rod modification protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10301 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02858 Esterase_N_term Esterase N-terminal domain | Back alignment and domain information |
|---|
| >COG2372 CopC Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only] | Back alignment and domain information |
|---|
| >PF05404 TRAP-delta: Translocon-associated protein, delta subunit precursor (TRAP-delta); InterPro: IPR008855 This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta) | Back alignment and domain information |
|---|
| >KOG1692|consensus | Back alignment and domain information |
|---|
| >PF01483 P_proprotein: Proprotein convertase P-domain; InterPro: IPR002884 This domain, termed the P domain is approximately 150 amino acids in length and C-terminal to a serine endopeptidase domain which belong to MEROPS peptidase family S8 (clan SB), subfamily S8B (kexin) | Back alignment and domain information |
|---|
| >COG1470 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK09619 flgD flagellar basal body rod modification protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12812 flgD flagellar basal body rod modification protein; Reviewed | Back alignment and domain information |
|---|
| >PF04151 PPC: Bacterial pre-peptidase C-terminal domain; InterPro: IPR007280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03096 nitroso_cyanin nitrosocyanin | Back alignment and domain information |
|---|
| >PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A | Back alignment and domain information |
|---|
| >PF07523 Big_3: Bacterial Ig-like domain (group 3); InterPro: IPR011080 This entry represents bacterial domains with an Ig-like fold | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-16 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 3e-16 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 2e-04 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-15 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 3e-15 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-14 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 5e-14 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 6e-14 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 6e-14 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 9e-14 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 9e-14 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-13 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-13 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-05 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-13 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 1e-13 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 7e-08 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-13 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 2e-13 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 5e-13 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 8e-13 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-12 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 2e-12 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 1e-11 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 3e-12 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 3e-12 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 1e-11 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 1e-11 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-11 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 9e-10 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 1e-08 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 1e-06 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-09 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 2e-09 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 2e-08 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 1e-04 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 3e-08 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 5e-05 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 7e-07 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 2e-04 |
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
Score = 70.6 bits (173), Expect = 1e-16
Identities = 26/107 (24%), Positives = 41/107 (38%), Gaps = 3/107 (2%)
Query: 38 CPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPV 97
P++ V P G S G GL + +FT+ T D+ + P +
Sbjct: 10 SPLQFYVNYPNSGS-VSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSK--AEI 66
Query: 98 RCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASK 144
C K + PT G Y I V + + GSP+ ++ D S+
Sbjct: 67 SCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSR 113
|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 100.0 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 100.0 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 100.0 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 100.0 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 100.0 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 100.0 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 100.0 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 99.98 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.98 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.97 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.97 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.97 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 99.97 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 99.97 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.97 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 99.96 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 99.96 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 99.95 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 99.95 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.95 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 99.95 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 99.95 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.95 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.95 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 99.94 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.94 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.94 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.94 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.94 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 99.93 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 99.93 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 99.93 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.92 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 99.91 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 99.91 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.87 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.81 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 99.76 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.46 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.22 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.15 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 99.14 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.11 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.11 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.11 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.05 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.04 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.97 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 98.9 | |
| 3tkv_A | 414 | FDEC fragment B, attaching and effacing protein, p | 98.87 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.87 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 98.84 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.79 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 98.73 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.71 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.7 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 98.68 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 98.67 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 98.64 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 98.64 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 98.63 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 98.62 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.57 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 98.5 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 98.43 | |
| 3tkv_A | 414 | FDEC fragment B, attaching and effacing protein, p | 98.35 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 97.6 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 97.2 | |
| 2p9r_A | 102 | Alpha-2-M, alpha-2-macroglobulin; human alpha2-mac | 95.61 | |
| 4fxk_A | 656 | Complement C4 beta chain; immune system, proteolyt | 94.97 | |
| 1cwv_A | 492 | Invasin; integrin-binding protein, INV gene, struc | 94.89 | |
| 2hr0_A | 645 | Complement C3 beta chain; complement component C3B | 94.62 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 94.14 | |
| 1cwv_A | 492 | Invasin; integrin-binding protein, INV gene, struc | 93.79 | |
| 2pn5_A | 1325 | TEP1R, thioester-containing protein I; FULL-length | 92.18 | |
| 3u83_A | 331 | Poliovirus receptor-related protein 1; nectin-1, h | 92.16 | |
| 3idu_A | 127 | Uncharacterized protein; all beta-protein, structu | 91.0 | |
| 2b39_A | 1661 | C3; thioester, immune defense, immune system; HET: | 90.91 | |
| 2o26_X | 290 | MAST/stem cell growth factor receptor; stem cell f | 89.8 | |
| 3hrz_A | 627 | Cobra venom factor; serine protease, glycosilated, | 88.65 | |
| 3cu7_A | 1676 | Complement C5; Mg domain, inflammation, anaphylato | 88.46 | |
| 1qgc_4 | 438 | Protein (immunoglobulin); virus-antibody complex, | 87.32 | |
| 3c12_A | 138 | FLGD, flagellar protein; HOOK capping, IG-like dom | 87.24 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 86.29 | |
| 3pl6_D | 268 | MBP peptide / T-cell receptor beta chain chimera; | 85.89 | |
| 4acq_A | 1451 | Alpha-2-macroglobulin; hydrolase inhibitor, protei | 83.7 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 83.25 | |
| 3osv_A | 138 | Flagellar basal-BODY ROD modification protein FLG; | 83.16 | |
| 4fxk_A | 656 | Complement C4 beta chain; immune system, proteolyt | 81.88 | |
| 4hci_A | 100 | Cupredoxin 1; structural genomics, niaid, national | 81.81 | |
| 3nfj_J | 245 | T cell receptor beta chain; immunoglobulin family, | 80.83 | |
| 3qib_D | 270 | 2B4 beta chain; IG domain, immune system; HET: NAG | 80.82 |
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-38 Score=232.30 Aligned_cols=127 Identities=19% Similarity=0.298 Sum_probs=121.7
Q ss_pred ceeEEEEEEECCEEcCCCCeEEEecCCCCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCCccceEEE
Q psy15726 21 YGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCY 100 (171)
Q Consensus 21 ~G~~~i~V~~~g~~I~gSPf~v~V~~~~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~~~~~~v~ 100 (171)
.|-|+|+|+|||+||++|||.+.|.+..|+++|+++|+||+.+.+|++++|+|++++++.+.|.+.|.+|++ +++++.
T Consensus 2 ~~~~~i~v~~~g~~v~gsPf~v~v~~~~d~~~~~~~G~GL~~~~vg~~~~F~V~t~dag~~~l~v~v~gp~~--~~~~v~ 79 (131)
T 2di9_A 2 SSGSSGDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCE--AKIECS 79 (131)
T ss_dssp CCCCCCCCCCCCCCCSSCTTSCSCCCCCCGGGCEEESHHHHEEETTSCEEEEEECTTTCSSCEEEEECSSSC--CEEEEE
T ss_pred CCcEEEEEEECCEECCCCCEEEEEeCCCCccccEEECCccCccccCCeEEEEEEEcCCCCCeeEEEEEecCC--ceEEEE
Confidence 478999999999999999999999988999999999999999999999999999999999999999999987 577899
Q ss_pred EcCCCEEEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEe---cCCCceEEec
Q psy15726 101 QQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQV---YDASKVKIEH 149 (171)
Q Consensus 101 ~~~dg~y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V---~d~skv~~~G 149 (171)
|++||+|.|+|+|+++|.|.|+|+|+|+||+||||.++| .|++||+++|
T Consensus 80 d~~dGty~v~Y~p~~~G~y~I~V~~~g~~I~gSPF~v~V~~~~d~~kv~~~G 131 (131)
T 2di9_A 80 DNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSSGPSSG 131 (131)
T ss_dssp ECSSSEEEEEEECSSSSEEEEEEEESSCBCTTCSEEEEEECCCCCCCSSCCC
T ss_pred ECCCCEEEEEEEeCCCeeEEEEEEECCEECCCcCEEEEECCCCCcceeEEEC
Confidence 999999999999999999999999999999999999999 6999999886
|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p9r_A Alpha-2-M, alpha-2-macroglobulin; human alpha2-macroglobulin, Mg2 domain, X-RAY, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4fxk_A Complement C4 beta chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_A* | Back alignment and structure |
|---|
| >1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 | Back alignment and structure |
|---|
| >2hr0_A Complement C3 beta chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2i07_A* 2wii_A* 2win_A* 2xwj_A* 3l3o_A* 3l5n_A* 3nms_A* 3nsa_A* 3ohx_A* 3t4a_A 2a74_A* 2a73_A* 2qki_A* 3g6j_A 2ice_A* 2icf_A* 2xwb_A* | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 | Back alignment and structure |
|---|
| >2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A | Back alignment and structure |
|---|
| >3idu_A Uncharacterized protein; all beta-protein, structural genomics, PSI-2, protein structure initiative; 1.70A {Pyrococcus furiosus} PDB: 2kl6_A | Back alignment and structure |
|---|
| >2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3hrz_A Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_A* 3hs0_A* | Back alignment and structure |
|---|
| >3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A | Back alignment and structure |
|---|
| >1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 | Back alignment and structure |
|---|
| >3c12_A FLGD, flagellar protein; HOOK capping, IG-like domain, FN-III domain, tudor-like domain, flagellar biogenesis, flagellum; 2.51A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >3osv_A Flagellar basal-BODY ROD modification protein FLG; FLGD, flagellum, P. aeruginosa, structural protein; 2.35A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fxk_A Complement C4 beta chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_A* | Back alignment and structure |
|---|
| >4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A | Back alignment and structure |
|---|
| >3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 171 | ||||
| d2diaa1 | 100 | b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens | 3e-16 | |
| d2di8a1 | 98 | b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens | 7e-15 | |
| d2d7pa1 | 99 | b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens | 1e-14 | |
| d1v05a_ | 96 | b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta | 4e-14 | |
| d2diba1 | 115 | b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens | 1e-13 | |
| d2dmca1 | 103 | b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens | 1e-13 | |
| d2dj4a1 | 101 | b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens | 2e-13 | |
| d2nqca1 | 97 | b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap | 2e-13 | |
| d2dica1 | 98 | b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens | 3e-13 | |
| d2d7ma1 | 102 | b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens | 7e-13 | |
| d2dmba1 | 111 | b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens | 8e-13 | |
| d2j3sa2 | 88 | b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap | 3e-12 | |
| d1qfha1 | 104 | b.1.18.10 (A:646-749) F-actin cross-linking gelati | 4e-12 | |
| d2di9a1 | 118 | b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens | 6e-12 | |
| d2di9a1 | 118 | b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens | 2e-05 | |
| d2w0pa1 | 92 | b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap | 8e-12 | |
| d2d7na1 | 80 | b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) | 2e-11 | |
| d2bp3a1 | 92 | b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap | 2e-11 | |
| d1wlha1 | 101 | b.1.18.10 (A:547-647) F-actin cross-linking gelati | 2e-09 | |
| d1qfha2 | 108 | b.1.18.10 (A:750-857) F-actin cross-linking gelati | 1e-07 |
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: Filamin repeat (rod domain) domain: Filamin b species: Human (Homo sapiens) [TaxId: 9606]
Score = 68.1 bits (166), Expect = 3e-16
Identities = 18/90 (20%), Positives = 28/90 (31%)
Query: 56 SGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTT 115
SG GL + G +++ + S G V K + P T
Sbjct: 10 SGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLT 69
Query: 116 TGVYKIDVLQGARPVRGSPYLCQVYDASKV 145
G+Y + + G V P +V A
Sbjct: 70 AGMYTLTMKYGGELVPHFPARVKVEPAVDT 99
|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| d2di9a1 | 118 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d2diba1 | 115 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d2d7ma1 | 102 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1v05a_ | 96 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2dmba1 | 111 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2dmca1 | 103 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2bp3a1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d2d7pa1 | 99 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d2nqca1 | 97 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1qfha1 | 104 | F-actin cross-linking gelation factor (ABP-120) re | 99.94 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 99.92 | |
| d2j3sa2 | 88 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2d7na1 | 80 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1qfha2 | 108 | F-actin cross-linking gelation factor (ABP-120) re | 99.81 | |
| d2di9a1 | 118 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.98 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.94 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d2d7ma1 | 102 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 98.88 | |
| d2j3sa2 | 88 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d2diba1 | 115 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.82 | |
| d2nqca1 | 97 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d2d7pa1 | 99 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d2bp3a1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 98.75 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 98.7 | |
| d2dmca1 | 103 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d1v05a_ | 96 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 98.67 | |
| d2d7na1 | 80 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 98.67 | |
| d2dmba1 | 111 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 98.66 | |
| d1qfha2 | 108 | F-actin cross-linking gelation factor (ABP-120) re | 98.6 | |
| d1qfha1 | 104 | F-actin cross-linking gelation factor (ABP-120) re | 98.58 | |
| d1cwva3 | 103 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 95.8 | |
| d1cwva2 | 96 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 94.27 | |
| d1vjja3 | 99 | Transglutaminase, two C-terminal domains {Human (H | 93.59 | |
| d2q3za3 | 98 | Transglutaminase, two C-terminal domains {Human (H | 92.3 | |
| d1ex0a3 | 100 | Transglutaminase, two C-terminal domains {Human (H | 90.41 | |
| d1wmda1 | 116 | Alkaline serine protease kp-43, C-terminal domain | 88.29 | |
| d1g0da3 | 101 | Transglutaminase, two C-terminal domains {Red sea | 85.43 | |
| d1f00i1 | 95 | Intimin {Escherichia coli [TaxId: 562]} | 83.32 | |
| d1u2ca1 | 103 | Dystroglycan, N-terminal domain {Mouse (Mus muscul | 82.27 | |
| d1ibya_ | 112 | Red copper protein nitrosocyanin {Nitrosomonas eur | 82.09 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 81.11 | |
| d1cwva1 | 94 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 80.83 |
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: E set domains family: Filamin repeat (rod domain) domain: Filamin b species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=3e-35 Score=210.17 Aligned_cols=114 Identities=19% Similarity=0.318 Sum_probs=108.1
Q ss_pred EEEECCEEcCCCCeEEEecCCCCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCCccceEEEEcCCCE
Q psy15726 27 RTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFAN 106 (171)
Q Consensus 27 ~V~~~g~~I~gSPf~v~V~~~~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~~~~~~v~~~~dg~ 106 (171)
+|+|||++|+||||.+.|.+..|+++|+++|+||+.+.+|++++|+|+++++|.++|++.|.+|++ +++++.+++||+
T Consensus 1 ~V~~~g~~v~gSPf~~~v~~~~d~~kv~v~G~Gl~~~~vg~~~~F~Vd~~~ag~g~l~v~i~~p~~--~~~~v~~~~dG~ 78 (118)
T d2di9a1 1 DVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCE--AKIECSDNGDGT 78 (118)
T ss_dssp CCCCCCCCCSSCTTSCSCCCCCCGGGCEEESHHHHEEETTSCEEEEEECTTTCSSCEEEEECSSSC--CEEEEEECSSSE
T ss_pred CeeECCEECCCCCEEEEEcCCCCccEEEEECCccCceeeeeeEEEEEEeCCCCCCccEEEEecCCc--eEEEEEECCCCE
Confidence 478999999999999999998999999999999999999999999999999999999999999987 467899999999
Q ss_pred EEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEecCC
Q psy15726 107 LLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDA 142 (171)
Q Consensus 107 y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V~d~ 142 (171)
|.++|+|.++|.|+|+|+|+|++|+||||+++|.|+
T Consensus 79 y~v~ytP~~~G~y~i~V~~~g~~i~gSPf~v~V~~~ 114 (118)
T d2di9a1 79 CSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMP 114 (118)
T ss_dssp EEEEEECSSSSEEEEEEEESSCBCTTCSEEEEEECC
T ss_pred EEEEEEeCCcEeEEEEEEECCEECCCCCEEEEEeCC
Confidence 999999999999999999999999999999999443
|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmda1 b.18.1.20 (A:319-434) Alkaline serine protease kp-43, C-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} | Back information, alignment and structure |
|---|
| >d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major) [TaxId: 143350]} | Back information, alignment and structure |
|---|
| >d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|