Psyllid ID: psy15726


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
SIFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKSTEEP
cEEEEEEEEEEEEEccccEEEEEEEEEEEEccEEcccccEEEEEEcccccEEEEEEccccccEEEccEEEEEEEEcccccccEEEEEEcccccccccEEEEccccEEEEEEEccccEEEEEEEEEccEEcccccEEEEEEccccEEEEccccccEEEcccEEEEEEccccc
cEEEEccEEEEccccccEEEccEEEEEEEEcccccccccEEEEEccccccccEEEEcccccccEccccEEEEEEEcccccccEEEEEEcccccEEEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEEcccccEEEEccccccccccccEEEEEEccccc
sifftkscillsekapswiSYGLVQARTLreetsfrscpmevpvvdpavgrepsgsglglyqarsgivnsftletcgvassefdvivtspqgaavpvrCYQQKFANLLAeftptttgvykidvlqgarpvrgspylcqvydaskvkiehkglsnivvndpisfkcksteep
sifftkscillsekapswisYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKiehkglsnivvndpisfkcksteep
SIFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKSTEEP
*IFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVD**********GLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFK*******
SIFFT*SCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKSTE**
SIFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKSTEEP
SIFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKST***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SIFFTKSCILLSEKAPSWISYGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVNDPISFKCKSTEEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q8BTM8 2647 Filamin-A OS=Mus musculus yes N/A 0.695 0.044 0.322 7e-06
P21333 2647 Filamin-A OS=Homo sapiens yes N/A 0.695 0.044 0.322 9e-06
O75369 2602 Filamin-B OS=Homo sapiens no N/A 0.561 0.036 0.342 3e-05
Q8VHX6 2726 Filamin-C OS=Mus musculus no N/A 0.754 0.047 0.309 4e-05
Q14315 2725 Filamin-C OS=Homo sapiens no N/A 0.754 0.047 0.309 4e-05
Q80X90 2602 Filamin-B OS=Mus musculus no N/A 0.573 0.037 0.320 0.0001
>sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 Back     alignment and function desciption
 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 39   PMEVPVVD--PAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVP 96
            P +VPV D   A   + SG GL     R+ +  SF ++T     +   V V  P+G   P
Sbjct: 1437 PFKVPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEP 1496

Query: 97   VRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQV---YDASKVKIEHKGLS 153
            V             + P+  G Y I VL G   V  SP+  +V   +DASKVK    GL+
Sbjct: 1497 VDVVDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLN 1556

Query: 154  NIVV 157
               V
Sbjct: 1557 TTGV 1560




Promotes orthogonal branching of actin filaments and links actin filaments to membrane glycoproteins. Anchors various transmembrane proteins to the actin cytoskeleton and serves as a scaffold for a wide range of cytoplasmic signaling proteins (By similarity). Interaction with FLNA may allow neuroblast migration from the ventricular zone into the cortical plate. Tethers cell surface-localized furin, modulates its rate of internalization and directs its intracellular trafficking.
Mus musculus (taxid: 10090)
>sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 Back     alignment and function description
>sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 Back     alignment and function description
>sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 Back     alignment and function description
>sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 Back     alignment and function description
>sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
383862911 2958 PREDICTED: filamin-B-like [Megachile rot 0.771 0.044 0.544 3e-35
307186374 2947 Filamin-A [Camponotus floridanus] 0.801 0.046 0.517 2e-34
350423380 2952 PREDICTED: filamin-C-like [Bombus impati 0.801 0.046 0.525 2e-34
340720217 2953 PREDICTED: filamin-C-like [Bombus terres 0.801 0.046 0.525 2e-34
332021538 1764 Filamin-A [Acromyrmex echinatior] 0.801 0.077 0.517 2e-34
322782475127 hypothetical protein SINV_02171 [Solenop 0.736 0.992 0.563 3e-34
345488442 2857 PREDICTED: filamin-B-like [Nasonia vitri 0.777 0.046 0.518 5e-34
328786692 2970 PREDICTED: filamin-A-like [Apis mellifer 0.801 0.046 0.510 1e-33
380017751 2943 PREDICTED: LOW QUALITY PROTEIN: filamin- 0.801 0.046 0.510 1e-33
321458955 2095 hypothetical protein DAPPUDRAFT_328543 [ 0.754 0.061 0.492 3e-32
>gi|383862911|ref|XP_003706926.1| PREDICTED: filamin-B-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (67%)

Query: 31   EETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSP 90
             E      P++V V  P  GRE + +GLGLYQ+  G V SFT+ET G    EFDV+++ P
Sbjct: 2253 NEVHISGSPLDVTVRSPTGGREVTATGLGLYQSCVGKVTSFTIETLGRPGKEFDVVISGP 2312

Query: 91   QGAAVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHK 150
            QG AVPVRCYQ +  NLLAEFT  T G YKIDVLQGA+PV GSP+ CQ +D SKVK++  
Sbjct: 2313 QGNAVPVRCYQHRDGNLLAEFTTNTVGTYKIDVLQGAKPVLGSPFFCQAFDVSKVKLQEL 2372

Query: 151  GLSNIVVNDPISFK 164
            G   + V+D I+FK
Sbjct: 2373 GPMTVSVHDHIAFK 2386




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307186374|gb|EFN72008.1| Filamin-A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350423380|ref|XP_003493464.1| PREDICTED: filamin-C-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340720217|ref|XP_003398538.1| PREDICTED: filamin-C-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332021538|gb|EGI61903.1| Filamin-A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322782475|gb|EFZ10424.1| hypothetical protein SINV_02171 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345488442|ref|XP_001599201.2| PREDICTED: filamin-B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328786692|ref|XP_393655.4| PREDICTED: filamin-A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380017751|ref|XP_003692810.1| PREDICTED: LOW QUALITY PROTEIN: filamin-B-like [Apis florea] Back     alignment and taxonomy information
>gi|321458955|gb|EFX70014.1| hypothetical protein DAPPUDRAFT_328543 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0028371 2955 jbug "jitterbug" [Drosophila m 0.754 0.043 0.418 2.9e-21
UNIPROTKB|B5FW90 2647 FLNA "Filamin A, alpha isoform 0.748 0.048 0.333 6.9e-09
RGD|1560614 2607 Flna "filamin A, alpha" [Rattu 0.748 0.049 0.326 1.4e-08
UNIPROTKB|Q5HY54 2607 FLNA "Filamin-A" [Homo sapiens 0.748 0.049 0.326 1.4e-08
UNIPROTKB|A9CB59 2639 FLNA "Filamin A, alpha (Predic 0.748 0.048 0.326 1.4e-08
UNIPROTKB|F1PWW0 2646 FLNA "Uncharacterized protein" 0.748 0.048 0.326 1.4e-08
MGI|MGI:95556 2647 Flna "filamin, alpha" [Mus mus 0.748 0.048 0.326 1.4e-08
UNIPROTKB|P21333 2647 FLNA "Filamin-A" [Homo sapiens 0.748 0.048 0.326 1.4e-08
UNIPROTKB|B0KWW5 2647 FLNA "Filamin A, alpha isoform 0.748 0.048 0.326 1.8e-08
UNIPROTKB|F1NG82 2506 FLNB "Uncharacterized protein" 0.719 0.049 0.330 2.2e-08
FB|FBgn0028371 jbug "jitterbug" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 267 (99.0 bits), Expect = 2.9e-21, P = 2.9e-21
 Identities = 54/129 (41%), Positives = 81/129 (62%)

Query:    39 PMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVR 98
             P+E+ V+  + G+E S SGLGLYQ+R G   SF ++T    + EFDV+V+ P G A+PVR
Sbjct:  2272 PLEINVLPASAGKEISVSGLGLYQSRVGKTTSFAIDTVKRPAREFDVVVSGPGGQALPVR 2331

Query:    99 CYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASKVKIEHKGLSNIVVN 158
             CYQ K  +L AEFT    G   I+VL  ++P+ GSP+ C+ +D+SKV  +      + ++
Sbjct:  2332 CYQTKNGHLQAEFTINKPGQCVIEVLHQSKPLPGSPFTCESFDSSKVSTQGVTKEPLALH 2391

Query:   159 DPISFKCKS 167
              P SF  ++
Sbjct:  2392 SPNSFTVRT 2400


GO:0003779 "actin binding" evidence=ISS
GO:0009612 "response to mechanical stimulus" evidence=IGI
GO:0048104 "establishment of body hair or bristle planar orientation" evidence=IMP
UNIPROTKB|B5FW90 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Otolemur garnettii (taxid:30611)] Back     alignment and assigned GO terms
RGD|1560614 Flna "filamin A, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HY54 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A9CB59 FLNA "Filamin A, alpha (Predicted)" [Papio anubis (taxid:9555)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWW0 FLNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:95556 Flna "filamin, alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P21333 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B0KWW5 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG82 FLNB "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 1e-17
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 1e-13
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
 Score = 73.0 bits (180), Expect = 1e-17
 Identities = 29/87 (33%), Positives = 38/87 (43%)

Query: 56  SGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTT 115
           SG GL +   G    FT++T      E +V VT P G  VPV             +TPT 
Sbjct: 7   SGPGLEKGVVGEPAEFTVDTRDAGGGELEVEVTGPSGKKVPVEVKDNGDGTYTVSYTPTE 66

Query: 116 TGVYKIDVLQGARPVRGSPYLCQVYDA 142
            G Y + V  G   + GSP+  +V  A
Sbjct: 67  PGDYTVTVKFGGEHIPGSPFTVKVGPA 93


These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29). Length = 93

>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG0518|consensus 1113 99.96
smart0055793 IG_FLMN Filamin-type immunoglobulin domains. These 99.95
KOG0518|consensus 1113 99.95
PF00630101 Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 99.91
smart0055793 IG_FLMN Filamin-type immunoglobulin domains. These 98.62
PF00630101 Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 98.19
PRK14081 667 triple tyrosine motif-containing protein; Provisio 97.17
KOG1428|consensus 3738 96.92
PRK14081667 triple tyrosine motif-containing protein; Provisio 96.89
PF0183599 A2M_N: MG2 domain; InterPro: IPR002890 The protein 96.68
TIGR03503374 conserved hypothetical protein TIGR03503. This set 95.82
PF06312219 Neurexophilin: Neurexophilin 95.8
PF1311586 YtkA: YtkA-like 93.67
COG2373 1621 Large extracellular alpha-helical protein [General 93.43
PF02369100 Big_1: Bacterial Ig-like domain (group 1); InterPr 93.3
PF1386081 FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A. 92.5
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 91.44
PF0423497 CopC: CopC domain; InterPro: IPR007348 CopC is a b 89.71
PF13473104 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 89.45
PF11896187 DUF3416: Domain of unknown function (DUF3416); Int 89.08
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 88.94
PF07705101 CARDB: CARDB; InterPro: IPR011635 The APHP (acidic 87.85
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 87.66
PRK06655225 flgD flagellar basal body rod modification protein 87.05
PRK10301124 hypothetical protein; Provisional 86.62
cd0285885 Esterase_N_term Esterase N-terminal domain. Estera 85.37
COG2372127 CopC Uncharacterized protein, homolog of Cu resist 84.63
PF05404167 TRAP-delta: Translocon-associated protein, delta s 83.49
KOG1692|consensus201 83.26
PF0148387 P_proprotein: Proprotein convertase P-domain; Inte 82.95
COG1470513 Predicted membrane protein [Function unknown] 82.69
PRK09619218 flgD flagellar basal body rod modification protein 82.5
PRK12812259 flgD flagellar basal body rod modification protein 82.21
PF0415170 PPC: Bacterial pre-peptidase C-terminal domain; In 82.2
TIGR03096135 nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de 81.76
PF1362082 CarboxypepD_reg: Carboxypeptidase regulatory-like 81.66
PF0752367 Big_3: Bacterial Ig-like domain (group 3); InterPr 80.24
>KOG0518|consensus Back     alignment and domain information
Probab=99.96  E-value=2.3e-28  Score=221.82  Aligned_cols=154  Identities=19%  Similarity=0.246  Sum_probs=141.0

Q ss_pred             ccCCCCceeEEEEEEECCEEcCCCCeEEEecCC-CCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCC
Q psy15726         15 APSWISYGLVQARTLREETSFRSCPMEVPVVDP-AVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGA   93 (171)
Q Consensus        15 ~~~P~~~G~~~i~V~~~g~~I~gSPf~v~V~~~-~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~   93 (171)
                      +|.|+|+|+|.|+|+.+|+||++|||.+.|... .|+++++++|.|+.....-++++|.||++++|.+-|++.+++|+  
T Consensus       722 tF~P~e~GeH~I~Vk~~G~hVpgsPf~i~V~~~e~dAsk~~v~g~g~~~G~t~ep~~fivDtr~agyGgLsi~~~Gps--  799 (1113)
T KOG0518|consen  722 TFTPREVGEHKINVKVAGKHVPGSPFSIKVSESEIDASKVRVSGQGLKEGHTFEPAEFIVDTRKAGYGGLSISVQGPS--  799 (1113)
T ss_pred             EECCCcCcceEEEEEEcceECCCCCeEEEeccccccceeEEEecccccccccccchheEeccccCCCCceEEEEeCCc--
Confidence            489999999999999999999999999999876 57999999999998876669999999999999999999999999  


Q ss_pred             ccceEEEEcCCCEEEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEecCCC----ceEEecCCcccEEcCCCEEEEEEccC
Q psy15726         94 AVPVRCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDAS----KVKIEHKGLSNIVVNDPISFKCKSTE  169 (171)
Q Consensus        94 ~~~~~v~~~~dg~y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V~d~s----kv~~~G~gl~~~~~g~~~~F~Vd~~~  169 (171)
                      .++..+.|+.||+++|+|+|+++|.|.|+|+|+++||+||||.+++.+++    -+..+..++.-+.+|..++|.+++.+
T Consensus       800 kvd~~~~d~~dGt~kV~ytPtepG~Y~I~i~Fad~~I~gSPftVkv~~~~~vvesi~~~~~~~~va~~g~~~~l~lk~~~  879 (1113)
T KOG0518|consen  800 KVDLNVEDREDGTCKVSYTPTEPGTYIINIKFADEHIKGSPFTVKVTGESRVVESITRDREAPSVARVGHTCSLDLKATE  879 (1113)
T ss_pred             ccccceeecCCCeEEEEEeCCCCceEEEEEEEcCccCCCCceEEEecCCeeEeeeeeecccccceecccceeeeeeecCC
Confidence            46788999999999999999999999999999999999999999999988    34456666667999999999998875


Q ss_pred             C
Q psy15726        170 E  170 (171)
Q Consensus       170 a  170 (171)
                      +
T Consensus       880 ~  880 (1113)
T KOG0518|consen  880 A  880 (1113)
T ss_pred             C
Confidence            4



>smart00557 IG_FLMN Filamin-type immunoglobulin domains Back     alignment and domain information
>KOG0518|consensus Back     alignment and domain information
>PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod Back     alignment and domain information
>smart00557 IG_FLMN Filamin-type immunoglobulin domains Back     alignment and domain information
>PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>PF01835 A2M_N: MG2 domain; InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white Back     alignment and domain information
>TIGR03503 conserved hypothetical protein TIGR03503 Back     alignment and domain information
>PF06312 Neurexophilin: Neurexophilin Back     alignment and domain information
>PF13115 YtkA: YtkA-like Back     alignment and domain information
>COG2373 Large extracellular alpha-helical protein [General function prediction only] Back     alignment and domain information
>PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins Back     alignment and domain information
>PF13860 FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF04234 CopC: CopC domain; InterPro: IPR007348 CopC is a bacterial blue copper protein that binds 1 atom of copper per protein molecule Back     alignment and domain information
>PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D Back     alignment and domain information
>PF11896 DUF3416: Domain of unknown function (DUF3416); InterPro: IPR021828 This presumed domain is functionally uncharacterised Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF07705 CARDB: CARDB; InterPro: IPR011635 The APHP (acidic peptide-dependent hydrolases/peptidase) domain is found in a variety of different proteins Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PRK06655 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK10301 hypothetical protein; Provisional Back     alignment and domain information
>cd02858 Esterase_N_term Esterase N-terminal domain Back     alignment and domain information
>COG2372 CopC Uncharacterized protein, homolog of Cu resistance protein CopC [General function prediction only] Back     alignment and domain information
>PF05404 TRAP-delta: Translocon-associated protein, delta subunit precursor (TRAP-delta); InterPro: IPR008855 This family consists of several eukaryotic translocon-associated protein, delta subunit precursors (TRAP-delta or SSR-delta) Back     alignment and domain information
>KOG1692|consensus Back     alignment and domain information
>PF01483 P_proprotein: Proprotein convertase P-domain; InterPro: IPR002884 This domain, termed the P domain is approximately 150 amino acids in length and C-terminal to a serine endopeptidase domain which belong to MEROPS peptidase family S8 (clan SB), subfamily S8B (kexin) Back     alignment and domain information
>COG1470 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK09619 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PRK12812 flgD flagellar basal body rod modification protein; Reviewed Back     alignment and domain information
>PF04151 PPC: Bacterial pre-peptidase C-terminal domain; InterPro: IPR007280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03096 nitroso_cyanin nitrosocyanin Back     alignment and domain information
>PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A Back     alignment and domain information
>PF07523 Big_3: Bacterial Ig-like domain (group 3); InterPro: IPR011080 This entry represents bacterial domains with an Ig-like fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-16
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-16
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-04
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-15
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-15
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-14
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 5e-14
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-14
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 6e-14
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 9e-14
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 9e-14
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-05
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 1e-13
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 7e-08
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 2e-13
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 5e-13
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 8e-13
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-12
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 2e-12
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 1e-11
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-12
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-12
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 1e-11
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 1e-11
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-11
2j3s_A 288 Filamin-A; cytoskeleton, phosphorylation, structur 9e-10
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 1e-08
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 1e-06
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-09
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-09
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 2e-08
1wlh_A 311 Gelation factor; ABP-120, filamin, immunoglobulin 1e-04
1qfh_A212 Protein (gelation factor); actin binding protein, 3e-08
1qfh_A212 Protein (gelation factor); actin binding protein, 5e-05
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 7e-07
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 2e-04
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
 Score = 70.6 bits (173), Expect = 1e-16
 Identities = 26/107 (24%), Positives = 41/107 (38%), Gaps = 3/107 (2%)

Query: 38  CPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPV 97
            P++  V  P  G   S  G GL    +    +FT+ T        D+ +  P      +
Sbjct: 10  SPLQFYVNYPNSGS-VSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSK--AEI 66

Query: 98  RCYQQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDASK 144
            C   K       + PT  G Y I V    + + GSP+  ++ D S+
Sbjct: 67  SCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSR 113


>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 100.0
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 100.0
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 100.0
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 100.0
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 100.0
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 100.0
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 100.0
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 99.98
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.98
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.97
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.97
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.97
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 99.97
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 99.97
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.97
1qfh_A212 Protein (gelation factor); actin binding protein, 99.96
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 99.96
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 99.95
1wlh_A 311 Gelation factor; ABP-120, filamin, immunoglobulin 99.95
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.95
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 99.95
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 99.95
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.95
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.95
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 99.94
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.94
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.94
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.94
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.94
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 99.93
1qfh_A212 Protein (gelation factor); actin binding protein, 99.93
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 99.93
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.92
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 99.91
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 99.91
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.87
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.81
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 99.76
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.46
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.22
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.15
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 99.14
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.11
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.11
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.11
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.05
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.04
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.97
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 98.9
3tkv_A414 FDEC fragment B, attaching and effacing protein, p 98.87
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.87
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 98.84
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.79
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 98.73
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.71
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.7
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 98.68
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 98.67
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 98.64
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 98.64
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 98.63
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 98.62
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.57
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 98.5
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 98.43
3tkv_A414 FDEC fragment B, attaching and effacing protein, p 98.35
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 97.6
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 97.2
2p9r_A102 Alpha-2-M, alpha-2-macroglobulin; human alpha2-mac 95.61
4fxk_A 656 Complement C4 beta chain; immune system, proteolyt 94.97
1cwv_A 492 Invasin; integrin-binding protein, INV gene, struc 94.89
2hr0_A 645 Complement C3 beta chain; complement component C3B 94.62
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 94.14
1cwv_A 492 Invasin; integrin-binding protein, INV gene, struc 93.79
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 92.18
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 92.16
3idu_A127 Uncharacterized protein; all beta-protein, structu 91.0
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 90.91
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 89.8
3hrz_A 627 Cobra venom factor; serine protease, glycosilated, 88.65
3cu7_A 1676 Complement C5; Mg domain, inflammation, anaphylato 88.46
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 87.32
3c12_A138 FLGD, flagellar protein; HOOK capping, IG-like dom 87.24
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 86.29
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 85.89
4acq_A 1451 Alpha-2-macroglobulin; hydrolase inhibitor, protei 83.7
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 83.25
3osv_A138 Flagellar basal-BODY ROD modification protein FLG; 83.16
4fxk_A656 Complement C4 beta chain; immune system, proteolyt 81.88
4hci_A100 Cupredoxin 1; structural genomics, niaid, national 81.81
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 80.83
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 80.82
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
Probab=100.00  E-value=2.4e-38  Score=232.30  Aligned_cols=127  Identities=19%  Similarity=0.298  Sum_probs=121.7

Q ss_pred             ceeEEEEEEECCEEcCCCCeEEEecCCCCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCCccceEEE
Q psy15726         21 YGLVQARTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCY  100 (171)
Q Consensus        21 ~G~~~i~V~~~g~~I~gSPf~v~V~~~~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~~~~~~v~  100 (171)
                      .|-|+|+|+|||+||++|||.+.|.+..|+++|+++|+||+.+.+|++++|+|++++++.+.|.+.|.+|++  +++++.
T Consensus         2 ~~~~~i~v~~~g~~v~gsPf~v~v~~~~d~~~~~~~G~GL~~~~vg~~~~F~V~t~dag~~~l~v~v~gp~~--~~~~v~   79 (131)
T 2di9_A            2 SSGSSGDVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCE--AKIECS   79 (131)
T ss_dssp             CCCCCCCCCCCCCCCSSCTTSCSCCCCCCGGGCEEESHHHHEEETTSCEEEEEECTTTCSSCEEEEECSSSC--CEEEEE
T ss_pred             CCcEEEEEEECCEECCCCCEEEEEeCCCCccccEEECCccCccccCCeEEEEEEEcCCCCCeeEEEEEecCC--ceEEEE
Confidence            478999999999999999999999988999999999999999999999999999999999999999999987  577899


Q ss_pred             EcCCCEEEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEe---cCCCceEEec
Q psy15726        101 QQKFANLLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQV---YDASKVKIEH  149 (171)
Q Consensus       101 ~~~dg~y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V---~d~skv~~~G  149 (171)
                      |++||+|.|+|+|+++|.|.|+|+|+|+||+||||.++|   .|++||+++|
T Consensus        80 d~~dGty~v~Y~p~~~G~y~I~V~~~g~~I~gSPF~v~V~~~~d~~kv~~~G  131 (131)
T 2di9_A           80 DNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSSGPSSG  131 (131)
T ss_dssp             ECSSSEEEEEEECSSSSEEEEEEEESSCBCTTCSEEEEEECCCCCCCSSCCC
T ss_pred             ECCCCEEEEEEEeCCCeeEEEEEEECCEECCCcCEEEEECCCCCcceeEEEC
Confidence            999999999999999999999999999999999999999   6999999886



>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2p9r_A Alpha-2-M, alpha-2-macroglobulin; human alpha2-macroglobulin, Mg2 domain, X-RAY, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>4fxk_A Complement C4 beta chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_A* Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>2hr0_A Complement C3 beta chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2i07_A* 2wii_A* 2win_A* 2xwj_A* 3l3o_A* 3l5n_A* 3nms_A* 3nsa_A* 3ohx_A* 3t4a_A 2a74_A* 2a73_A* 2qki_A* 3g6j_A 2ice_A* 2icf_A* 2xwb_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3idu_A Uncharacterized protein; all beta-protein, structural genomics, PSI-2, protein structure initiative; 1.70A {Pyrococcus furiosus} PDB: 2kl6_A Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3hrz_A Cobra venom factor; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Naja kaouthia} PDB: 3frp_A* 3hs0_A* Back     alignment and structure
>3cu7_A Complement C5; Mg domain, inflammation, anaphylatoxin, cleavage of basic residues, complement alternate pathway, glycoprotein, immune response; HET: NAG; 3.10A {Homo sapiens} PDB: 3kls_A* 3km9_A* 4e0s_A* 3prx_A* 3pvm_A* 4a5w_A* 1xwe_A Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>3c12_A FLGD, flagellar protein; HOOK capping, IG-like domain, FN-III domain, tudor-like domain, flagellar biogenesis, flagellum; 2.51A {Xanthomonas campestris PV} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>4acq_A Alpha-2-macroglobulin; hydrolase inhibitor, proteinase inhibitor, irreversible PROT inhibitor, conformational change, blood plasma inhibitor; HET: MEQ NAG MAN; 4.30A {Homo sapiens} Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>3osv_A Flagellar basal-BODY ROD modification protein FLG; FLGD, flagellum, P. aeruginosa, structural protein; 2.35A {Pseudomonas aeruginosa} Back     alignment and structure
>4fxk_A Complement C4 beta chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_A* Back     alignment and structure
>4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 3e-16
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 7e-15
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 1e-14
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 4e-14
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 1e-13
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 1e-13
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 2e-13
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 2e-13
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 3e-13
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 7e-13
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 8e-13
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 3e-12
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 4e-12
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 6e-12
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 2e-05
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 8e-12
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 2e-11
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 2e-11
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 2e-09
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 1e-07
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: Filamin repeat (rod domain)
domain: Filamin b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.1 bits (166), Expect = 3e-16
 Identities = 18/90 (20%), Positives = 28/90 (31%)

Query: 56  SGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFANLLAEFTPTT 115
           SG GL   + G     +++          +   S  G    V     K       + P T
Sbjct: 10  SGPGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLT 69

Query: 116 TGVYKIDVLQGARPVRGSPYLCQVYDASKV 145
            G+Y + +  G   V   P   +V  A   
Sbjct: 70  AGMYTLTMKYGGELVPHFPARVKVEPAVDT 99


>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d2di9a1118 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2di8a198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2dj4a1101 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2diba1115 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2d7ma1102 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2w0pa192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1v05a_96 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2diaa1100 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2dmba1111 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2dmca1103 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2bp3a192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2dica198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2d7pa199 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2nqca197 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1qfha1104 F-actin cross-linking gelation factor (ABP-120) re 99.94
d1wlha1101 F-actin cross-linking gelation factor (ABP-120) re 99.92
d2j3sa288 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2d7na180 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1qfha2108 F-actin cross-linking gelation factor (ABP-120) re 99.81
d2di9a1118 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.32
d2dica198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2dj4a1101 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2diaa1100 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.94
d2w0pa192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2d7ma1102 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 98.88
d2j3sa288 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2di8a198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2diba1115 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.82
d2nqca197 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 98.77
d2d7pa199 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 98.75
d2bp3a192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1wlha1101 F-actin cross-linking gelation factor (ABP-120) re 98.7
d2dmca1103 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1v05a_96 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2d7na180 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 98.67
d2dmba1111 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1qfha2108 F-actin cross-linking gelation factor (ABP-120) re 98.6
d1qfha1104 F-actin cross-linking gelation factor (ABP-120) re 98.58
d1cwva3103 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 95.8
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 94.27
d1vjja399 Transglutaminase, two C-terminal domains {Human (H 93.59
d2q3za398 Transglutaminase, two C-terminal domains {Human (H 92.3
d1ex0a3100 Transglutaminase, two C-terminal domains {Human (H 90.41
d1wmda1116 Alkaline serine protease kp-43, C-terminal domain 88.29
d1g0da3101 Transglutaminase, two C-terminal domains {Red sea 85.43
d1f00i195 Intimin {Escherichia coli [TaxId: 562]} 83.32
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 82.27
d1ibya_112 Red copper protein nitrosocyanin {Nitrosomonas eur 82.09
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 81.11
d1cwva194 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 80.83
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: Filamin repeat (rod domain)
domain: Filamin b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3e-35  Score=210.17  Aligned_cols=114  Identities=19%  Similarity=0.318  Sum_probs=108.1

Q ss_pred             EEEECCEEcCCCCeEEEecCCCCCCCcEEEcCCCcceEeCCeEEEEEEeCCCcCCceEEEEECCCCCccceEEEEcCCCE
Q psy15726         27 RTLREETSFRSCPMEVPVVDPAVGREPSGSGLGLYQARSGIVNSFTLETCGVASSEFDVIVTSPQGAAVPVRCYQQKFAN  106 (171)
Q Consensus        27 ~V~~~g~~I~gSPf~v~V~~~~d~~~v~v~G~Gl~~~~vg~~~~F~V~~~~ag~~~l~v~i~~p~g~~~~~~v~~~~dg~  106 (171)
                      +|+|||++|+||||.+.|.+..|+++|+++|+||+.+.+|++++|+|+++++|.++|++.|.+|++  +++++.+++||+
T Consensus         1 ~V~~~g~~v~gSPf~~~v~~~~d~~kv~v~G~Gl~~~~vg~~~~F~Vd~~~ag~g~l~v~i~~p~~--~~~~v~~~~dG~   78 (118)
T d2di9a1           1 DVTYDGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCE--AKIECSDNGDGT   78 (118)
T ss_dssp             CCCCCCCCCSSCTTSCSCCCCCCGGGCEEESHHHHEEETTSCEEEEEECTTTCSSCEEEEECSSSC--CEEEEEECSSSE
T ss_pred             CeeECCEECCCCCEEEEEcCCCCccEEEEECCccCceeeeeeEEEEEEeCCCCCCccEEEEecCCc--eEEEEEECCCCE
Confidence            478999999999999999998999999999999999999999999999999999999999999987  467899999999


Q ss_pred             EEEEEEcCCCeeEEEEEEECCEEcCCCCeEEEecCC
Q psy15726        107 LLAEFTPTTTGVYKIDVLQGARPVRGSPYLCQVYDA  142 (171)
Q Consensus       107 y~v~y~P~~~G~~~i~V~~~g~~I~gSPF~v~V~d~  142 (171)
                      |.++|+|.++|.|+|+|+|+|++|+||||+++|.|+
T Consensus        79 y~v~ytP~~~G~y~i~V~~~g~~i~gSPf~v~V~~~  114 (118)
T d2di9a1          79 CSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMP  114 (118)
T ss_dssp             EEEEEECSSSSEEEEEEEESSCBCTTCSEEEEEECC
T ss_pred             EEEEEEeCCcEeEEEEEEECCEECCCCCEEEEEeCC
Confidence            999999999999999999999999999999999443



>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} Back     information, alignment and structure
>d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} Back     information, alignment and structure
>d1wmda1 b.18.1.20 (A:319-434) Alkaline serine protease kp-43, C-terminal domain {Bacillus sp. KSM-KP43 [TaxId: 109322]} Back     information, alignment and structure
>d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major) [TaxId: 143350]} Back     information, alignment and structure
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure