Psyllid ID: psy15872
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| 328717441 | 439 | PREDICTED: hypothetical protein LOC10016 | 0.510 | 0.111 | 0.877 | 2e-20 | |
| 321462594 | 317 | hypothetical protein DAPPUDRAFT_23773 [D | 0.520 | 0.157 | 0.725 | 4e-15 | |
| 195056305 | 987 | GH22848 [Drosophila grimshawi] gi|193899 | 0.510 | 0.049 | 0.653 | 6e-14 | |
| 194756456 | 941 | GF11481 [Drosophila ananassae] gi|190621 | 0.510 | 0.052 | 0.632 | 8e-14 | |
| 19921934 | 918 | CG1688 [Drosophila melanogaster] gi|5052 | 0.510 | 0.053 | 0.632 | 1e-13 | |
| 195475128 | 919 | GE22083 [Drosophila yakuba] gi|194175937 | 0.510 | 0.053 | 0.632 | 1e-13 | |
| 195381115 | 958 | GJ20830 [Drosophila virilis] gi|19414409 | 0.510 | 0.051 | 0.632 | 1e-13 | |
| 195332913 | 919 | GM20581 [Drosophila sechellia] gi|194125 | 0.510 | 0.053 | 0.632 | 1e-13 | |
| 194858339 | 911 | GG25264 [Drosophila erecta] gi|190661023 | 0.510 | 0.053 | 0.632 | 1e-13 | |
| 195431928 | 1004 | GK15616 [Drosophila willistoni] gi|19416 | 0.510 | 0.048 | 0.632 | 2e-13 |
| >gi|328717441|ref|XP_001952545.2| PREDICTED: hypothetical protein LOC100167612 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 102 bits (255), Expect = 2e-20, Method: Composition-based stats.
Identities = 43/49 (87%), Positives = 46/49 (93%)
Query: 18 GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ 66
GYIC+GA VFAAWE W+F+DGAYFCFVTLSTIGFGDLVPGKSFQ TDTQ
Sbjct: 333 GYICLGAAVFAAWEGWTFIDGAYFCFVTLSTIGFGDLVPGKSFQGTDTQ 381
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321462594|gb|EFX73616.1| hypothetical protein DAPPUDRAFT_23773 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|195056305|ref|XP_001995051.1| GH22848 [Drosophila grimshawi] gi|193899257|gb|EDV98123.1| GH22848 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|194756456|ref|XP_001960493.1| GF11481 [Drosophila ananassae] gi|190621791|gb|EDV37315.1| GF11481 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|19921934|ref|NP_610516.1| CG1688 [Drosophila melanogaster] gi|5052538|gb|AAD38599.1|AF145624_1 BcDNA.GH04802 [Drosophila melanogaster] gi|7303857|gb|AAF58903.1| CG1688 [Drosophila melanogaster] gi|220943664|gb|ACL84375.1| CG1688-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|195475128|ref|XP_002089836.1| GE22083 [Drosophila yakuba] gi|194175937|gb|EDW89548.1| GE22083 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195381115|ref|XP_002049300.1| GJ20830 [Drosophila virilis] gi|194144097|gb|EDW60493.1| GJ20830 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195332913|ref|XP_002033136.1| GM20581 [Drosophila sechellia] gi|194125106|gb|EDW47149.1| GM20581 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194858339|ref|XP_001969156.1| GG25264 [Drosophila erecta] gi|190661023|gb|EDV58215.1| GG25264 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195431928|ref|XP_002063979.1| GK15616 [Drosophila willistoni] gi|194160064|gb|EDW74965.1| GK15616 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 96 | ||||||
| FB|FBgn0027589 | 918 | CG1688 [Drosophila melanogaste | 0.510 | 0.053 | 0.632 | 1.4e-13 | |
| FB|FBgn0262685 | 385 | CG43155 [Drosophila melanogast | 0.718 | 0.179 | 0.458 | 3.2e-11 | |
| FB|FBgn0035192 | 729 | CG9194 [Drosophila melanogaste | 0.5 | 0.065 | 0.625 | 4.7e-11 | |
| UNIPROTKB|Q9ERU4 | 179 | Kcnk6 "Protein Kcnk6" [Rattus | 0.427 | 0.229 | 0.619 | 4.9e-11 | |
| FB|FBgn0033257 | 395 | CG8713 [Drosophila melanogaste | 0.416 | 0.101 | 0.65 | 5.6e-11 | |
| WB|WBGene00010784 | 372 | twk-48 [Caenorhabditis elegans | 0.562 | 0.145 | 0.490 | 2.9e-10 | |
| RGD|621450 | 313 | Kcnk6 "potassium channel, subf | 0.427 | 0.130 | 0.619 | 7.2e-10 | |
| UNIPROTKB|G3V8R8 | 313 | Kcnk6 "RCG53580, isoform CRA_c | 0.427 | 0.130 | 0.619 | 7.2e-10 | |
| WB|WBGene00006690 | 676 | twk-39 [Caenorhabditis elegans | 0.541 | 0.076 | 0.509 | 8.1e-10 | |
| UNIPROTKB|E1BYI0 | 374 | LOC100859545 "Uncharacterized | 0.395 | 0.101 | 0.605 | 7.6e-09 |
| FB|FBgn0027589 CG1688 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 189 (71.6 bits), Expect = 1.4e-13, P = 1.4e-13
Identities = 31/49 (63%), Positives = 38/49 (77%)
Query: 19 YICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQI 67
YIC+G +FA WE WS +DGAYFCFVTLSTIG+GD VP +SF + Q+
Sbjct: 827 YICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQL 875
|
|
| FB|FBgn0262685 CG43155 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0035192 CG9194 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ERU4 Kcnk6 "Protein Kcnk6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033257 CG8713 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00010784 twk-48 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|621450 Kcnk6 "potassium channel, subfamily K, member 6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V8R8 Kcnk6 "RCG53580, isoform CRA_c" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006690 twk-39 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYI0 LOC100859545 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| pfam07885 | 74 | pfam07885, Ion_trans_2, Ion channel | 2e-09 | |
| PRK10537 | 393 | PRK10537, PRK10537, voltage-gated potassium channe | 0.001 |
| >gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel | Back alignment and domain information |
|---|
Score = 49.1 bits (118), Expect = 2e-09
Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 3/42 (7%)
Query: 19 YICIGAGVFAAWEE---WSFLDGAYFCFVTLSTIGFGDLVPG 57
+ G ++ EE W FLD YF FVTL+TIG+GD+VP
Sbjct: 6 VLIFGTVYYSLEEEGWGWDFLDALYFSFVTLTTIGYGDIVPL 47
|
This family includes the two membrane helix type ion channels found in bacteria. Length = 74 |
| >gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.68 | |
| KOG4404|consensus | 350 | 99.55 | ||
| KOG1419|consensus | 654 | 99.45 | ||
| KOG3713|consensus | 477 | 99.43 | ||
| KOG1545|consensus | 507 | 99.3 | ||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.29 | |
| KOG1418|consensus | 433 | 99.25 | ||
| KOG4404|consensus | 350 | 99.24 | ||
| KOG1418|consensus | 433 | 99.12 | ||
| KOG1420|consensus | 1103 | 98.95 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.94 | |
| KOG4390|consensus | 632 | 98.84 | ||
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 98.17 | |
| KOG3684|consensus | 489 | 98.14 | ||
| KOG3193|consensus | 1087 | 97.96 | ||
| KOG0498|consensus | 727 | 97.87 | ||
| KOG0501|consensus | 971 | 97.6 | ||
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 96.03 | |
| KOG3827|consensus | 400 | 94.99 | ||
| KOG0500|consensus | 536 | 94.24 | ||
| KOG0499|consensus | 815 | 87.05 |
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
Probab=99.68 E-value=4.9e-17 Score=101.26 Aligned_cols=63 Identities=38% Similarity=0.604 Sum_probs=52.8
Q ss_pred HHHHHHHHhHHHHh---hhcCChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHhh
Q psy15872 16 QHGYICIGAGVFAA---WEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPT 78 (96)
Q Consensus 16 l~~~l~~ga~~~~~---~e~~s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~~ 78 (96)
++.++..++..+.. .|+|++.|++||+++|+|||||||+.|.++.||++++++++.|+.++.+
T Consensus 3 ~~~~l~~~~~~~~~~~~~~~~~~~da~yfs~~t~tTvGyGDi~p~t~~gr~~~~~~~~~G~~~~~~ 68 (79)
T PF07885_consen 3 LLLVLAFGAIFFYISEGSEKWSFIDALYFSFVTITTVGYGDIVPQTPAGRIFTIIYMLIGIFLFAL 68 (79)
T ss_dssp HHHHHHHHHHHHHHTTSSSTTSHHHHHHHHHHHHTT---SSSSTSSHHHHHHHHHHHHHHHHHHHH
T ss_pred EEeeeHHHHHHHHHHHhcccCCHHHHHHHHHHHHhcccCCCccCCccchHHHHHHHHHHHHHHHHH
Confidence 45566677777777 5679999999999999999999999999999999999999999998875
|
; PDB: 1KKD_A 2A0L_A 1ORQ_C 3UKM_C 1LNQ_E 3OUS_A 3LDC_A 3LDD_A 3RBZ_A 3LDE_A .... |
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >KOG1545|consensus | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG3827|consensus | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >KOG0499|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 96 | ||||
| 3ukm_A | 280 | Crystal Structure Of The Human Two Pore Domain Pota | 3e-07 | ||
| 3um7_A | 309 | Crystal Structure Of The Human Two Pore Domain K+ I | 7e-04 |
| >pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 | Back alignment and structure |
|
| >pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 96 | |||
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 6e-13 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 2e-12 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 4e-12 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 6e-12 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 2e-11 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 2e-11 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 3e-08 |
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 | Back alignment and structure |
|---|
Score = 61.4 bits (148), Expect = 6e-13
Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
Query: 15 CQHGYICIGAGVFAAWEE-WSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVI 71
+ I A VF+ E+ W+FL+ YFCF++LSTIG GD VPG+ + + ++ +
Sbjct: 181 TVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIG 238
|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.8 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.79 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.79 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.79 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.76 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.76 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.74 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.74 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.74 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.64 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.63 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.62 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.61 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.59 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.57 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.5 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.48 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.44 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.41 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.38 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.37 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.12 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 99.04 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 98.98 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 98.36 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 94.79 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 93.48 |
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
Probab=99.80 E-value=1.2e-19 Score=117.61 Aligned_cols=74 Identities=16% Similarity=0.135 Sum_probs=65.1
Q ss_pred HHHHHHHHHHHHHHHHHHHhHHHHhhhcC-------ChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHh
Q psy15872 5 DIEINAHSDRCQHGYICIGAGVFAAWEEW-------SFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRP 77 (96)
Q Consensus 5 ~~~~~~~~~~~l~~~l~~ga~~~~~~e~~-------s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~ 77 (96)
+++.....+..++.++++++.+++..|+| ++.||+||+++|+|||||||++|.++.||+++++++++|+.++.
T Consensus 4 ~~r~~l~~~~~~~~~~~~~a~~~~~~E~~~~~~~~~~~~~a~y~~~~T~tTvGyGDi~P~t~~gr~~~~~~~l~G~~~~~ 83 (103)
T 2k1e_A 4 HEREAQKAEEELQKVLEEASKKAVEAERGAPGAALISYPDAIWWSVETATTVGYGDRYPVTEEGRKVAEQVMKAGIEVFA 83 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCCGGGTTTTTTGGGGCCSCCSSCCCSSSCTHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHhhhhhccCCCCcccccHHHHHHHHHHHHhcccCCCCCCCChhHHHHHHHHHHHHHHHHH
Confidence 34445555666778888999999999986 99999999999999999999999999999999999999999986
Q ss_pred h
Q psy15872 78 T 78 (96)
Q Consensus 78 ~ 78 (96)
.
T Consensus 84 ~ 84 (103)
T 2k1e_A 84 L 84 (103)
T ss_dssp H
T ss_pred H
Confidence 5
|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 96 | ||||
| d1lnqa2 | 80 | f.14.1.1 (A:19-98) Potassium channel-related prote | 2e-11 |
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel-related protein MthK species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
Score = 52.8 bits (127), Expect = 2e-11
Identities = 18/58 (31%), Positives = 25/58 (43%)
Query: 18 GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISV 75
I G F E S+ Y+ FVT++T+G+GD P T IV+ I
Sbjct: 11 AVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGT 68
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 96 | |||
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.77 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.71 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.55 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.55 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 98.76 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.77 E-value=1.1e-19 Score=116.48 Aligned_cols=74 Identities=16% Similarity=0.178 Sum_probs=60.7
Q ss_pred HHHHHHHHHHHHHHHHHHHhHHHHhhhc-------CChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHh
Q psy15872 5 DIEINAHSDRCQHGYICIGAGVFAAWEE-------WSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRP 77 (96)
Q Consensus 5 ~~~~~~~~~~~l~~~l~~ga~~~~~~e~-------~s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~ 77 (96)
.-+.+...+..+++.+++++..++..|+ .++.||+||+++|+|||||||++|.|+.||+++.+.++.|+.++.
T Consensus 4 ~~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~ 83 (103)
T d1r3jc_ 4 HWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFG 83 (103)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHH
Confidence 3344444455556667778888877775 479999999999999999999999999999999999999998875
Q ss_pred h
Q psy15872 78 T 78 (96)
Q Consensus 78 ~ 78 (96)
.
T Consensus 84 ~ 84 (103)
T d1r3jc_ 84 L 84 (103)
T ss_dssp H
T ss_pred H
Confidence 4
|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|