Psyllid ID: psy15872


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MSSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYATGDQEETALT
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccHHHHccccHHHHHcc
ccccEEEEEccccccHHHHHHHHHHHHHHHccccHHccEEEHEEEHHHcccccccccccccccccccEEEEEEEEEHHHHHHHHHHHHHHHHHHcc
MSSYDIEINAhsdrcqhgyICIGAGVFAAWEEwsfldgayfcfvtlstigfgdlvpgksfqrtdtqIDIVIEIsvrptlgvrpryatgdqeetalt
MSSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKsfqrtdtqidivieisvrptlgvrpryatgdqeetalt
MSSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYATGDQEETALT
******EINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVR**************
**SYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYATGD**E****
MSSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYA**********
*SSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYATGDQEET*L*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYDIEINAHSDRCQHGYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPTLGVRPRYATGDQEETALT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q63ZI0 374 Potassium channel subfami N/A N/A 0.395 0.101 0.605 2e-09
Q9JL58 365 Potassium channel subfami yes N/A 0.437 0.115 0.571 9e-09
Q9NPC2 374 Potassium channel subfami yes N/A 0.395 0.101 0.605 9e-09
Q9ES08 396 Potassium channel subfami no N/A 0.437 0.106 0.523 3e-08
Q3LS21 402 Potassium channel subfami yes N/A 0.395 0.094 0.552 4e-08
O14649 394 Potassium channel subfami no N/A 0.437 0.106 0.470 5e-08
O35111 409 Potassium channel subfami no N/A 0.531 0.124 0.470 6e-08
O54912 411 Potassium channel subfami no N/A 0.531 0.124 0.470 6e-08
Q9Y257313 Potassium channel subfami no N/A 0.395 0.121 0.615 2e-07
Q9Z2T2336 Potassium channel subfami no N/A 0.458 0.130 0.488 9e-07
>sp|Q63ZI0|KCNK9_XENLA Potassium channel subfamily K member 9 OS=Xenopus laevis GN=kcnk9 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/38 (60%), Positives = 29/38 (76%)

Query: 18  GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLV 55
           G +CIGA  F+ +EEWSF    Y+CF+TL+TIGFGD V
Sbjct: 169 GTLCIGAAAFSHYEEWSFFQAYYYCFITLTTIGFGDYV 206




pH-dependent, voltage-insensitive, background potassium channel protein.
Xenopus laevis (taxid: 8355)
>sp|Q9JL58|KCNK9_CAVPO Potassium channel subfamily K member 9 OS=Cavia porcellus GN=KCNK9 PE=1 SV=1 Back     alignment and function description
>sp|Q9NPC2|KCNK9_HUMAN Potassium channel subfamily K member 9 OS=Homo sapiens GN=KCNK9 PE=1 SV=1 Back     alignment and function description
>sp|Q9ES08|KCNK9_RAT Potassium channel subfamily K member 9 OS=Rattus norvegicus GN=Kcnk9 PE=1 SV=2 Back     alignment and function description
>sp|Q3LS21|KCNK9_MOUSE Potassium channel subfamily K member 9 OS=Mus musculus GN=Kcnk9 PE=2 SV=1 Back     alignment and function description
>sp|O14649|KCNK3_HUMAN Potassium channel subfamily K member 3 OS=Homo sapiens GN=KCNK3 PE=1 SV=1 Back     alignment and function description
>sp|O35111|KCNK3_MOUSE Potassium channel subfamily K member 3 OS=Mus musculus GN=Kcnk3 PE=2 SV=2 Back     alignment and function description
>sp|O54912|KCNK3_RAT Potassium channel subfamily K member 3 OS=Rattus norvegicus GN=Kcnk3 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y257|KCNK6_HUMAN Potassium channel subfamily K member 6 OS=Homo sapiens GN=KCNK6 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2T2|KCNK1_RAT Potassium channel subfamily K member 1 OS=Rattus norvegicus GN=Kcnk1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
328717441 439 PREDICTED: hypothetical protein LOC10016 0.510 0.111 0.877 2e-20
321462594 317 hypothetical protein DAPPUDRAFT_23773 [D 0.520 0.157 0.725 4e-15
195056305 987 GH22848 [Drosophila grimshawi] gi|193899 0.510 0.049 0.653 6e-14
194756456 941 GF11481 [Drosophila ananassae] gi|190621 0.510 0.052 0.632 8e-14
19921934 918 CG1688 [Drosophila melanogaster] gi|5052 0.510 0.053 0.632 1e-13
195475128 919 GE22083 [Drosophila yakuba] gi|194175937 0.510 0.053 0.632 1e-13
195381115 958 GJ20830 [Drosophila virilis] gi|19414409 0.510 0.051 0.632 1e-13
195332913 919 GM20581 [Drosophila sechellia] gi|194125 0.510 0.053 0.632 1e-13
194858339 911 GG25264 [Drosophila erecta] gi|190661023 0.510 0.053 0.632 1e-13
195431928 1004 GK15616 [Drosophila willistoni] gi|19416 0.510 0.048 0.632 2e-13
>gi|328717441|ref|XP_001952545.2| PREDICTED: hypothetical protein LOC100167612 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 43/49 (87%), Positives = 46/49 (93%)

Query: 18  GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQ 66
           GYIC+GA VFAAWE W+F+DGAYFCFVTLSTIGFGDLVPGKSFQ TDTQ
Sbjct: 333 GYICLGAAVFAAWEGWTFIDGAYFCFVTLSTIGFGDLVPGKSFQGTDTQ 381




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321462594|gb|EFX73616.1| hypothetical protein DAPPUDRAFT_23773 [Daphnia pulex] Back     alignment and taxonomy information
>gi|195056305|ref|XP_001995051.1| GH22848 [Drosophila grimshawi] gi|193899257|gb|EDV98123.1| GH22848 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194756456|ref|XP_001960493.1| GF11481 [Drosophila ananassae] gi|190621791|gb|EDV37315.1| GF11481 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|19921934|ref|NP_610516.1| CG1688 [Drosophila melanogaster] gi|5052538|gb|AAD38599.1|AF145624_1 BcDNA.GH04802 [Drosophila melanogaster] gi|7303857|gb|AAF58903.1| CG1688 [Drosophila melanogaster] gi|220943664|gb|ACL84375.1| CG1688-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195475128|ref|XP_002089836.1| GE22083 [Drosophila yakuba] gi|194175937|gb|EDW89548.1| GE22083 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195381115|ref|XP_002049300.1| GJ20830 [Drosophila virilis] gi|194144097|gb|EDW60493.1| GJ20830 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195332913|ref|XP_002033136.1| GM20581 [Drosophila sechellia] gi|194125106|gb|EDW47149.1| GM20581 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194858339|ref|XP_001969156.1| GG25264 [Drosophila erecta] gi|190661023|gb|EDV58215.1| GG25264 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195431928|ref|XP_002063979.1| GK15616 [Drosophila willistoni] gi|194160064|gb|EDW74965.1| GK15616 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0027589918 CG1688 [Drosophila melanogaste 0.510 0.053 0.632 1.4e-13
FB|FBgn0262685385 CG43155 [Drosophila melanogast 0.718 0.179 0.458 3.2e-11
FB|FBgn0035192729 CG9194 [Drosophila melanogaste 0.5 0.065 0.625 4.7e-11
UNIPROTKB|Q9ERU4179 Kcnk6 "Protein Kcnk6" [Rattus 0.427 0.229 0.619 4.9e-11
FB|FBgn0033257395 CG8713 [Drosophila melanogaste 0.416 0.101 0.65 5.6e-11
WB|WBGene00010784372 twk-48 [Caenorhabditis elegans 0.562 0.145 0.490 2.9e-10
RGD|621450313 Kcnk6 "potassium channel, subf 0.427 0.130 0.619 7.2e-10
UNIPROTKB|G3V8R8313 Kcnk6 "RCG53580, isoform CRA_c 0.427 0.130 0.619 7.2e-10
WB|WBGene00006690676 twk-39 [Caenorhabditis elegans 0.541 0.076 0.509 8.1e-10
UNIPROTKB|E1BYI0 374 LOC100859545 "Uncharacterized 0.395 0.101 0.605 7.6e-09
FB|FBgn0027589 CG1688 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 189 (71.6 bits), Expect = 1.4e-13, P = 1.4e-13
 Identities = 31/49 (63%), Positives = 38/49 (77%)

Query:    19 YICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQI 67
             YIC+G  +FA WE WS +DGAYFCFVTLSTIG+GD VP +SF   + Q+
Sbjct:   827 YICVGTVIFALWENWSLVDGAYFCFVTLSTIGYGDFVPARSFNGPELQL 875




GO:0005267 "potassium channel activity" evidence=ISS
GO:0071805 "potassium ion transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
FB|FBgn0262685 CG43155 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0035192 CG9194 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ERU4 Kcnk6 "Protein Kcnk6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0033257 CG8713 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00010784 twk-48 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|621450 Kcnk6 "potassium channel, subfamily K, member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8R8 Kcnk6 "RCG53580, isoform CRA_c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00006690 twk-39 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYI0 LOC100859545 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JL58KCNK9_CAVPONo assigned EC number0.57140.43750.1150yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
pfam0788574 pfam07885, Ion_trans_2, Ion channel 2e-09
PRK10537 393 PRK10537, PRK10537, voltage-gated potassium channe 0.001
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
 Score = 49.1 bits (118), Expect = 2e-09
 Identities = 20/42 (47%), Positives = 26/42 (61%), Gaps = 3/42 (7%)

Query: 19 YICIGAGVFAAWEE---WSFLDGAYFCFVTLSTIGFGDLVPG 57
           +  G   ++  EE   W FLD  YF FVTL+TIG+GD+VP 
Sbjct: 6  VLIFGTVYYSLEEEGWGWDFLDALYFSFVTLTTIGYGDIVPL 47


This family includes the two membrane helix type ion channels found in bacteria. Length = 74

>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.68
KOG4404|consensus350 99.55
KOG1419|consensus 654 99.45
KOG3713|consensus477 99.43
KOG1545|consensus507 99.3
PRK10537 393 voltage-gated potassium channel; Provisional 99.29
KOG1418|consensus 433 99.25
KOG4404|consensus 350 99.24
KOG1418|consensus 433 99.12
KOG1420|consensus 1103 98.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 98.94
KOG4390|consensus 632 98.84
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 98.17
KOG3684|consensus 489 98.14
KOG3193|consensus 1087 97.96
KOG0498|consensus 727 97.87
KOG0501|consensus 971 97.6
PF00520200 Ion_trans: Ion transport protein calcium channel s 96.03
KOG3827|consensus 400 94.99
KOG0500|consensus 536 94.24
KOG0499|consensus 815 87.05
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
Probab=99.68  E-value=4.9e-17  Score=101.26  Aligned_cols=63  Identities=38%  Similarity=0.604  Sum_probs=52.8

Q ss_pred             HHHHHHHHhHHHHh---hhcCChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHhh
Q psy15872         16 QHGYICIGAGVFAA---WEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRPT   78 (96)
Q Consensus        16 l~~~l~~ga~~~~~---~e~~s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~~   78 (96)
                      ++.++..++..+..   .|+|++.|++||+++|+|||||||+.|.++.||++++++++.|+.++.+
T Consensus         3 ~~~~l~~~~~~~~~~~~~~~~~~~da~yfs~~t~tTvGyGDi~p~t~~gr~~~~~~~~~G~~~~~~   68 (79)
T PF07885_consen    3 LLLVLAFGAIFFYISEGSEKWSFIDALYFSFVTITTVGYGDIVPQTPAGRIFTIIYMLIGIFLFAL   68 (79)
T ss_dssp             HHHHHHHHHHHHHHTTSSSTTSHHHHHHHHHHHHTT---SSSSTSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEeeeHHHHHHHHHHHhcccCCHHHHHHHHHHHHhcccCCCccCCccchHHHHHHHHHHHHHHHHH
Confidence            45566677777777   5679999999999999999999999999999999999999999998875



; PDB: 1KKD_A 2A0L_A 1ORQ_C 3UKM_C 1LNQ_E 3OUS_A 3LDC_A 3LDD_A 3RBZ_A 3LDE_A ....

>KOG4404|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3ukm_A280 Crystal Structure Of The Human Two Pore Domain Pota 3e-07
3um7_A309 Crystal Structure Of The Human Two Pore Domain K+ I 7e-04
>pdb|3UKM|A Chain A, Crystal Structure Of The Human Two Pore Domain Potassium Ion Channel K2p1 (Twik-1) Length = 280 Back     alignment and structure

Iteration: 1

Score = 50.1 bits (118), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Query: 19 YICIGAGVFAAWEE-WSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQI 67 + I A VF+ E+ W+FL+ YFCF++LSTIG GD VPG+ + + ++ Sbjct: 185 FFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFREL 234
>pdb|3UM7|A Chain A, Crystal Structure Of The Human Two Pore Domain K+ Ion Channel Traak (K2p4.1) Length = 309 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3ukm_A280 Potassium channel subfamily K member 1; membrane p 6e-13
2q67_A114 Potassium channel protein; inverted teepee, helix 2e-12
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 4e-12
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 6e-12
3ouf_A97 Potassium channel protein; ION channel, membrane, 2e-11
3um7_A309 Potassium channel subfamily K member 4; potassium 2e-11
1lnq_A 336 MTHK channels, potassium channel related protein; 3e-08
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Length = 280 Back     alignment and structure
 Score = 61.4 bits (148), Expect = 6e-13
 Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 15  CQHGYICIGAGVFAAWEE-WSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVI 71
               +  I A VF+  E+ W+FL+  YFCF++LSTIG GD VPG+ + +   ++  + 
Sbjct: 181 TVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIG 238


>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Length = 309 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.8
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.79
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.79
2q67_A114 Potassium channel protein; inverted teepee, helix 99.79
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.76
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.76
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.74
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.74
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.74
3um7_A309 Potassium channel subfamily K member 4; potassium 99.64
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.63
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.62
3um7_A 309 Potassium channel subfamily K member 4; potassium 99.61
3ukm_A 280 Potassium channel subfamily K member 1; membrane p 99.59
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.57
1lnq_A 336 MTHK channels, potassium channel related protein; 99.5
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.48
1xl4_A 301 Inward rectifier potassium channel; integral membr 99.44
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 99.41
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.38
1p7b_A 333 Integral membrane channel and cytosolic domains; t 99.37
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.12
3sya_A 340 G protein-activated inward rectifier potassium CH; 99.04
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 98.98
3rvy_A285 ION transport protein; tetrameric ION channel, vol 98.36
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 94.79
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 93.48
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
Probab=99.80  E-value=1.2e-19  Score=117.61  Aligned_cols=74  Identities=16%  Similarity=0.135  Sum_probs=65.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHhhhcC-------ChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHh
Q psy15872          5 DIEINAHSDRCQHGYICIGAGVFAAWEEW-------SFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRP   77 (96)
Q Consensus         5 ~~~~~~~~~~~l~~~l~~ga~~~~~~e~~-------s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~   77 (96)
                      +++.....+..++.++++++.+++..|+|       ++.||+||+++|+|||||||++|.++.||+++++++++|+.++.
T Consensus         4 ~~r~~l~~~~~~~~~~~~~a~~~~~~E~~~~~~~~~~~~~a~y~~~~T~tTvGyGDi~P~t~~gr~~~~~~~l~G~~~~~   83 (103)
T 2k1e_A            4 HEREAQKAEEELQKVLEEASKKAVEAERGAPGAALISYPDAIWWSVETATTVGYGDRYPVTEEGRKVAEQVMKAGIEVFA   83 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCCGGGTTTTTTGGGGCCSCCSSCCCSSSCTHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhhhccCCCCcccccHHHHHHHHHHHHhcccCCCCCCCChhHHHHHHHHHHHHHHHHH
Confidence            34445555666778888999999999986       99999999999999999999999999999999999999999986


Q ss_pred             h
Q psy15872         78 T   78 (96)
Q Consensus        78 ~   78 (96)
                      .
T Consensus        84 ~   84 (103)
T 2k1e_A           84 L   84 (103)
T ss_dssp             H
T ss_pred             H
Confidence            5



>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-11
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]
 Score = 52.8 bits (127), Expect = 2e-11
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 18 GYICIGAGVFAAWEEWSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISV 75
            I  G   F   E  S+    Y+ FVT++T+G+GD  P        T   IV+ I  
Sbjct: 11 AVIIYGTAGFHFIEGESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGT 68


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.77
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.71
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.55
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.55
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.76
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.77  E-value=1.1e-19  Score=116.48  Aligned_cols=74  Identities=16%  Similarity=0.178  Sum_probs=60.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHhHHHHhhhc-------CChhhhhhheeeeeeceecCCcccCCcchhHHHHHHHHHHHHHHh
Q psy15872          5 DIEINAHSDRCQHGYICIGAGVFAAWEE-------WSFLDGAYFCFVTLSTIGFGDLVPGKSFQRTDTQIDIVIEISVRP   77 (96)
Q Consensus         5 ~~~~~~~~~~~l~~~l~~ga~~~~~~e~-------~s~~da~Yf~~vTltTVGyGDi~P~t~~g~~~~~~~~~~gi~~i~   77 (96)
                      .-+.+...+..+++.+++++..++..|+       .++.||+||+++|+|||||||++|.|+.||+++.+.++.|+.++.
T Consensus         4 ~~r~~~~~~~~~~~~~~~~s~~~~~~e~~~~~~~~~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~   83 (103)
T d1r3jc_           4 HWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFG   83 (103)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCcccCchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHH
Confidence            3344444455556667778888877775       479999999999999999999999999999999999999998875


Q ss_pred             h
Q psy15872         78 T   78 (96)
Q Consensus        78 ~   78 (96)
                      .
T Consensus        84 ~   84 (103)
T d1r3jc_          84 L   84 (103)
T ss_dssp             H
T ss_pred             H
Confidence            4



>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure