Psyllid ID: psy15887

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MLERGRILPIEPLIGNIKTELSNHNDSIEDSSAKDSSSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEEcEEEEEEc
cccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHccccEEcc
mlergrilpiepliGNIKTelsnhndsiedssakdsssnskntknskrqrrqrthFTSQQLQELEATFArnrypdmstrEEIAMWTNLTEALRETHAYSYNFLI
mlergrilpiepligNIKTELSNHNDSiedssakdsssnskntknskrqrrqrthftsqqlqeleatfarnrypdmsTREEIAMWTNLTEALRETHAYSYNFLI
MLERGRILPIEPLIGNIKTELSNHNdsiedssakdsssnskntknskRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
********************************************************************************EIAMWTNLTEALRETHAYSYNF**
*******************************************************FTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
MLERGRILPIEPLIGNIKTELSNHN*********************************QQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
***************************************************QRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLERGRILPIEPLIGNIKTELSNHNDSIEDSSAKDSSSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query104 2.2.26 [Sep-21-2011]
O18400 509 Pituitary homeobox homolo no N/A 0.701 0.143 0.72 5e-22
Q9PWR3 326 Pituitary homeobox 2 OS=X N/A N/A 0.740 0.236 0.632 2e-21
O35160 302 Pituitary homeobox 3 OS=M yes N/A 0.644 0.221 0.705 4e-21
P81062 302 Pituitary homeobox 3 OS=R yes N/A 0.644 0.221 0.705 4e-21
O75364 302 Pituitary homeobox 3 OS=H yes N/A 0.644 0.221 0.705 6e-21
Q9W5Z2 314 Pituitary homeobox 2 OS=D yes N/A 0.596 0.197 0.761 5e-20
O93385 333 Pituitary homeobox 2 OS=G no N/A 0.538 0.168 0.746 9e-20
Q9I8K3 292 Pituitary homeobox 3 OS=X N/A N/A 0.653 0.232 0.676 2e-19
Q6QU75 293 Pituitary homeobox 3 OS=D no N/A 0.653 0.232 0.657 2e-19
Q9W751 305 Pituitary homeobox 1 OS=X N/A N/A 0.557 0.190 0.741 8e-19
>sp|O18400|PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster GN=Ptx1 PE=2 SV=2 Back     alignment and function desciption
 Score =  102 bits (255), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 57/75 (76%), Gaps = 2/75 (2%)

Query: 17  IKTELSNHNDSIEDSSAKDSSSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPDM 76
           IKTE  N + S  D     S    KN K +KRQRRQRTHFTSQQLQELE TF+RNRYPDM
Sbjct: 234 IKTE--NISSSGHDEPMTTSGEEPKNDKKNKRQRRQRTHFTSQQLQELEHTFSRNRYPDM 291

Query: 77  STREEIAMWTNLTEA 91
           STREEIAMWTNLTEA
Sbjct: 292 STREEIAMWTNLTEA 306
Appears to control physiological cell functions rather than pattern formation during embryogenesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q9PWR3|PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis GN=pitx2 PE=2 SV=1 Back     alignment and function description
>sp|O35160|PITX3_MOUSE Pituitary homeobox 3 OS=Mus musculus GN=Pitx3 PE=1 SV=1 Back     alignment and function description
>sp|P81062|PITX3_RAT Pituitary homeobox 3 OS=Rattus norvegicus GN=Pitx3 PE=1 SV=2 Back     alignment and function description
>sp|O75364|PITX3_HUMAN Pituitary homeobox 3 OS=Homo sapiens GN=PITX3 PE=1 SV=1 Back     alignment and function description
>sp|Q9W5Z2|PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio GN=pitx2 PE=2 SV=1 Back     alignment and function description
>sp|O93385|PITX2_CHICK Pituitary homeobox 2 OS=Gallus gallus GN=PITX2 PE=2 SV=1 Back     alignment and function description
>sp|Q9I8K3|PITX3_XENLA Pituitary homeobox 3 OS=Xenopus laevis GN=pitx3 PE=2 SV=1 Back     alignment and function description
>sp|Q6QU75|PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio GN=pitx3 PE=2 SV=1 Back     alignment and function description
>sp|Q9W751|PITX1_XENLA Pituitary homeobox 1 OS=Xenopus laevis GN=pitx1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
193624928 429 PREDICTED: pituitary homeobox homolog Pt 0.711 0.172 0.723 5e-22
242017518 302 Pituitary homeobox, putative [Pediculus 0.673 0.231 0.712 3e-21
189234679 517 PREDICTED: similar to pituitary homeobox 0.653 0.131 0.72 3e-21
270002832 508 Ptx1 [Tribolium castaneum] 0.653 0.133 0.72 4e-21
357615722 377 pituitary homeobox1 [Danaus plexippus] 0.673 0.185 0.72 7e-21
198449449 588 GA13007 [Drosophila pseudoobscura pseudo 0.701 0.124 0.72 1e-20
195159085 589 GL13525 [Drosophila persimilis] gi|19411 0.701 0.123 0.72 1e-20
195061200 499 GH14222 [Drosophila grimshawi] gi|193891 0.701 0.146 0.72 1e-20
195113185 603 GI22129 [Drosophila mojavensis] gi|19391 0.701 0.121 0.72 1e-20
195452834 751 GK14162 [Drosophila willistoni] gi|19416 0.701 0.097 0.72 1e-20
>gi|193624928|ref|XP_001949221.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 1 [Acyrthosiphon pisum] gi|328705300|ref|XP_003242759.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 2 [Acyrthosiphon pisum] gi|328705302|ref|XP_003242760.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 59/76 (77%), Gaps = 2/76 (2%)

Query: 16  NIKTELSNHNDSIEDSSAKDSSSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPD 75
            IKTE  +    +     KD+  N KN KN+KRQRRQRTHFTSQQLQELEATF RNRYPD
Sbjct: 138 GIKTEGIDTGVGVVTDDGKDA--NIKNNKNTKRQRRQRTHFTSQQLQELEATFTRNRYPD 195

Query: 76  MSTREEIAMWTNLTEA 91
           MSTREEIAMWTNLTEA
Sbjct: 196 MSTREEIAMWTNLTEA 211

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242017518|ref|XP_002429235.1| Pituitary homeobox, putative [Pediculus humanus corporis] gi|212514124|gb|EEB16497.1| Pituitary homeobox, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189234679|ref|XP_970167.2| PREDICTED: similar to pituitary homeobox1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002832|gb|EEZ99279.1| Ptx1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357615722|gb|EHJ69804.1| pituitary homeobox1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|198449449|ref|XP_001357586.2| GA13007 [Drosophila pseudoobscura pseudoobscura] gi|198130612|gb|EAL26720.2| GA13007 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195159085|ref|XP_002020413.1| GL13525 [Drosophila persimilis] gi|194117182|gb|EDW39225.1| GL13525 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195061200|ref|XP_001995944.1| GH14222 [Drosophila grimshawi] gi|193891736|gb|EDV90602.1| GH14222 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195113185|ref|XP_002001149.1| GI22129 [Drosophila mojavensis] gi|193917743|gb|EDW16610.1| GI22129 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195452834|ref|XP_002073520.1| GK14162 [Drosophila willistoni] gi|194169605|gb|EDW84506.1| GK14162 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query104
UNIPROTKB|A5D7J4 325 PITX2 "Uncharacterized protein 0.423 0.135 0.954 4.6e-18
UNIPROTKB|E2R5R2 325 PITX2 "Uncharacterized protein 0.423 0.135 0.954 4.6e-18
UNIPROTKB|D6RBG8118 PITX2 "Pituitary homeobox 2" [ 0.423 0.372 0.954 4.6e-18
UNIPROTKB|D6RFI4 290 PITX2 "Pituitary homeobox 2" [ 0.423 0.151 0.954 4.6e-18
UNIPROTKB|Q99697 317 PITX2 "Pituitary homeobox 2" [ 0.423 0.138 0.954 4.6e-18
UNIPROTKB|F1S139 326 PITX2 "Uncharacterized protein 0.423 0.134 0.954 4.6e-18
MGI|MGI:109340 317 Pitx2 "paired-like homeodomain 0.423 0.138 0.954 4.6e-18
RGD|3331 324 Pitx2 "paired-like homeodomain 0.423 0.135 0.954 4.6e-18
ZFIN|ZDB-GENE-990714-27 314 pitx2 "paired-like homeodomain 0.423 0.140 0.954 4.6e-18
UNIPROTKB|O93385 333 PITX2 "Pituitary homeobox 2" [ 0.423 0.132 0.954 4.9e-18
UNIPROTKB|A5D7J4 PITX2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 42/44 (95%), Positives = 43/44 (97%)

Query:    48 RQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEA 91
             RQRRQRTHFTSQQLQELEATF RNRYPDMSTREEIA+WTNLTEA
Sbjct:    92 RQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEA 135
GO:0003350 "pulmonary myocardium development" evidence=IEA
GO:0003253 "cardiac neural crest cell migration involved in outflow tract morphogenesis" evidence=IEA
GO:0003171 "atrioventricular valve development" evidence=IEA
GO:0002074 "extraocular skeletal muscle development" evidence=IEA
GO:0001764 "neuron migration" evidence=IEA
GO:0001701 "in utero embryonic development" evidence=IEA
GO:0001570 "vasculogenesis" evidence=IEA
GO:0001569 "patterning of blood vessels" evidence=IEA
GO:0001191 "RNA polymerase II transcription factor binding transcription factor activity involved in negative regulation of transcription" evidence=IEA
GO:0001105 "RNA polymerase II transcription coactivator activity" evidence=IEA
GO:0001102 "RNA polymerase II activating transcription factor binding" evidence=IEA
GO:0001078 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription" evidence=IEA
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:2000288 "positive regulation of myoblast proliferation" evidence=IEA
GO:0070986 "left/right axis specification" evidence=IEA
GO:0061325 "cell proliferation involved in outflow tract morphogenesis" evidence=IEA
GO:0061072 "iris morphogenesis" evidence=IEA
GO:0061031 "endodermal digestive tract morphogenesis" evidence=IEA
GO:0060578 "superior vena cava morphogenesis" evidence=IEA
GO:0060577 "pulmonary vein morphogenesis" evidence=IEA
GO:0060460 "left lung morphogenesis" evidence=IEA
GO:0060412 "ventricular septum morphogenesis" evidence=IEA
GO:0055015 "ventricular cardiac muscle cell development" evidence=IEA
GO:0055009 "atrial cardiac muscle tissue morphogenesis" evidence=IEA
GO:0051219 "phosphoprotein binding" evidence=IEA
GO:0048557 "embryonic digestive tract morphogenesis" evidence=IEA
GO:0048536 "spleen development" evidence=IEA
GO:0043388 "positive regulation of DNA binding" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0042476 "odontogenesis" evidence=IEA
GO:0035993 "deltoid tuberosity development" evidence=IEA
GO:0035886 "vascular smooth muscle cell differentiation" evidence=IEA
GO:0035116 "embryonic hindlimb morphogenesis" evidence=IEA
GO:0031490 "chromatin DNA binding" evidence=IEA
GO:0031076 "embryonic camera-type eye development" evidence=IEA
GO:0030334 "regulation of cell migration" evidence=IEA
GO:0021983 "pituitary gland development" evidence=IEA
GO:0021855 "hypothalamus cell migration" evidence=IEA
GO:0021763 "subthalamic nucleus development" evidence=IEA
GO:0016055 "Wnt receptor signaling pathway" evidence=IEA
GO:0007520 "myoblast fusion" evidence=IEA
GO:0007368 "determination of left/right symmetry" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IEA
UNIPROTKB|E2R5R2 PITX2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D6RBG8 PITX2 "Pituitary homeobox 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RFI4 PITX2 "Pituitary homeobox 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q99697 PITX2 "Pituitary homeobox 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S139 PITX2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:109340 Pitx2 "paired-like homeodomain transcription factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3331 Pitx2 "paired-like homeodomain 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990714-27 pitx2 "paired-like homeodomain transcription factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O93385 PITX2 "Pituitary homeobox 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P56673PITX1_CHICKNo assigned EC number0.90900.42300.1414noN/A
O75364PITX3_HUMANNo assigned EC number0.70580.64420.2218yesN/A
O35160PITX3_MOUSENo assigned EC number0.70580.64420.2218yesN/A
P81062PITX3_RATNo assigned EC number0.70580.64420.2218yesN/A
P78337PITX1_HUMANNo assigned EC number0.90900.42300.1401noN/A
P52906UNC30_CAEELNo assigned EC number0.56710.63460.2043yesN/A
Q9W5Z2PITX2_DANRENo assigned EC number0.76190.59610.1974yesN/A
Q99NA7PITX1_RATNo assigned EC number0.90900.42300.1396noN/A
P70314PITX1_MOUSENo assigned EC number0.90900.42300.1396noN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-14
smart0038957 smart00389, HOX, Homeodomain 2e-11
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-11
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 61.0 bits (149), Expect = 4e-14
 Identities = 23/42 (54%), Positives = 28/42 (66%)

Query: 50 RRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEA 91
          RR+RT FT +QL+ELE  F +NRYP    REE+A    LTE 
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTER 42

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 104
KOG0842|consensus307 99.79
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.78
KOG0484|consensus125 99.75
KOG0850|consensus245 99.74
KOG0489|consensus261 99.74
KOG0487|consensus308 99.73
KOG0488|consensus309 99.73
KOG0843|consensus197 99.73
KOG0485|consensus 268 99.68
KOG0494|consensus 332 99.66
KOG2251|consensus 228 99.64
KOG0493|consensus342 99.62
KOG0492|consensus246 99.61
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.61
KOG0848|consensus317 99.56
COG5576156 Homeodomain-containing transcription factor [Trans 99.51
KOG0486|consensus 351 99.51
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.51
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.45
KOG0491|consensus194 99.44
KOG0844|consensus 408 99.41
KOG0490|consensus 235 99.36
KOG4577|consensus 383 99.34
KOG0483|consensus198 99.29
KOG0847|consensus288 99.21
KOG0849|consensus 354 99.18
KOG3802|consensus398 99.11
KOG1168|consensus385 98.5
KOG2252|consensus558 98.46
KOG0490|consensus235 98.38
KOG1146|consensus 1406 98.18
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.02
KOG0775|consensus304 97.88
KOG0774|consensus334 97.72
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.8
KOG3623|consensus 1007 95.82
KOG0773|consensus342 95.58
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 93.99
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 91.79
COG3413215 Predicted DNA binding protein [General function pr 84.55
>KOG0842|consensus Back     alignment and domain information 
Probab=99.79  E-value=2.4e-19  Score=127.90  Aligned_cols=56  Identities=27%  Similarity=0.392  Sum_probs=52.3

Q ss_pred             ccCcCCCCCCCCHHHHHHHHHHhhcCCCCCHHHHHHHHHHcCCCcCccceeeeccc
Q psy15887         46 SKRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSYN  101 (104)
Q Consensus        46 ~~~~rr~Rt~~t~~Q~~~L~~~F~~~~~p~~~~r~~La~~l~l~~~~VqvWFQN~~  101 (104)
                      ..++||.|..|+..|+.+||+.|...+|++..+|++||..|.|++.||||||||-.
T Consensus       150 ~~~kRKrRVLFSqAQV~ELERRFrqQRYLSAPERE~LA~~LrLT~TQVKIWFQNrR  205 (307)
T KOG0842|consen  150 KRKKRKRRVLFSQAQVYELERRFRQQRYLSAPEREHLASSLRLTPTQVKIWFQNRR  205 (307)
T ss_pred             cccccccccccchhHHHHHHHHHHhhhccccHhHHHHHHhcCCCchheeeeeecch
Confidence            45667788999999999999999999999999999999999999999999999964

>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 4e-18
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-17
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 1e-08
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 1e-08
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-07
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-07
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-07
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 7e-04
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure 
Iteration: 1

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 41/43 (95%), Positives = 42/43 (97%)
Query: 49 QRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEA 91
          QRRQRTHFTSQQLQELEATF RNRYPDMSTREEIA+WTNLTEA
Sbjct: 3  QRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEA 45
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query104
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 4e-22
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 5e-21
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-21
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-20
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-19
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-18
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 4e-18
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 4e-18
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 6e-18
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-18
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-17
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-15
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 4e-14
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 2e-13
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-13
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-13
1lfb_A99 Liver transcription factor (LFB1); transcription r 9e-13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 4e-12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-11
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 1e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-10
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-10
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-10
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-09
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-09
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 8e-09
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-09
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-08
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 5e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 8e-08
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-07
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-07
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 4e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-07
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 8e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-06
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-06
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-06
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-06
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 7e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-05
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 7e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-04
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 1e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score = 81.3 bits (201), Expect = 4e-22
 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 3/63 (4%)

Query: 29 EDSSAKDSSSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNL 88
          ED S  +S          ++QRR RT F++ QL ELE  F R +YPD+ TREE+A  TNL
Sbjct: 1  EDISDCESEPGIAL---KRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNL 57

Query: 89 TEA 91
          TEA
Sbjct: 58 TEA 60
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.86
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.85
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.84
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.83
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.82
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.81
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.81
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.8
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.8
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.8
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.79
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.79
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.79
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.78
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.78
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.78
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.78
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.78
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.78
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.78
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.77
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.77
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.77
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.77
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.77
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.77
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.77
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.76
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.76
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.76
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.76
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.76
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.75
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.74
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.73
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.73
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.72
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.72
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.72
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.72
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.71
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.7
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.7
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.7
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.7
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.69
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.68
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.68
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.68
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.68
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.68
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.67
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.67
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.66
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.66
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.64
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.64
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.61
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.59
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.55
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.52
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.49
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.48
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.25
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.25
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 97.72
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.63
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 89.06
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 88.15
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 83.92
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 82.78
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 82.71
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.86  E-value=1.1e-22  Score=114.87  Aligned_cols=60  Identities=15%  Similarity=0.202  Sum_probs=55.9

Q ss_pred             CccCcCCCCCCCCHHHHHHHHHHhhc-CCCCCHHHHHHHHHHcCCCcCccceeeecccccC
Q psy15887         45 NSKRQRRQRTHFTSQQLQELEATFAR-NRYPDMSTREEIAMWTNLTEALRETHAYSYNFLI  104 (104)
Q Consensus        45 ~~~~~rr~Rt~~t~~Q~~~L~~~F~~-~~~p~~~~r~~La~~l~l~~~~VqvWFQN~~~~~  104 (104)
                      ..+.+||.||.|+.+|+..|+..|+. ++||+...|+.||.++||++++|||||||..|.|
T Consensus         3 ~~~~~kR~RT~~s~eQL~~Lqs~f~~~~~yPd~~~r~~La~~tGL~~~~IqVWFQNrR~~~   63 (71)
T 1wi3_A            3 SGSSGPRSRTKISLEALGILQSFIHDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHV   63 (71)
T ss_dssp             CCCCCCCCCCCCCSHHHHHHHHHHHHHCSCCCHHHHHHHHHHSCCCHHHHHHHHHHHHHHC
T ss_pred             CCCCCCCCCccCCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCHHHHHHhhccceeee
Confidence            34568899999999999999999999 9999999999999999999999999999987754
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 104
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-12
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-11
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-10
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-10
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-10
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 7e-10
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-09
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-09
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-09
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 4e-09
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 8e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-08
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-08
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 5e-08
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-08
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 8e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 1e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-07
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-07
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-07
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-07
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-06
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 6e-06
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-05
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-05
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-05
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-05
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-05
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 0.002
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 55.2 bits (133), Expect = 3e-12
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 37 SSNSKNTKNSKRQRRQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEA 91
          ++ + N  +++  R++R  +T  Q  ELE  F  N Y     R E+A   NLTE 
Sbjct: 1  NNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTER 55
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query104
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.84
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.84
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.84
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.83
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.83
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.83
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.82
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.82
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.82
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.82
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.82
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.81
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.81
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.79
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.79
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.78
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.78
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.77
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.77
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.76
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.75
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.72
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.71
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.66
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.63
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.58
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.56
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.56
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.53
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.53
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 84.41
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Engrailed Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.84  E-value=2.3e-22  Score=108.48  Aligned_cols=50  Identities=32%  Similarity=0.400  Sum_probs=48.4

Q ss_pred             CCCCCCCHHHHHHHHHHhhcCCCCCHHHHHHHHHHcCCCcCccceeeecc
Q psy15887         51 RQRTHFTSQQLQELEATFARNRYPDMSTREEIAMWTNLTEALRETHAYSY  100 (104)
Q Consensus        51 r~Rt~~t~~Q~~~L~~~F~~~~~p~~~~r~~La~~l~l~~~~VqvWFQN~  100 (104)
                      |+||.||..|+..|+..|+.++||+..++.+||..+||++++|+|||||-
T Consensus         1 R~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~lgL~~~qV~vWFqNr   50 (53)
T d1p7ia_           1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNA   50 (53)
T ss_dssp             CCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CCCccCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChHHhhhccccc
Confidence            57999999999999999999999999999999999999999999999994
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure