Psyllid ID: psy15912
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| 328709438 | 759 | PREDICTED: H(+)/Cl(-) exchange transport | 0.755 | 0.479 | 0.459 | 1e-113 | |
| 328785199 | 807 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.452 | 0.438 | 1e-108 | |
| 380021098 | 805 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.453 | 0.438 | 1e-108 | |
| 307201523 | 805 | Chloride channel protein 7 [Harpegnathos | 0.757 | 0.453 | 0.436 | 1e-108 | |
| 322796366 | 775 | hypothetical protein SINV_06598 [Solenop | 0.757 | 0.470 | 0.440 | 1e-107 | |
| 340725063 | 803 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.454 | 0.424 | 1e-107 | |
| 350398489 | 802 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.455 | 0.426 | 1e-107 | |
| 345486889 | 824 | PREDICTED: H(+)/Cl(-) exchange transport | 0.748 | 0.438 | 0.429 | 1e-106 | |
| 383865255 | 806 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.452 | 0.430 | 1e-106 | |
| 383865253 | 809 | PREDICTED: H(+)/Cl(-) exchange transport | 0.757 | 0.451 | 0.430 | 1e-106 |
| >gi|328709438|ref|XP_001952257.2| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 414 bits (1064), Expect = e-113, Method: Compositional matrix adjust.
Identities = 221/481 (45%), Positives = 288/481 (59%), Gaps = 117/481 (24%)
Query: 2 KHAVQMYCGDGEYNTLAALWLQVPEKSVRTMLHDPKGAFGVFSLSVFVVTYFLLSVWTYG 61
K+ VQ+ C DGEYN++A+LWLQVPE SVR+ HDP + +L F ++++LL+ WTYG
Sbjct: 396 KNPVQLNCNDGEYNSMASLWLQVPEASVRSFFHDPTESLDATTLVYFAISFYLLTTWTYG 455
Query: 62 VSVSGGGMPEKYDFLSKDNVWKSNGKPRSLSEQLSDSGGVFIPCLLTGAAWGRLFSLFLQ 121
+SVS G +FIPCL TGAAWGRL L +Q
Sbjct: 456 LSVSAG---------------------------------LFIPCLATGAAWGRLIGLGVQ 482
Query: 122 SIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWI 181
+FP ID GKYAL+GAA+QLGG VRMTISLT+ILIEATG+I+FGLPLM+ L+TAKWI
Sbjct: 483 CVFPN---IDVGKYALVGAASQLGGAVRMTISLTVILIEATGDITFGLPLMICLLTAKWI 539
Query: 182 GDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNITARIVKSHPVICLRPLETVGNIIDVLKA 241
GD+FTE +YD+HIQLSGIPL+AWDPPPLSSNI A V SHPV + E+VG I+D LK
Sbjct: 540 GDYFTESIYDVHIQLSGIPLMAWDPPPLSSNIYASEVMSHPVTVFKSKESVGQIVDTLKK 599
Query: 242 TSHNGFPIVDVEPMTKHSSDGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKESPGRLVG 301
++NGFP+VD ST++ G+ +S GRL G
Sbjct: 600 YTYNGFPVVD---------------DVFSTETEGGN---------------NKSNGRLRG 629
Query: 302 LILRSQLIILIKHKIYKENQNWPDDQLSSEIFHAEYRCRPRIWSPGRLVGLILRSQLIIL 361
LILRSQLI+L+++K++ E P W
Sbjct: 630 LILRSQLIVLLQNKVFNE--------------------IPSAW----------------- 652
Query: 362 IKHKIYKENQNWPDDQLSSEIFHAEYPRYPSVNDLVVSENDRSFTVKLNLFMNTSPFSVQ 421
D +S F +YPRY +++++ V +N+R +TV L FMN SP+ VQ
Sbjct: 653 --------------DNVSLTTFRKDYPRYSNIDNIEVLDNERQYTVDLLRFMNPSPYVVQ 698
Query: 422 DSTSLPRVFKLFRALGLRHVVVVNNNNHVVGMITRKDLARYRVWRHGGRMGLEELKISST 481
SLPR+F+LFRA+GLRH+VVVN++N V G++TRKDL RYRVWRH G +G+EELK+S+
Sbjct: 699 HMASLPRIFRLFRAMGLRHIVVVNDSNEVTGVVTRKDLTRYRVWRHRGAIGVEELKVSAK 758
Query: 482 L 482
L
Sbjct: 759 L 759
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328785199|ref|XP_396520.3| PREDICTED: H(+)/Cl(-) exchange transporter 7 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380021098|ref|XP_003694411.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307201523|gb|EFN81286.1| Chloride channel protein 7 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322796366|gb|EFZ18907.1| hypothetical protein SINV_06598 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340725063|ref|XP_003400894.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350398489|ref|XP_003485207.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345486889|ref|XP_003425578.1| PREDICTED: H(+)/Cl(-) exchange transporter 7 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383865255|ref|XP_003708090.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383865253|ref|XP_003708089.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 482 | ||||||
| UNIPROTKB|P51798 | 805 | CLCN7 "H(+)/Cl(-) exchange tra | 0.325 | 0.195 | 0.603 | 1.5e-96 | |
| MGI|MGI:1347048 | 803 | Clcn7 "chloride channel 7" [Mu | 0.325 | 0.195 | 0.603 | 1.8e-96 | |
| ZFIN|ZDB-GENE-061103-196 | 795 | clcn7 "chloride channel 7" [Da | 0.323 | 0.196 | 0.616 | 2e-96 | |
| RGD|61836 | 803 | Clcn7 "chloride channel, volta | 0.325 | 0.195 | 0.597 | 3.2e-96 | |
| UNIPROTKB|E2R0Q0 | 747 | CLCN7 "Uncharacterized protein | 0.327 | 0.211 | 0.593 | 7.1e-96 | |
| UNIPROTKB|F1RG09 | 809 | LOC100626534 "Uncharacterized | 0.325 | 0.194 | 0.616 | 9.5e-96 | |
| UNIPROTKB|Q4PKH3 | 809 | CLCN7 "H(+)/Cl(-) exchange tra | 0.325 | 0.194 | 0.603 | 1.3e-94 | |
| WB|WBGene00000533 | 796 | clh-6 [Caenorhabditis elegans | 0.325 | 0.197 | 0.592 | 6.9e-83 | |
| UNIPROTKB|H0Y2M6 | 901 | CLCN7 "Chloride channel 7, iso | 0.325 | 0.174 | 0.603 | 3.3e-81 | |
| FB|FBgn0033755 | 813 | ClC-b "Chloride channel-b" [Dr | 0.325 | 0.193 | 0.531 | 1.3e-80 |
| UNIPROTKB|P51798 CLCN7 "H(+)/Cl(-) exchange transporter 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 502 (181.8 bits), Expect = 1.5e-96, Sum P(3) = 1.5e-96
Identities = 96/159 (60%), Positives = 121/159 (76%)
Query: 95 LSDSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISL 154
L+ S GVFIP LL GAAWGRLF + L + A W DPGKYAL+GAAAQLGG+VRMT+SL
Sbjct: 507 LTVSAGVFIPSLLIGAAWGRLFGISLSYLTGAAIWADPGKYALMGAAAQLGGIVRMTLSL 566
Query: 155 TIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNIT 214
T+I++EAT N+++G P+ML L+TAK +GD F EGLYD+HIQL +P L W+ P S ++T
Sbjct: 567 TVIMMEATSNVTYGFPIMLVLMTAKIVGDVFIEGLYDMHIQLQSVPFLHWEAPVTSHSLT 626
Query: 215 ARIVKSHPVICLRPLETVGNIIDVLK--ATSHNGFPIVD 251
AR V S PV CLR E VG I+DVL A++HNGFP+V+
Sbjct: 627 AREVMSTPVTCLRRREKVGVIVDVLSDTASNHNGFPVVE 665
|
|
| MGI|MGI:1347048 Clcn7 "chloride channel 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061103-196 clcn7 "chloride channel 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|61836 Clcn7 "chloride channel, voltage-sensitive 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0Q0 CLCN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RG09 LOC100626534 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4PKH3 CLCN7 "H(+)/Cl(-) exchange transporter 7" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000533 clh-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y2M6 CLCN7 "Chloride channel 7, isoform CRA_c" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033755 ClC-b "Chloride channel-b" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| cd03685 | 466 | cd03685, ClC_6_like, ClC-6-like chloride channel p | 1e-55 | |
| cd01036 | 416 | cd01036, ClC_euk, Chloride channel, ClC | 2e-31 | |
| cd03684 | 445 | cd03684, ClC_3_like, ClC-3-like chloride channel p | 6e-27 | |
| pfam00654 | 345 | pfam00654, Voltage_CLC, Voltage gated chloride cha | 3e-23 | |
| cd04591 | 105 | cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont | 2e-20 | |
| cd03683 | 426 | cd03683, ClC_1_like, ClC-1-like chloride channel p | 7e-20 | |
| cd00400 | 383 | cd00400, Voltage_gated_ClC, CLC voltage-gated chlo | 1e-15 | |
| COG0038 | 443 | COG0038, EriC, Chloride channel protein EriC [Inor | 1e-13 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 5e-11 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 4e-10 | |
| cd01031 | 402 | cd01031, EriC, ClC chloride channel EriC | 6e-10 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 6e-09 | |
| PRK05277 | 438 | PRK05277, PRK05277, chloride channel protein; Prov | 8e-08 | |
| PRK01862 | 574 | PRK01862, PRK01862, putative voltage-gated ClC-typ | 8e-08 | |
| cd01034 | 390 | cd01034, EriC_like, ClC chloride channel family | 2e-07 | |
| cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd c | 3e-07 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 6e-07 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 1e-06 | |
| cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd co | 1e-06 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 1e-06 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 7e-06 | |
| cd04582 | 106 | cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contain | 2e-05 | |
| cd04591 | 105 | cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont | 4e-05 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 5e-05 | |
| cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two | 7e-05 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 1e-04 | |
| cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after | 3e-04 | |
| cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd cont | 3e-04 | |
| cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two | 5e-04 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 7e-04 | |
| cd04603 | 111 | cd04603, CBS_pair_KefB_assoc, This cd contains two | 9e-04 | |
| cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after | 0.001 | |
| cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two | 0.001 | |
| cd04596 | 108 | cd04596, CBS_pair_DRTGG_assoc, This cd contains tw | 0.001 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 0.002 | |
| cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contai | 0.002 | |
| COG4109 | 432 | COG4109, COG4109, Predicted transcriptional regula | 0.002 | |
| PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent i | 0.003 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 0.003 | |
| cd04639 | 111 | cd04639, CBS_pair_26, The CBS domain, named after | 0.003 | |
| COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane p | 0.004 | |
| cd01033 | 388 | cd01033, ClC_like, Putative ClC chloride channel | 0.004 |
| >gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
Score = 192 bits (489), Expect = 1e-55
Identities = 71/159 (44%), Positives = 96/159 (60%), Gaps = 34/159 (21%)
Query: 44 SLSVFVVTYFLLSVWTYGVSVSGGGMPEKYDFLSKDNVWKSNGKPRSLSEQLSDSGGVFI 103
+L +F V Y+ L+ WT+G++V G +FI
Sbjct: 335 TLLIFFVLYYFLACWTFGIAVPSG---------------------------------LFI 361
Query: 104 PCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTIILIEATG 163
P +L GAA+GRL + L S F T IDPG YAL+GAAA LGGV+RMT+SLT+IL+E T
Sbjct: 362 PMILIGAAYGRLVGILLGSYF-GFTSIDPGLYALLGAAAFLGGVMRMTVSLTVILLELTN 420
Query: 164 NISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSGIPLL 202
N+++ P+ML L+ AKW+GD+F EG+YDI IQL G+P L
Sbjct: 421 NLTYLPPIMLVLMIAKWVGDYFNEGIYDIIIQLKGVPFL 459
|
This CD includes ClC-6, ClC-7 and ClC-B, C, D in plants. Proteins in this family are ubiquitous in eukarotes and their functions are unclear. They are expressed in intracellular organelles membranes. This family belongs to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. ClC chloride ion channel superfamily perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, and transepithelial transport in animals. Length = 466 |
| >gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC | Back alignment and domain information |
|---|
| >gnl|CDD|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238504 cd01031, EriC, ClC chloride channel EriC | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family | Back alignment and domain information |
|---|
| >gnl|CDD|239980 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239984 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239955 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|239957 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239996 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239985 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >gnl|CDD|239958 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|239976 cd04603, CBS_pair_KefB_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >gnl|CDD|240007 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239973 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >gnl|CDD|239969 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239956 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >gnl|CDD|226594 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|237843 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|225979 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| KOG0474|consensus | 762 | 100.0 | ||
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| KOG0475|consensus | 696 | 100.0 | ||
| KOG0476|consensus | 931 | 100.0 | ||
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 99.87 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 99.86 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 99.86 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.84 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 99.83 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 99.83 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 99.83 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 99.79 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 99.78 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 99.78 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.77 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 99.77 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 99.71 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.68 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.67 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.63 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.63 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.59 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 99.52 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.52 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.5 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.5 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.49 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.49 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.46 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.46 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.44 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.44 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.43 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.43 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.42 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.42 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 99.41 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.41 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.41 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.4 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.4 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.4 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.4 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.4 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.4 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.39 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.39 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.39 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.38 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.38 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.38 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.37 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.37 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.37 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.37 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.36 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.36 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.36 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.36 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.36 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.35 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.35 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.35 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.35 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.35 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.34 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.34 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.34 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.34 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.33 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.33 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.33 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.33 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.33 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.33 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.32 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.32 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.32 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.31 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.31 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.3 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.3 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.3 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.3 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.3 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.29 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.29 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.29 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.28 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.28 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.27 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.27 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.27 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.27 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.25 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.25 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.24 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.23 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.23 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.22 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.19 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.19 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.17 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.16 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.11 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.1 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.06 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.02 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.01 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 98.89 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.87 | |
| KOG2550|consensus | 503 | 98.83 | ||
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 98.78 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 98.66 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.63 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 98.59 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.52 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.5 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 98.46 | |
| KOG1764|consensus | 381 | 98.45 | ||
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 98.37 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 98.33 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 98.33 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.29 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.29 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 98.2 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 98.13 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 98.11 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 98.11 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.09 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.08 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.93 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.9 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 97.89 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.88 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 97.87 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.85 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.85 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.85 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.82 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.81 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.79 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.76 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.72 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.7 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.67 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.67 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.66 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.66 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.63 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.6 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.59 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.56 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.56 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.54 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.53 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.53 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.52 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.49 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.48 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.48 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.48 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.47 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.46 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.46 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.46 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.45 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.45 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.44 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.44 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.42 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.42 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.41 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.4 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.39 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.39 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.38 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.37 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.36 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.35 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.35 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.33 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.33 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.31 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.31 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.29 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.28 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 97.27 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.26 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.25 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.23 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.2 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.2 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.19 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.18 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.18 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.17 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.17 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.14 | |
| KOG1764|consensus | 381 | 97.13 | ||
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.11 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.1 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.09 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.08 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.07 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.07 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.05 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.04 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.99 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.97 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 96.9 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 96.89 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 96.83 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.82 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.74 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.74 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 96.72 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.71 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.68 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 96.5 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.33 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 95.87 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 95.35 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 94.96 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 94.63 | |
| KOG0474|consensus | 762 | 94.52 | ||
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 93.1 | |
| KOG2550|consensus | 503 | 92.26 | ||
| KOG0475|consensus | 696 | 91.43 | ||
| KOG0476|consensus | 931 | 89.09 | ||
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 88.35 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 87.49 | |
| KOG2118|consensus | 498 | 81.31 |
| >KOG0474|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.7e-62 Score=501.81 Aligned_cols=351 Identities=49% Similarity=0.870 Sum_probs=312.0
Q ss_pred CceeecCCCccchHHHHHccCchHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHhccccccCCCchhhhhhhccccccc
Q psy15912 4 AVQMYCGDGEYNTLAALWLQVPEKSVRTMLHDPKGAFGVFSLSVFVVTYFLLSVWTYGVSVSGGGMPEKYDFLSKDNVWK 83 (482)
Q Consensus 4 ~~~~~c~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~g~G~~~~~~~l~~~~~~~ 83 (482)
..+|+||+|+|||+|++||+.++++|++|||++.+.|+..+|.+|+++|++++++|||+.+|
T Consensus 411 ~p~f~Cp~~~YNdlAtL~fnt~ddaVrnLFh~~~~ef~~~tL~iFfv~yf~L~~~TfGi~vp------------------ 472 (762)
T KOG0474|consen 411 CPTFFCPDGEYNDLATLFFNTNDDAVRNLFHSPTNEFGILTLAIFFVLYFFLACWTFGIAVP------------------ 472 (762)
T ss_pred CccccCCCCchhHHHHHHcCCcHHHHHHHhcCCCCccchhHHHHHHHHHHHHHHHHhccccc------------------
Confidence 35689999999999999999999999999999889999999999999999999999999999
Q ss_pred cCCCcccccccCCCCcceehHHHHHHHHHHHHHHHHHHHhcCCCCCCchhHHHHHHHHHHhhhhhchhHHHHHHHHHhhC
Q psy15912 84 SNGKPRSLSEQLSDSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTIILIEATG 163 (482)
Q Consensus 84 ~~~~~~~~~~~~G~~gG~f~Psl~iGa~~G~~~g~~~~~~~~~~~~~~~~~~a~vG~aa~~~g~~~~p~s~~vi~~Eltg 163 (482)
.|+|+|++.+||+.||++|.++..++ +++|+.||++|+||++||++||++|.+||++|+|
T Consensus 473 ---------------sGlFiP~iL~GAa~GRlvg~~l~~~~----~id~G~yAllGAAa~LGG~mRMTvSL~VIl~E~T- 532 (762)
T KOG0474|consen 473 ---------------SGLFIPVILTGAAYGRLVGMLLGSYT----NIDPGLYALLGAAAFLGGVMRMTVSLCVILLELT- 532 (762)
T ss_pred ---------------ccchhHHHHhhHHHHHHHHHHHHHhh----ccCchHHHHHhHHHHhCCeEEEEeeeehHHHHhh-
Confidence 99999999999999999999998776 3799999999999999999999999999999999
Q ss_pred CchhhHHHHHHHHHHHHHhhhcCCChhHHHHHHcCCCCCCCCCCCCccccchhhcccCCeeEecCCCCHHHHHHHHHhCC
Q psy15912 164 NISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNITARIVKSHPVICLRPLETVGNIIDVLKATS 243 (482)
Q Consensus 164 ~~~~~~Pl~ia~~ia~~v~~~~~~siy~~~L~~~g~p~l~~~~~~~l~~l~a~dvM~~~~~~l~~~~~i~~~~~~l~~~~ 243 (482)
+..+.+|+|++.++|++|++.|++++||.+++.+|+|+++.++++.+++++|+|+|++++++++..++++.++++|+++.
T Consensus 533 n~~~~lPiMlvLliaK~VGD~FNegiYd~~i~LkgvP~Le~~pe~~mr~L~a~ev~~~pvi~l~~~ekV~~Iv~vLk~t~ 612 (762)
T KOG0474|consen 533 NNLLLLPIMLVLLIAKTVGDSFNEGIYDIIIQLKGVPFLEWEPEPYMRNLTAGEVMSKPVICLNRVEKVAVIVDVLKSTN 612 (762)
T ss_pred hhhhhhHHHHHHHHHHHHHhhhhhhhHHHhhhccCCccccCCCchHhhhhhHhhhccCCeEEEechhhHHHHHHHHHhcC
Confidence 77899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCeeeEecCCCCCCCCCCCccccCCCCCCCCCCCCccccCCCCCCCCCCCCCCCeEEEEEeHHHHHHHHHhhhhccCCCC
Q psy15912 244 HNGFPIVDVEPMTKHSSDGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKESPGRLVGLILRSQLIILIKHKIYKENQNW 323 (482)
Q Consensus 244 ~~~fPVVd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lvGiIs~~dL~~~l~~~~~~~~~~~ 323 (482)
||+|||||+.+. .+.+++.|+|.|++++.+++++.+.+...+
T Consensus 613 HngFPVvd~~~~--------------------------------------~~~~~l~GlILRshl~vlL~~~~f~~~~~~ 654 (762)
T KOG0474|consen 613 HNGFPVVDEPPS--------------------------------------NEAGRLHGLILRSHLLVLLKKRVFVEESRS 654 (762)
T ss_pred cCCCccccCCCC--------------------------------------ccchhhhHHHHHHHHHHHHHhhhhhccCcc
Confidence 999999998631 001479999999999998887654322111
Q ss_pred CCccchhhhhhhccccccccCCCCccccchhhHHHHHHHHhhhhccCCCCCCCCCChhhhhhhCCCCCCCCccccCcccc
Q psy15912 324 PDDQLSSEIFHAEYRCRPRIWSPGRLVGLILRSQLIILIKHKIYKENQNWPDDQLSSEIFHAEYPRYPSVNDLVVSENDR 403 (482)
Q Consensus 324 p~~~~~~~~~~~~~~~~~~~~~~~~~~G~i~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 403 (482)
..+ |+. .+...+++.+++.++++++.++++++
T Consensus 655 ~~~----------------------------------------------~~~--~~~~~~~d~a~r~~~i~dv~lt~~e~ 686 (762)
T KOG0474|consen 655 TFD----------------------------------------------LPV--RRKFTFRDFAKREPSIEDVHLTSEEM 686 (762)
T ss_pred ccC----------------------------------------------cch--hhcCCHHHhhhcCCchhhhhcchHhH
Confidence 000 111 12234455567888999999999999
Q ss_pred ccccccccccccCceeeeCCCCHHHHHHHHHHcCCCEEEEECCCCeEEEEEeHHHhHHHHHhhcccccccccccccc
Q psy15912 404 SFTVKLNLFMNTSPFSVQDSTSLPRVFKLFRALGLRHVVVVNNNNHVVGMITRKDLARYRVWRHGGRMGLEELKISS 480 (482)
Q Consensus 404 ~~~i~v~~im~~~p~~V~~~~~l~~a~~~f~~~~lr~lpVVD~~g~lvGIITr~DLl~~~~~~~~~~~~~~~~~~~~ 480 (482)
.+++|+.++|+++|++|++++++.+++.+||+.|+||+.||++.++++||+||+|+..++. .+....+++++++.
T Consensus 687 ~~yvDl~p~~n~sPytV~~~mSl~k~~~lFR~lGLRhLlVv~~~~~~~gilTR~D~~~~~~--l~~~~~v~~~~~~~ 761 (762)
T KOG0474|consen 687 EMYVDLHPFMNPSPYTVPETMSLAKAFILFRQLGLRHLLVVPKTNRVVGILTRKDLARYRI--LGLEPHVDELKMGK 761 (762)
T ss_pred hhccccccccCCCCcccCcccchHHHHHHHHHhcceeEEEecCCCceeEEEehhhhhhHHH--hccccccccccccc
Confidence 9999999999999999999999999999999999999999999999999999999998873 33345567777654
|
|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >KOG0476|consensus | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0474|consensus | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >KOG0476|consensus | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2118|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 482 | ||||
| 3org_A | 632 | Crystal Structure Of A Eukaryotic Clc Transporter L | 6e-14 | ||
| 3ejy_A | 473 | Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE | 1e-04 | ||
| 2ht2_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 1kpk_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 1e-04 | ||
| 2exy_A | 473 | Crystal Structure Of The E148q Mutant Of Ecclc, Fab | 1e-04 | ||
| 2htk_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 3ejz_A | 473 | Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C | 1e-04 | ||
| 2ht3_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 2ez0_A | 473 | Crystal Structure Of The S107aE148QY445A MUTANT OF | 1e-04 | ||
| 2htl_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 3det_A | 473 | Structure Of The E418a, Y445a Doubly Ungated Mutant | 1e-04 | ||
| 1ots_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 2fec_A | 465 | Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE | 1e-04 | ||
| 1otu_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-04 | ||
| 4ftp_A | 465 | Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT | 2e-04 | ||
| 1ott_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-04 | ||
| 2ht4_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-04 | ||
| 3nmo_A | 465 | Crystal Structure Of An Engineered Monomeric Clc-Ec | 2e-04 | ||
| 4ene_A | 446 | Structure Of The N- And C-Terminal Trimmed Clc-Ec1 | 2e-04 | ||
| 2hlf_A | 444 | Structure Of The Escherichis Coli Clc Chloride Chan | 2e-04 | ||
| 2r9h_A | 444 | Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com | 2e-04 | ||
| 1kpl_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 3e-04 |
| >pdb|3ORG|A Chain A, Crystal Structure Of A Eukaryotic Clc Transporter Length = 632 | Back alignment and structure |
|
| >pdb|3EJY|A Chain A, Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTER, CLC- Ec1 Length = 473 | Back alignment and structure |
| >pdb|2HT2|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445h Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|1KPK|A Chain A, Crystal Structure Of The Clc Chloride Channel From E. Coli Length = 473 | Back alignment and structure |
| >pdb|2EXY|A Chain A, Crystal Structure Of The E148q Mutant Of Ecclc, Fab Complexed In Absence Of Bound Ions Length = 473 | Back alignment and structure |
| >pdb|2HTK|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445a Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3EJZ|A Chain A, Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, CLC-Ec1 Length = 473 | Back alignment and structure |
| >pdb|2HT3|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445l Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2EZ0|A Chain A, Crystal Structure Of The S107aE148QY445A MUTANT OF ECCLC, In Complex With A Fab Fragment Length = 473 | Back alignment and structure |
| >pdb|2HTL|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445f Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3DET|A Chain A, Structure Of The E418a, Y445a Doubly Ungated Mutant Of E.Coli Clc_ec1, Cl-H+ ANTIPORTER Length = 473 | Back alignment and structure |
| >pdb|1OTS|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|2FEC|A Chain A, Structure Of The E203q Mutant Of The Cl-H+ EXCHANGER CLC- Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTU|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148q Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|4FTP|A Chain A, Structure Of The E202y Mutant Of The Cl-H+ ANTIPORTER CLC-Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTT|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148a Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|2HT4|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445w Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3NMO|A Chain A, Crystal Structure Of An Engineered Monomeric Clc-Ec1 Cl-H+ Transporter Length = 465 | Back alignment and structure |
| >pdb|4ENE|A Chain A, Structure Of The N- And C-Terminal Trimmed Clc-Ec1 Cl-H+ ANTIPORTER And Fab Complex Length = 446 | Back alignment and structure |
| >pdb|2HLF|A Chain A, Structure Of The Escherichis Coli Clc Chloride Channel Y445e Mutant And Fab Complex Length = 444 | Back alignment and structure |
| >pdb|2R9H|A Chain A, Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Complex With Fab Length = 444 | Back alignment and structure |
| >pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 482 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 5e-68 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 3e-23 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 5e-15 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 1e-14 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 6e-14 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-10 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 2e-08 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 9e-08 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-10 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-07 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 5e-05 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 6e-10 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 2e-06 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 2e-09 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 8e-06 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-09 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 1e-07 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 3e-09 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 3e-04 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 6e-09 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 6e-05 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 1e-08 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 3e-08 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 1e-08 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 9e-07 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 3e-08 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 7e-05 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 4e-08 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 1e-07 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 4e-08 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 6e-06 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 5e-08 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 3e-06 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 5e-08 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 1e-07 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 8e-08 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 4e-06 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 1e-07 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 6e-07 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 1e-07 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 4e-04 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 2e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 3e-06 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 3e-07 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 7e-07 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 7e-07 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 1e-04 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 8e-07 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 3e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 1e-05 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 1e-06 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 6e-04 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 1e-06 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 2e-06 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 1e-06 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 3e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 5e-06 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 8e-06 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 6e-06 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 7e-06 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 2e-05 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 8e-05 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 3e-04 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 8e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
Score = 228 bits (583), Expect = 5e-68
Identities = 76/428 (17%), Positives = 138/428 (32%), Gaps = 122/428 (28%)
Query: 38 GAFGVFSLSVFVVTYFLLSVWTYGVSVSGGGMPEKYDFLSKDNVWKSNGKPRSLSEQLSD 97
FG L + + F+L + G+ + G
Sbjct: 314 DHFGWTELILMPIIKFILVALSIGLPLPAG------------------------------ 343
Query: 98 SGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTII 157
VF+P L GA +GRL+ ++ +F A I PG YA++GAAA GV R +S +I
Sbjct: 344 ---VFVPSFLIGAGFGRLYGELMRVVFGNA--IVPGSYAVVGAAAFTAGVTR-ALSCAVI 397
Query: 158 LIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNITARI 217
+ E TG I +P++++++ A +G+ F LY+ + + +P + S +TAR
Sbjct: 398 IFEVTGQIRHLVPVLISVLLAVIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEMTARE 457
Query: 218 V--KSHPVICLRPLETVGNIIDVL-KATSHNGFPIVDVEPMTKHSSDGAEQSSAGSTDSH 274
+ L P +I +L K + FP++D
Sbjct: 458 IMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVID----------------------- 494
Query: 275 KGDTSHKRDSSHKGDASRKESPGRLVGLILRSQLIILIKHKIYKENQNWPDDQLSSEIFH 334
+ G L+G I R +++ ++H + + + +
Sbjct: 495 --------------------ANGYLLGAISRKEIVDRLQHVLEDVPEPIAGHRTLVLLDA 534
Query: 335 AEYRCRPRIWSPGRLVGLILRSQLIILIKHKIYKENQNWPDDQLSSEIFHAEYPRYPSVN 394
A+ S +
Sbjct: 535 ADLSENIEGLVD--------------------------ETPSGEHSSKGKRTATVLEPTS 568
Query: 395 DLVVSENDRSFTVKLNLFMNTSPFSVQDSTSLPRVFKLFRALGLRHVVVVNNNNHVVGMI 454
LVV + V + + ++ LF L + V +VG++
Sbjct: 569 SLVVPCDVSPIVV-------------TSYSLVRQLHFLFVMLMPSMIYVT-ERGKLVGIV 614
Query: 455 TRKDLARY 462
R+D+A
Sbjct: 615 EREDVAYG 622
|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Length = 465 | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Length = 466 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* Length = 245 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 100.0 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 99.88 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 99.87 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 99.87 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.84 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.79 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.77 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.76 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.76 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.76 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.76 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.76 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.75 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.75 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.75 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.74 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.74 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.74 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.73 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.73 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.73 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.73 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.73 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.73 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.72 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.72 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.72 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.71 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.71 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.71 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.71 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.71 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.7 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.7 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.7 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.69 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.69 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.69 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.69 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.68 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.68 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.68 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.68 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.68 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.67 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.67 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.67 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.66 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.66 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.66 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.65 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.65 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.65 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.65 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.64 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.63 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.63 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.62 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.62 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.61 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.61 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.54 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.46 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.41 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.4 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.37 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.35 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.33 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.31 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.26 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.15 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.8 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.62 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.61 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.61 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.6 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.56 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.56 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.55 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.55 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.54 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.54 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.53 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.51 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.51 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.51 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.5 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.5 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.5 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 98.5 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.49 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.45 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.44 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.41 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.41 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.41 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.4 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.4 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.39 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 98.39 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.39 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.38 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.38 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.37 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.36 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.36 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.36 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.36 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.35 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 98.32 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.29 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.28 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.28 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.27 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 98.27 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.26 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.25 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.19 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.19 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 98.15 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.06 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.99 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.88 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.74 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.53 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.41 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.37 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.34 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.22 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 97.22 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.9 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.82 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.35 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.3 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-43 Score=386.89 Aligned_cols=320 Identities=26% Similarity=0.418 Sum_probs=237.5
Q ss_pred chHHHHHHhcCCC----CchhHHHHHHHHHHHHHHHHHhccccccCCCchhhhhhhccccccccCCCcccccccCCCCcc
Q psy15912 25 PEKSVRTMLHDPK----GAFGVFSLSVFVVTYFLLSVWTYGVSVSGGGMPEKYDFLSKDNVWKSNGKPRSLSEQLSDSGG 100 (482)
Q Consensus 25 ~~~~i~~l~~~~~----~~~~~~~l~~~~~~~~~~~~~~~~~~~~g~G~~~~~~~l~~~~~~~~~~~~~~~~~~~G~~gG 100 (482)
+++.++.+|++.. +.+.+..+++++++|++++++++|.++| ||
T Consensus 297 ~~~~i~~l~~~~~~~~~~~~~~~~l~~~~~~k~~~t~~s~g~g~p---------------------------------GG 343 (632)
T 3org_A 297 PRATINDLFKAVPLYQTDHFGWTELILMPIIKFILVALSIGLPLP---------------------------------AG 343 (632)
T ss_dssp CHHHHHHHHSCC----------CCSSHHHHHHHHHHHHHTTSSSB---------------------------------CB
T ss_pred HHHHHHHHHcCCccccccchhHHHHHHHHHHHHHHHHHHHhCCCc---------------------------------ch
Confidence 5778888887532 2333446788899999999999999999 99
Q ss_pred eehHHHHHHHHHHHHHHHHHHHhcCCCCCCchhHHHHHHHHHHhhhhhchhHHHHHHHHHhhCCchhhHHHHHHHHHHHH
Q psy15912 101 VFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKW 180 (482)
Q Consensus 101 ~f~Psl~iGa~~G~~~g~~~~~~~~~~~~~~~~~~a~vG~aa~~~g~~~~p~s~~vi~~Eltg~~~~~~Pl~ia~~ia~~ 180 (482)
+|+|+|++||++|+++|.+++.++|.. ++|+.||++||||+++|++|+|++++ +++||||++++++|+|+++++||+
T Consensus 344 if~P~l~iGA~~G~~~g~~~~~~~p~~--~~p~~~a~vGmaa~~~~v~~ap~t~v-i~~E~tg~~~~~lpl~ia~~~a~~ 420 (632)
T 3org_A 344 VFVPSFLIGAGFGRLYGELMRVVFGNA--IVPGSYAVVGAAAFTAGVTRALSCAV-IIFEVTGQIRHLVPVLISVLLAVI 420 (632)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHCTT--SCHHHHHHHHHHHHHHHHSCCTTHHH-HHHHHTCCCSCSHHHHHHHHHHHH
T ss_pred hhHHHHHHHHHHHHHHHHHHHHhCCcc--cchHHHHHHHHHHHHHHHHHHHHHHH-HHHHHhCChhHHHHHHHHHHHHHH
Confidence 999999999999999999999888864 68999999999999999999999875 899999999999999999999999
Q ss_pred HhhhcCCChhHHHHHHcCCCCCCCCCCCCccccchhhccc--CCeeEecCCCCHHHHHHHHH-hCCCCeeeEecCCCCCC
Q psy15912 181 IGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNITARIVKS--HPVICLRPLETVGNIIDVLK-ATSHNGFPIVDVEPMTK 257 (482)
Q Consensus 181 v~~~~~~siy~~~L~~~g~p~l~~~~~~~l~~l~a~dvM~--~~~~~l~~~~~i~~~~~~l~-~~~~~~fPVVd~~~~~~ 257 (482)
+++.+++++|+.+++.+++|+++....+..+.++|+|+|+ +++.+++++++++++.+.|+ +++++.+||||++
T Consensus 421 v~~~~~~~iY~~~~~~k~lp~l~~~~~~~~~~~~V~diM~p~~~v~~v~~~~t~~e~~~~~~~~~~~~~~PVvd~~---- 496 (632)
T 3org_A 421 VGNAFNRSLYETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVIDAN---- 496 (632)
T ss_dssp HHHHHCCCHHHHHHHHTTCCEEEEECTTCCTTSBHHHHCBCTTTSCCBCSSSCHHHHHHHHHHSTTCCEECBBCTT----
T ss_pred HHHHhCCCHHHHHHHhcCCCccccccccccccCcHHHHhhcCCCceEecCCCcHHHHHHHHHhcCCcceEEEEecC----
Confidence 9999999999999999999987654445568899999999 89999999999999999999 8999999999975
Q ss_pred CCCCCccccCCCCCCCCCCCCccccCCCCCCCCCCCCCCCeEEEEEeHHHHHHHHHhhhhccCCCCCCccchhhhhhhcc
Q psy15912 258 HSSDGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKESPGRLVGLILRSQLIILIKHKIYKENQNWPDDQLSSEIFHAEY 337 (482)
Q Consensus 258 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~lvGiIs~~dL~~~l~~~~~~~~~~~p~~~~~~~~~~~~~ 337 (482)
++++|+|+++|+.+.+.+...... .+ ....
T Consensus 497 ---------------------------------------~~lvGiVt~~DL~~~l~~~~~~~~--~~---~~~~------ 526 (632)
T 3org_A 497 ---------------------------------------GYLLGAISRKEIVDRLQHVLEDVP--EP---IAGH------ 526 (632)
T ss_dssp ---------------------------------------CBBCCEESHHHHTTTTTTC----------------------
T ss_pred ---------------------------------------CeEEEEEEHHHHHHHHHHHhhhcc--cc---cccc------
Confidence 689999999999876543210000 00 0000
Q ss_pred ccccccCCCCccccchhhHHHHHHHHhhhhccCCCCCCCCCChhhhhhhCCCCCCCCccccCccccccccccccccccCc
Q psy15912 338 RCRPRIWSPGRLVGLILRSQLIILIKHKIYKENQNWPDDQLSSEIFHAEYPRYPSVNDLVVSENDRSFTVKLNLFMNTSP 417 (482)
Q Consensus 338 ~~~~~~~~~~~~~G~i~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~~im~~~p 417 (482)
...-....+++.+..+.. ..... ..... ...+ + +.... ...-+++++|+++|
T Consensus 527 ----------~~~~~~~~~~l~~~~~~~-~~~~~---~~~~~--~~~e---~----~~~~~-----~~~~~v~~iMt~~p 578 (632)
T 3org_A 527 ----------RTLVLLDAADLSENIEGL-VDETP---SGEHS--SKGK---R----TATVL-----EPTSSLVVPCDVSP 578 (632)
T ss_dssp ------------------------------------------------------------------------CCSCCCCC
T ss_pred ----------cceeccCHHHHHhhcccC-CCCCc---ccchh--hhcc---c----ceEee-----ccccccchhhcCCC
Confidence 000000000000000000 00000 00000 0000 0 00000 01114899999999
Q ss_pred eeeeCCCCHHHHHHHHHHcCCCEEEEECCCCeEEEEEeHHHhHHHH
Q psy15912 418 FSVQDSTSLPRVFKLFRALGLRHVVVVNNNNHVVGMITRKDLARYR 463 (482)
Q Consensus 418 ~~V~~~~~l~~a~~~f~~~~lr~lpVVD~~g~lvGIITr~DLl~~~ 463 (482)
++|++++++.++.++|++++.+++||+ ++|+++||||++|+++..
T Consensus 579 itV~~~~~l~ea~~~M~~~~i~~lpVv-e~G~lvGIVT~~Dll~~~ 623 (632)
T 3org_A 579 IVVTSYSLVRQLHFLFVMLMPSMIYVT-ERGKLVGIVEREDVAYGY 623 (632)
T ss_dssp CEEETTCBHHHHHHHHHHTCCSEEEEE-ETTEEEEEEEGGGTEECC
T ss_pred ceecCCCcHHHHHHHHHhcCCCEEEEE-ECCEEEEEEehhhHHHHH
Confidence 999999999999999999999999999 789999999999999764
|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 482 | ||||
| d1otsa_ | 444 | f.20.1.1 (A:) Clc chloride channel {Escherichia co | 3e-24 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 1e-08 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 4e-08 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 3e-07 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 9e-07 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 5e-06 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 5e-06 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 5e-06 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 2e-05 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 2e-05 | |
| d2yvxa2 | 144 | d.37.1.1 (A:132-275) Magnesium transporter MgtE {T | 4e-05 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 5e-05 | |
| d2rc3a1 | 127 | d.37.1.1 (A:23-149) Uncharacterized protein NE2398 | 1e-04 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 1e-04 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-04 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 2e-04 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 3e-04 | |
| d2ef7a1 | 127 | d.37.1.1 (A:1-127) Uncharacterized protein ST2348 | 3e-04 | |
| d2riha1 | 131 | d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 | 5e-04 | |
| d1y5ha3 | 123 | d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {M | 0.001 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 0.001 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 0.001 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 0.002 | |
| d1pbja3 | 120 | d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {A | 0.003 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Score = 102 bits (256), Expect = 3e-24
Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 2/99 (2%)
Query: 98 SGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTII 157
GG+F P L G G F + +FP+ ++ G +A+ G A L +R ++ I+
Sbjct: 337 PGGIFAPMLALGTVLGTAFGMVAVELFPQ-YHLEAGTFAIAGMGALLAASIRAPLTGIIL 395
Query: 158 LIEATGNISFGLPLMLTLITAKWIGDFF-TEGLYDIHIQ 195
++E T N LP+++T + A + F + LY +
Sbjct: 396 VLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILA 434
|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} Length = 144 | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} Length = 127 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} Length = 127 | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} Length = 131 | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 123 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 120 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 482 | |||
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 99.86 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.8 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.8 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.79 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.79 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.79 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.78 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.78 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.78 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.77 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.77 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.76 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.76 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.76 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.75 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.74 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.73 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.73 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.72 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.71 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.7 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.7 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.67 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.65 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.65 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.65 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.64 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.81 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.72 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.72 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.62 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.61 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.6 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.58 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.57 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.56 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.52 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.49 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.48 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.48 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.47 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.43 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.42 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.36 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.27 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.21 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.2 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.09 | |
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 98.05 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.04 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 97.99 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.88 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.86 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.83 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 84.98 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Probab=99.86 E-value=6e-22 Score=205.79 Aligned_cols=136 Identities=24% Similarity=0.398 Sum_probs=124.0
Q ss_pred cccccCCCchhhhhhhcccccccc-----CCCc--ccccccCCCCcceehHHHHHHHHHHHHHHHHHHHhcCCCCCCchh
Q psy15912 61 GVSVSGGGMPEKYDFLSKDNVWKS-----NGKP--RSLSEQLSDSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPG 133 (482)
Q Consensus 61 ~~~~~g~G~~~~~~~l~~~~~~~~-----~~~~--~~~~~~~G~~gG~f~Psl~iGa~~G~~~g~~~~~~~~~~~~~~~~ 133 (482)
.-.+.|+||+.++..++++..+.. +.|+ |++|+++|.+||+|+|++++||++|+++|.++..++|... ++|+
T Consensus 293 ~p~~~g~G~~~~~~~~~~~~~~~~l~~~~~~K~~~t~~t~~~G~~GG~f~P~l~iGa~~G~~~~~~~~~~~~~~~-~~~~ 371 (444)
T d1otsa_ 293 APATSGGGFNLIPIATAGNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYH-LEAG 371 (444)
T ss_dssp CGGGSSCSTTHHHHHHHTCSCHHHHHHHHHHHHHHHHHHHHTTCSSBSHHHHHHHHHHHHHHHHHHHHHHCGGGT-CCHH
T ss_pred CcccCCCchHHHHHHhcCCcchHHHHHHHHHHHHHHHHHhhcCCCCCeehHHHHHHHHHHHHHHHHHHHhCCccc-CCHH
Confidence 445789999999999999866544 2455 9999999999999999999999999999999999888754 7899
Q ss_pred HHHHHHHHHHhhhhhchhHHHHHHHHHhhCCchhhHHHHHHHHHHHHHhhhcC-CChhHHHHHHc
Q psy15912 134 KYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFT-EGLYDIHIQLS 197 (482)
Q Consensus 134 ~~a~vG~aa~~~g~~~~p~s~~vi~~Eltg~~~~~~Pl~ia~~ia~~v~~~~~-~siy~~~L~~~ 197 (482)
.|+++||++++++++|+|++++++++|+||++++++|+|+++++|+++++.++ +++||.++++.
T Consensus 372 ~~alvGmaa~~a~~~~~Plta~vl~~Eltg~~~~~~p~~ia~~~a~~v~~~~~~~siY~~~l~~~ 436 (444)
T d1otsa_ 372 TFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILART 436 (444)
T ss_dssp HHHHHHHTHHHHHTSCCHHHHHHHHHHHHCCGGGHHHHHHHHHHHHHHHHTTTCCCHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhhHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHhCCCChHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999986 79999998753
|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|