Psyllid ID: psy15927


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MRGGTSPITDEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENVPNVVKK
ccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccEEEEEEEEcccccEEEEEEEcccccccccccccccccccc
cccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEEcccEEEEEEEEcccccEEEEEEEcccccccccHHHHccccccc
mrggtspitdeQAVQNAVDSWYNEIKdyklfgreptmqelmsgsptghftQLIWKGTKAVGigiakgdqnRVVVVANyspagnvvryfnenvpnvvkk
mrggtspitdeqavqNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANyspagnvvryfnenvpnvvkk
MRGGTSPITDEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENVPNVVKK
***************NAVDSWYNEIKDYKLFGRE**********PTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENV******
*************VQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNE*VPNV***
*********DEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENVPNVVKK
**********EQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENVPNVVK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGGTSPITDEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRYFNENVPNVVKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query98 2.2.26 [Sep-21-2011]
Q9CYL5154 Golgi-associated plant pa yes N/A 0.775 0.493 0.423 1e-11
Q9H4G4154 Golgi-associated plant pa yes N/A 0.765 0.487 0.428 1e-10
P36110329 Protein PRY2 OS=Saccharom yes N/A 0.704 0.209 0.402 2e-08
P47032299 Protein PRY1 OS=Saccharom no N/A 0.663 0.217 0.432 2e-07
Q4V9Y5 500 Cysteine-rich secretory p no N/A 0.693 0.136 0.387 8e-07
P35781202 Venom allergen 5.01 OS=Ve N/A N/A 0.765 0.371 0.345 1e-06
Q8BZQ2 495 Cysteine-rich secretory p no N/A 0.673 0.133 0.384 1e-06
P35792164 Pathogenesis-related prot N/A N/A 0.663 0.396 0.366 1e-06
A9YME1232 Venom allergen 5 OS=Micro N/A N/A 0.663 0.280 0.347 2e-06
Q60477244 Cysteine-rich secretory p yes N/A 0.795 0.319 0.340 2e-06
>sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=2 SV=3 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 47/85 (55%), Gaps = 9/85 (10%)

Query: 11  EQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQN 70
           +Q  ++  D WY+EIK Y         Q+    S TGHFT ++WK TK +G+G A     
Sbjct: 73  DQTGKDVADRWYSEIKSY-------NFQQPGFTSGTGHFTAMVWKNTKKIGVGKASASDG 125

Query: 71  RVVVVANYSPAGNVVR--YFNENVP 93
              VVA Y PAGN+V   +F ENVP
Sbjct: 126 SSFVVARYFPAGNIVNQGFFEENVP 150





Mus musculus (taxid: 10090)
>sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 Back     alignment and function description
>sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=3 SV=1 Back     alignment and function description
>sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 Back     alignment and function description
>sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 Back     alignment and function description
>sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 Back     alignment and function description
>sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 Back     alignment and function description
>sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description
>sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 Back     alignment and function description
>sp|Q60477|CRIS2_CAVPO Cysteine-rich secretory protein 2 OS=Cavia porcellus GN=CRISP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
405957390 380 Golgi-associated plant pathogenesis-rela 0.785 0.202 0.476 5e-14
242003910 251 conserved hypothetical protein [Ixodes s 0.836 0.326 0.494 9e-14
91077960 583 PREDICTED: similar to LOC495415 protein 0.704 0.118 0.486 2e-13
291226126 324 PREDICTED: GLI pathogenesis-related 2-li 0.744 0.225 0.462 5e-13
195997441 771 hypothetical protein TRIADDRAFT_51643 [T 0.714 0.090 0.518 1e-12
148298863 371 SCP-related protein [Bombyx mori] gi|110 0.724 0.191 0.474 1e-12
427790149 293 Putative tick salivary antigen-5 protein 0.836 0.279 0.471 3e-12
328722183 577 PREDICTED: hypothetical protein LOC10016 0.826 0.140 0.416 3e-12
195115064145 GI14160 [Drosophila mojavensis] gi|19391 0.693 0.468 0.513 3e-12
193664656 457 PREDICTED: hypothetical protein LOC10016 0.724 0.155 0.474 3e-12
>gi|405957390|gb|EKC23604.1| Golgi-associated plant pathogenesis-related protein 1 [Crassostrea gigas] Back     alignment and taxonomy information
 Score = 81.6 bits (200), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 57/84 (67%), Gaps = 7/84 (8%)

Query: 10 DEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQ 69
          D  + Q   D WY+EIK Y+ FG EP  + L +G    HFTQ++WKG++ +G+G A+   
Sbjct: 9  DTYSGQEVTDQWYSEIKLYR-FGGEP--RNLSAG----HFTQVVWKGSREIGVGKARSKD 61

Query: 70 NRVVVVANYSPAGNVVRYFNENVP 93
           +++VVANY PAGNV+  F+ENVP
Sbjct: 62 GKILVVANYRPAGNVIGRFSENVP 85




Source: Crassostrea gigas

Species: Crassostrea gigas

Genus: Crassostrea

Family: Ostreidae

Order: Ostreoida

Class: Bivalvia

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|242003910|ref|XP_002436232.1| conserved hypothetical protein [Ixodes scapularis] gi|215499568|gb|EEC09062.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|91077960|ref|XP_967490.1| PREDICTED: similar to LOC495415 protein [Tribolium castaneum] gi|270002291|gb|EEZ98738.1| hypothetical protein TcasGA2_TC001293 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291226126|ref|XP_002733044.1| PREDICTED: GLI pathogenesis-related 2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|195997441|ref|XP_002108589.1| hypothetical protein TRIADDRAFT_51643 [Trichoplax adhaerens] gi|190589365|gb|EDV29387.1| hypothetical protein TRIADDRAFT_51643 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|148298863|ref|NP_001091773.1| SCP-related protein [Bombyx mori] gi|110559661|gb|ABG76067.1| SCP-related protein [Bombyx mori] Back     alignment and taxonomy information
>gi|427790149|gb|JAA60526.1| Putative tick salivary antigen-5 protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|328722183|ref|XP_001948456.2| PREDICTED: hypothetical protein LOC100162791 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195115064|ref|XP_002002087.1| GI14160 [Drosophila mojavensis] gi|193912662|gb|EDW11529.1| GI14160 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|193664656|ref|XP_001946213.1| PREDICTED: hypothetical protein LOC100165954 isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query98
ZFIN|ZDB-GENE-030131-4424 543 glipr2 "GLI pathogenesis-relat 0.693 0.125 0.525 1.6e-13
MGI|MGI:1917770154 Glipr2 "GLI pathogenesis-relat 0.775 0.493 0.435 2.7e-13
RGD|1583669150 Glipr2 "GLI pathogenesis-relat 0.775 0.506 0.435 3.4e-13
UNIPROTKB|E1BYA2154 GLIPR2 "Uncharacterized protei 0.765 0.487 0.440 7.1e-13
UNIPROTKB|F1ST88154 LOC100739112 "Uncharacterized 0.765 0.487 0.452 7.1e-13
UNIPROTKB|Q0VCH9154 GLIPR2 "Uncharacterized protei 0.765 0.487 0.440 1.9e-12
UNIPROTKB|J9NX46153 GLIPR2 "Uncharacterized protei 0.765 0.490 0.440 1.9e-12
UNIPROTKB|Q9H4G4154 GLIPR2 "Golgi-associated plant 0.765 0.487 0.440 1.9e-12
FB|FBgn0031412146 CG16995 [Drosophila melanogast 0.704 0.472 0.441 1.7e-11
ZFIN|ZDB-GENE-041010-53154 glipr2l "GLI pathogenesis-rela 0.765 0.487 0.392 3.5e-11
ZFIN|ZDB-GENE-030131-4424 glipr2 "GLI pathogenesis-related 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 185 (70.2 bits), Expect = 1.6e-13, P = 1.6e-13
 Identities = 41/78 (52%), Positives = 49/78 (62%)

Query:    17 AVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVA 76
             AVDSWY EIKDY  F R P        S TGHFTQ++WK TK +G+G+A  D N + VV 
Sbjct:    76 AVDSWYGEIKDYN-FSR-PGFS-----SKTGHFTQVVWKDTKELGVGLAT-DGNTIFVVG 127

Query:    77 NYSPAGNVVR--YFNENV 92
              Y PAGN+    YF +NV
Sbjct:   128 QYLPAGNIANAGYFEKNV 145


GO:0005576 "extracellular region" evidence=IEA
MGI|MGI:1917770 Glipr2 "GLI pathogenesis-related 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1583669 Glipr2 "GLI pathogenesis-related 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYA2 GLIPR2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST88 LOC100739112 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCH9 GLIPR2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NX46 GLIPR2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H4G4 GLIPR2 "Golgi-associated plant pathogenesis-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0031412 CG16995 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-53 glipr2l "GLI pathogenesis-related 2, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
cd05382132 cd05382, SCP_GAPR-1_like, SCP_GAPR-1_like: SCP-lik 2e-29
cd05384129 cd05384, SCP_PRY1_like, SCP_PRY1_like: SCP-like ex 3e-17
cd00168122 cd00168, SCP, SCP: SCP-like extracellular protein 1e-13
cd05380144 cd05380, SCP_euk, SCP_euk: SCP-like extracellular 2e-13
smart00198144 smart00198, SCP, SCP / Tpx-1 / Ag5 / PR-1 / Sc7 fa 6e-12
cd05381136 cd05381, SCP_PR-1_like, SCP_PR-1_like: SCP-like ex 5e-09
cd05383138 cd05383, SCP_CRISP, SCP_CRISP: SCP-like extracellu 4e-08
cd05385144 cd05385, SCP_GLIPR-1_like, SCP_GLIPR-1_like: SCP-l 2e-07
pfam00188121 pfam00188, CAP, Cysteine-rich secretory protein fa 4e-07
cd05559136 cd05559, SCP_HrTT-1, SCP_HrTT-1: SCP-like extracel 2e-04
>gnl|CDD|240182 cd05382, SCP_GAPR-1_like, SCP_GAPR-1_like: SCP-like extracellular protein domain, golgi-associated plant pathogenesis related protein (GAPR)-like sub-family Back     alignment and domain information
 Score =  101 bits (254), Expect = 2e-29
 Identities = 37/84 (44%), Positives = 48/84 (57%), Gaps = 10/84 (11%)

Query: 1   MRGGTSPITDEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAV 60
              G+ P   +   + AVDSWYNEIK Y  F +          S TGHFTQ++WK +  +
Sbjct: 59  YASGSGP---DLTGEEAVDSWYNEIKKYD-FNKPG------FSSKTGHFTQVVWKSSTEL 108

Query: 61  GIGIAKGDQNRVVVVANYSPAGNV 84
           G+G+AK  +  V VVA Y PAGNV
Sbjct: 109 GVGVAKSKKGCVYVVARYRPAGNV 132


The wider family of SCP containing proteins includes plant pathogenesis-related protein 1 (PR-1), CRISPs, mammalian cysteine-rich secretory proteins, which combine SCP with a C-terminal cysteine rich domain, and allergen 5 from vespid venom. It has been proposed that SCP domains may function as endopeptidases. The human GAPR-1 protein has been reported to dimerize, and such a dimer may form an active site containing a catalytic triad. GAPR-1 and GLIPR-2 appear to be synonyms. Length = 132

>gnl|CDD|240184 cd05384, SCP_PRY1_like, SCP_PRY1_like: SCP-like extracellular protein domain, PRY1-like sub-family restricted to fungi Back     alignment and domain information
>gnl|CDD|238097 cd00168, SCP, SCP: SCP-like extracellular protein domain, found in eukaryotes and prokaryotes Back     alignment and domain information
>gnl|CDD|240180 cd05380, SCP_euk, SCP_euk: SCP-like extracellular protein domain, as found mainly in eukaryotes Back     alignment and domain information
>gnl|CDD|214553 smart00198, SCP, SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains Back     alignment and domain information
>gnl|CDD|240181 cd05381, SCP_PR-1_like, SCP_PR-1_like: SCP-like extracellular protein domain, PR-1 like subfamily Back     alignment and domain information
>gnl|CDD|240183 cd05383, SCP_CRISP, SCP_CRISP: SCP-like extracellular protein domain, CRISP-like sub-family Back     alignment and domain information
>gnl|CDD|240185 cd05385, SCP_GLIPR-1_like, SCP_GLIPR-1_like: SCP-like extracellular protein domain, glioma pathogenesis-related protein (GLIPR)-like sub-family Back     alignment and domain information
>gnl|CDD|215778 pfam00188, CAP, Cysteine-rich secretory protein family Back     alignment and domain information
>gnl|CDD|240186 cd05559, SCP_HrTT-1, SCP_HrTT-1: SCP-like extracellular protein domain in HrTT-1, a tail-tip epidermis marker in ascidians Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 98
cd05381136 SCP_PR-1_like SCP_PR-1_like: SCP-like extracellula 99.91
cd05384129 SCP_PRY1_like SCP_PRY1_like: SCP-like extracellula 99.89
KOG3017|consensus225 99.88
cd05382132 SCP_GAPR-1_like SCP_GAPR-1_like: SCP-like extracel 99.86
cd05383138 SCP_CRISP SCP_CRISP: SCP-like extracellular protei 99.84
cd05385144 SCP_GLIPR-1_like SCP_GLIPR-1_like: SCP-like extrac 99.83
smart00198144 SCP SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extra 99.82
cd05559136 SCP_HrTT-1 SCP_HrTT-1: SCP-like extracellular prot 99.79
cd00168122 SCP SCP: SCP-like extracellular protein domain, fo 99.75
cd05380144 SCP_euk SCP_euk: SCP-like extracellular protein do 99.75
PF00188124 CAP: Cysteine-rich secretory protein family; Inter 99.23
cd05379122 SCP_bacterial SCP_bacterial: SCP-like extracellula 96.47
TIGR02909127 spore_YkwD uncharacterized protein, YkwD family. M 96.45
>cd05381 SCP_PR-1_like SCP_PR-1_like: SCP-like extracellular protein domain, PR-1 like subfamily Back     alignment and domain information
Probab=99.91  E-value=3.7e-24  Score=135.07  Aligned_cols=74  Identities=32%  Similarity=0.597  Sum_probs=63.8

Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCCcccccccCCCCcchhhHhhhcccceEEEEEEEcCC-CCEEEEEEecCCCCCcccccc
Q psy15927         12 QAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQ-NRVVVVANYSPAGNVVRYFNE   90 (98)
Q Consensus        12 ~~~~~~v~~W~~e~~~y~~~~~~~~~~~~~~~~~~~hftqmvw~~t~~vGCa~~~c~~-~~~~~vC~Y~p~GN~~g~~~~   90 (98)
                      ..+.++|+.|++|...|+ +.. +.|   ..+..++|||||||++|++||||++.|.. +..++||+|+|+||+.|+.+|
T Consensus        62 ~~~~~~v~~W~~e~~~y~-~~~-~~~---~~~~~~~hftq~vw~~t~~vGCa~~~c~~~~~~~vvC~Y~p~gn~~g~~~Y  136 (136)
T cd05381          62 WSAADAVASWVSEKKYYD-YDS-NTC---AAGKMCGHYTQVVWRNTTRVGCARVTCDNGGGVFIICNYDPPGNYIGQRPY  136 (136)
T ss_pred             CCHHHHHHHHHhccccCC-CCC-CCc---CCCccchHHHHHHHHhcCEeceEEEEeCCCCcEEEEEEeeCCCCCCCCCCC
Confidence            357889999999999999 776 333   34578999999999999999999999987 347999999999999998875



The wider family of SCP containing proteins includes plant pathogenesis-related protein 1 (PR-1), which accumulates after infections with pathogens, and may act as an anti-fungal agent or be involved in cell wall loosening. It also includes CRISPs, mammalian cysteine-rich secretory proteins, and allergen 5 from vespid venom. It has been proposed that SCP domains may function as endopeptidases.

>cd05384 SCP_PRY1_like SCP_PRY1_like: SCP-like extracellular protein domain, PRY1-like sub-family restricted to fungi Back     alignment and domain information
>KOG3017|consensus Back     alignment and domain information
>cd05382 SCP_GAPR-1_like SCP_GAPR-1_like: SCP-like extracellular protein domain, golgi-associated plant pathogenesis related protein (GAPR)-like sub-family Back     alignment and domain information
>cd05383 SCP_CRISP SCP_CRISP: SCP-like extracellular protein domain, CRISP-like sub-family Back     alignment and domain information
>cd05385 SCP_GLIPR-1_like SCP_GLIPR-1_like: SCP-like extracellular protein domain, glioma pathogenesis-related protein (GLIPR)-like sub-family Back     alignment and domain information
>smart00198 SCP SCP / Tpx-1 / Ag5 / PR-1 / Sc7 family of extracellular domains Back     alignment and domain information
>cd05559 SCP_HrTT-1 SCP_HrTT-1: SCP-like extracellular protein domain in HrTT-1, a tail-tip epidermis marker in ascidians Back     alignment and domain information
>cd00168 SCP SCP: SCP-like extracellular protein domain, found in eukaryotes and prokaryotes Back     alignment and domain information
>cd05380 SCP_euk SCP_euk: SCP-like extracellular protein domain, as found mainly in eukaryotes Back     alignment and domain information
>PF00188 CAP: Cysteine-rich secretory protein family; InterPro: IPR014044 The cysteine-rich secretory proteins, antigen 5, and pathogenesis-related 1 proteins (CAP) superfamily proteins are found in a wide range of organisms, including prokaryotes [] and non-vertebrate eukaryotes [], The nine subfamilies of the mammalian CAP superfamily include: the human glioma pathogenesis-related 1 (GLIPR1), Golgi associated pathogenesis related-1 (GAPR1) proteins, peptidase inhibitor 15 (PI15), peptidase inhibitor 16 (PI16), cysteine-rich secretory proteins (CRISPs), CRISP LCCL domain containing 1 (CRISPLD1), CRISP LCCL domain containing 2 (CRISPLD2), mannose receptor like and the R3H domain containing like proteins Back     alignment and domain information
>cd05379 SCP_bacterial SCP_bacterial: SCP-like extracellular protein domain, as found in bacteria and archaea Back     alignment and domain information
>TIGR02909 spore_YkwD uncharacterized protein, YkwD family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
1smb_A154 Crystal Structure Of Golgi-Associated Pr-1 Protein 1e-11
4aiw_A154 Gapr-1 With Bound Inositol Hexakisphosphate Length 1e-11
2ddb_A210 Crystal Structure Of Pseudecin From Pseudechis Porp 2e-07
2dda_A211 Crystal Structure Of Pseudechetoxin From Pseudechis 3e-07
2vzn_A218 Crystal Structure Of The Major Allergen From Fire A 1e-05
1qnx_A209 Ves V 5, An Allergen From Vespula Vulgaris Venom Le 1e-05
3q2r_A205 Crystal Structure Of Sglipr1 Soaked With Zinc Chlor 8e-05
1u53_A196 Novel X-Ray Structure Of Na-Asp-2, A Pr-1 Protein F 1e-04
1rc9_A221 Crystal Structure Of Stecrisp, A Member Of Crisp Fa 2e-04
>pdb|1SMB|A Chain A, Crystal Structure Of Golgi-Associated Pr-1 Protein Length = 154 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 9/84 (10%) Query: 11 EQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQN 70 +Q + D WY+EIK+Y Q+ S TGHFT ++WK TK +G+G A Sbjct: 73 DQTGKEVADRWYSEIKNY-------NFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDG 125 Query: 71 RVVVVANYSPAGNVVR--YFNENV 92 VVA Y PAGNVV +F ENV Sbjct: 126 SSFVVARYFPAGNVVNEGFFEENV 149
>pdb|4AIW|A Chain A, Gapr-1 With Bound Inositol Hexakisphosphate Length = 154 Back     alignment and structure
>pdb|2DDB|A Chain A, Crystal Structure Of Pseudecin From Pseudechis Porphyriacus Length = 210 Back     alignment and structure
>pdb|2DDA|A Chain A, Crystal Structure Of Pseudechetoxin From Pseudechis Australis Length = 211 Back     alignment and structure
>pdb|2VZN|A Chain A, Crystal Structure Of The Major Allergen From Fire Ant Venom, Sol I 3 Length = 218 Back     alignment and structure
>pdb|1QNX|A Chain A, Ves V 5, An Allergen From Vespula Vulgaris Venom Length = 209 Back     alignment and structure
>pdb|3Q2R|A Chain A, Crystal Structure Of Sglipr1 Soaked With Zinc Chloride Length = 205 Back     alignment and structure
>pdb|1U53|A Chain A, Novel X-Ray Structure Of Na-Asp-2, A Pr-1 Protein From The Nematode Parasite Necator Americanus And A Vaccine Antigen For Human Hookworm Infection Length = 196 Back     alignment and structure
>pdb|1RC9|A Chain A, Crystal Structure Of Stecrisp, A Member Of Crisp Family From Trimeresurus Stejnegeri Refined At 1.6 Angstroms Resolution: Structual Relationship Of The Two Domains Length = 221 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query98
4aiw_A154 Golgi-associated plant pathogenesis-related prote; 3e-26
1cfe_A135 Pathogenesis-related protein P14A; PR-1 proteins, 2e-24
1u53_A196 Secreted protein Asp-2; antibiotic; 1.56A {Necator 6e-23
2vzn_A218 Venom allergen 3; major FIRE ANT allergen, SOL I 3 1e-20
2ddb_A210 Pseudecin, channel blocker; crisp, snake venom, CN 2e-20
3nt8_A424 Ancylostoma secreted protein 1; pathogenesis relat 2e-20
3nt8_A 424 Ancylostoma secreted protein 1; pathogenesis relat 2e-16
1xta_A221 Natrin 1; crisp, serine protease, ION channel bloc 3e-20
1qnx_A209 VES V 5, antigen 5; allergen, vespid venom; 1.90A 5e-20
3q2u_A205 Glioma pathogenesis-related protein 1; crisp, memb 5e-18
3u3l_C233 Tablysin 15; CAP domain, alphavbeta3 integrin, sal 1e-12
3s6s_A206 AC-Asp-7; pathogenesis-related protein, SCP/TAPS, 2e-05
>4aiw_A Golgi-associated plant pathogenesis-related prote; lipid-binding protein, golgi apparatus, myristate; HET: I6P; 1.50A {Homo sapiens} PDB: 1smb_A* Length = 154 Back     alignment and structure
 Score = 93.5 bits (233), Expect = 3e-26
 Identities = 36/81 (44%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 15  QNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVV 74
           +   D WY+EIK+Y  F + P        S TGHFT ++WK TK +G+G A        V
Sbjct: 77  KEVADRWYSEIKNYN-FQQ-PGFT-----SGTGHFTAMVWKNTKKMGVGKASASDGSSFV 129

Query: 75  VANYSPAGNVV--RYFNENVP 93
           VA Y PAGNVV   +F ENV 
Sbjct: 130 VARYFPAGNVVNEGFFEENVL 150


>1cfe_A Pathogenesis-related protein P14A; PR-1 proteins, plant defense; NMR {Solanum lycopersicum} SCOP: d.111.1.1 Length = 135 Back     alignment and structure
>1u53_A Secreted protein Asp-2; antibiotic; 1.56A {Necator americanus} Length = 196 Back     alignment and structure
>2vzn_A Venom allergen 3; major FIRE ANT allergen, SOL I 3, secreted, cross- reactivity; 3.05A {Solenopsis invicta} Length = 218 Back     alignment and structure
>2ddb_A Pseudecin, channel blocker; crisp, snake venom, CNG channel, toxin; 1.90A {Pseudechis porphyriacus} PDB: 2epf_A 2dda_A Length = 210 Back     alignment and structure
>3nt8_A Ancylostoma secreted protein 1; pathogenesis related-1 protein, cysteine-rich secretory PROT domain, immune system; 2.20A {Necator americanus} Length = 424 Back     alignment and structure
>3nt8_A Ancylostoma secreted protein 1; pathogenesis related-1 protein, cysteine-rich secretory PROT domain, immune system; 2.20A {Necator americanus} Length = 424 Back     alignment and structure
>1xta_A Natrin 1; crisp, serine protease, ION channel blocking, cobra, toxin; 1.58A {Naja atra} PDB: 2giz_A 1xx5_A 3mz8_A 1rc9_A 1wvr_A Length = 221 Back     alignment and structure
>1qnx_A VES V 5, antigen 5; allergen, vespid venom; 1.90A {Vespula vulgaris} SCOP: d.111.1.1 Length = 209 Back     alignment and structure
>3q2u_A Glioma pathogenesis-related protein 1; crisp, membrane protein; 1.85A {Homo sapiens} PDB: 3q2r_A Length = 205 Back     alignment and structure
>3u3l_C Tablysin 15; CAP domain, alphavbeta3 integrin, salivary gland, protein BI; HET: PLM CIT; 1.57A {Tabanus yao} PDB: 3u3n_C* 3u3u_C* Length = 233 Back     alignment and structure
>3s6s_A AC-Asp-7; pathogenesis-related protein, SCP/TAPS, unknown function; 2.40A {Ancylostoma caninum} PDB: 3s6v_A 3s6u_A Length = 206 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
4aiw_A154 Golgi-associated plant pathogenesis-related prote; 99.97
1u53_A196 Secreted protein Asp-2; antibiotic; 1.56A {Necator 99.95
1cfe_A135 Pathogenesis-related protein P14A; PR-1 proteins, 99.94
2ddb_A210 Pseudecin, channel blocker; crisp, snake venom, CN 99.93
3u3l_C233 Tablysin 15; CAP domain, alphavbeta3 integrin, sal 99.92
1xta_A221 Natrin 1; crisp, serine protease, ION channel bloc 99.92
2vzn_A218 Venom allergen 3; major FIRE ANT allergen, SOL I 3 99.91
3q2u_A205 Glioma pathogenesis-related protein 1; crisp, memb 99.91
3nt8_A424 Ancylostoma secreted protein 1; pathogenesis relat 99.91
1qnx_A209 VES V 5, antigen 5; allergen, vespid venom; 1.90A 99.89
3nt8_A 424 Ancylostoma secreted protein 1; pathogenesis relat 99.88
3s6s_A206 AC-Asp-7; pathogenesis-related protein, SCP/TAPS, 99.83
>4aiw_A Golgi-associated plant pathogenesis-related prote; lipid-binding protein, golgi apparatus, myristate; HET: I6P; 1.50A {Homo sapiens} PDB: 1smb_A* Back     alignment and structure
Probab=99.97  E-value=9e-32  Score=172.81  Aligned_cols=79  Identities=47%  Similarity=0.766  Sum_probs=70.5

Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCCcccccccCCCCcchhhHhhhcccceEEEEEEEcCCCCEEEEEEecCCCCCccc--cc
Q psy15927         12 QAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRY--FN   89 (98)
Q Consensus        12 ~~~~~~v~~W~~e~~~y~~~~~~~~~~~~~~~~~~~hftqmvw~~t~~vGCa~~~c~~~~~~~vC~Y~p~GN~~g~--~~   89 (98)
                      .+..++|+.||+|.++|+ +..+ .     ....+||||||||++|++||||++.|.++..++||+|+|+||+.|+  |.
T Consensus        74 ~~~~~~v~~W~~E~~~y~-~~~~-~-----~~~~~gHfTQ~VW~~t~~vGCg~a~c~~~~~~vVC~Y~P~GN~~g~~~y~  146 (154)
T 4aiw_A           74 QTGKEVADRWYSEIKNYN-FQQP-G-----FTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFE  146 (154)
T ss_dssp             CCHHHHHHHHHGGGGGCC-TTSC-S-----CCTTTHHHHHHHCTTCCEEEEEEEECTTSCEEEEEEEESCCCCCSTTHHH
T ss_pred             CCHHHHHHHHHHHhhhcc-cCCC-C-----cCCCcCCeeeeehhhhceeeeEEEEcCCCCEEEEEEEeCCCccCCccchH
Confidence            356789999999999999 8774 3     3456999999999999999999999998889999999999999875  99


Q ss_pred             cCCCCCCC
Q psy15927         90 ENVPNVVK   97 (98)
Q Consensus        90 ~nv~~p~~   97 (98)
                      +||+||++
T Consensus       147 ~NV~pPkk  154 (154)
T 4aiw_A          147 ENVLPPKK  154 (154)
T ss_dssp             HHSCCCCC
T ss_pred             HhCCCCCC
Confidence            99999975



>1u53_A Secreted protein Asp-2; antibiotic; 1.56A {Necator americanus} Back     alignment and structure
>1cfe_A Pathogenesis-related protein P14A; PR-1 proteins, plant defense; NMR {Solanum lycopersicum} SCOP: d.111.1.1 Back     alignment and structure
>2ddb_A Pseudecin, channel blocker; crisp, snake venom, CNG channel, toxin; 1.90A {Pseudechis porphyriacus} PDB: 2epf_A 2dda_A Back     alignment and structure
>3u3l_C Tablysin 15; CAP domain, alphavbeta3 integrin, salivary gland, protein BI; HET: PLM CIT; 1.57A {Tabanus yao} PDB: 3u3n_C* 3u3u_C* Back     alignment and structure
>1xta_A Natrin 1; crisp, serine protease, ION channel blocking, cobra, toxin; 1.58A {Naja atra} PDB: 2giz_A 1xx5_A 3mz8_A 1rc9_A 1wvr_A Back     alignment and structure
>2vzn_A Venom allergen 3; major FIRE ANT allergen, SOL I 3, secreted, cross- reactivity; 3.05A {Solenopsis invicta} Back     alignment and structure
>3q2u_A Glioma pathogenesis-related protein 1; crisp, membrane protein; 1.85A {Homo sapiens} PDB: 3q2r_A Back     alignment and structure
>3nt8_A Ancylostoma secreted protein 1; pathogenesis related-1 protein, cysteine-rich secretory PROT domain, immune system; 2.20A {Necator americanus} Back     alignment and structure
>1qnx_A VES V 5, antigen 5; allergen, vespid venom; 1.90A {Vespula vulgaris} SCOP: d.111.1.1 Back     alignment and structure
>3nt8_A Ancylostoma secreted protein 1; pathogenesis related-1 protein, cysteine-rich secretory PROT domain, immune system; 2.20A {Necator americanus} Back     alignment and structure
>3s6s_A AC-Asp-7; pathogenesis-related protein, SCP/TAPS, unknown function; 2.40A {Ancylostoma caninum} PDB: 3s6v_A 3s6u_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 98
d1qnxa_209 d.111.1.1 (A:) Insect allergen 5 (AG5) {Yellow jac 1e-14
d1smba_149 d.111.1.1 (A:) Golgi-associated PR-1 protein {Huma 7e-13
d1rc9a1164 d.111.1.1 (A:1-164) Cysteine-rich secretory protei 1e-11
d1cfea_135 d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1 4e-11
>d1qnxa_ d.111.1.1 (A:) Insect allergen 5 (AG5) {Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]} Length = 209 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PR-1-like
superfamily: PR-1-like
family: PR-1-like
domain: Insect allergen 5 (AG5)
species: Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]
 Score = 63.8 bits (154), Expect = 1e-14
 Identities = 25/84 (29%), Positives = 34/84 (40%), Gaps = 7/84 (8%)

Query: 5   TSPITDEQAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGI 64
            S           V  W +E+KDY                 TGH+TQ++W  TK VG G 
Sbjct: 122 GSTAAKYDDPVKLVKMWEDEVKDYNP----KKKFSGNDFLKTGHYTQMVWANTKEVGCGS 177

Query: 65  AK---GDQNRVVVVANYSPAGNVV 85
            K      ++  +V NY P+GN  
Sbjct: 178 IKYIQEKWHKHYLVCNYGPSGNFK 201


>d1smba_ d.111.1.1 (A:) Golgi-associated PR-1 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1rc9a1 d.111.1.1 (A:1-164) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]} Length = 164 Back     information, alignment and structure
>d1cfea_ d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a [TaxId: 4081]} Length = 135 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query98
d1smba_149 Golgi-associated PR-1 protein {Human (Homo sapiens 99.94
d1cfea_135 Pathogenesis-related protein 1 (PR1) {Tomato (Lyco 99.94
d1rc9a1164 Cysteine-rich secretory protein (SteCRISP) {Chines 99.91
d1qnxa_209 Insect allergen 5 (AG5) {Yellow jacket (Vespula vu 99.88
>d1smba_ d.111.1.1 (A:) Golgi-associated PR-1 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PR-1-like
superfamily: PR-1-like
family: PR-1-like
domain: Golgi-associated PR-1 protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=4.8e-28  Score=152.56  Aligned_cols=77  Identities=47%  Similarity=0.780  Sum_probs=68.3

Q ss_pred             HHHHHHHHHHHHHhhcCCCCCCCcccccccCCCCcchhhHhhhcccceEEEEEEEcCCCCEEEEEEecCCCCCccc--cc
Q psy15927         12 QAVQNAVDSWYNEIKDYKLFGREPTMQELMSGSPTGHFTQLIWKGTKAVGIGIAKGDQNRVVVVANYSPAGNVVRY--FN   89 (98)
Q Consensus        12 ~~~~~~v~~W~~e~~~y~~~~~~~~~~~~~~~~~~~hftqmvw~~t~~vGCa~~~c~~~~~~~vC~Y~p~GN~~g~--~~   89 (98)
                      ..+.++|+.|++|..+|+ +..+ .     ....+||||||||.++++||||++.|.++..++||+|+|+||+.|+  |.
T Consensus        71 ~~~~~~v~~W~~e~~~y~-~~~~-~-----~~~~~ghftqmvw~~t~~vGCg~a~c~~~~~~~VC~Y~p~GN~~~~~~y~  143 (149)
T d1smba_          71 QTGKEVADRWYSEIKNYN-FQQP-G-----FTSGTGHFTAMVWKNTKKMGVGKASASDGSSFVVARYFPAGNVVNEGFFE  143 (149)
T ss_dssp             CCHHHHHHHHHGGGGGCC-TTSC-C-----CCGGGHHHHHHHCTTCCEEEEEEEECTTSCEEEEEEEESCCCCCSTTHHH
T ss_pred             ccHHHHHHHHHHHHhhcc-cCCC-C-----cccccchhhheecCCceEeeEEEEEcCCCCEEEEEEeeCCCCcCCcccch
Confidence            356789999999999999 8774 2     3456899999999999999999999988778999999999999775  89


Q ss_pred             cCCCCC
Q psy15927         90 ENVPNV   95 (98)
Q Consensus        90 ~nv~~p   95 (98)
                      +||+||
T Consensus       144 ~nv~~p  149 (149)
T d1smba_         144 ENVLPP  149 (149)
T ss_dssp             HHSCCC
T ss_pred             hcCCCc
Confidence            999998



>d1cfea_ d.111.1.1 (A:) Pathogenesis-related protein 1 (PR1) {Tomato (Lycopersicon esculentum), P14a [TaxId: 4081]} Back     information, alignment and structure
>d1rc9a1 d.111.1.1 (A:1-164) Cysteine-rich secretory protein (SteCRISP) {Chinese green tree viper (Trimeresurus stejnegeri) [TaxId: 39682]} Back     information, alignment and structure
>d1qnxa_ d.111.1.1 (A:) Insect allergen 5 (AG5) {Yellow jacket (Vespula vulgaris), Ves v 5 [TaxId: 7454]} Back     information, alignment and structure