Psyllid ID: psy16032
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 243 | ||||||
| 195448799 | 513 | GK10191 [Drosophila willistoni] gi|19416 | 0.386 | 0.183 | 0.447 | 7e-16 | |
| 195134596 | 514 | GI11185 [Drosophila mojavensis] gi|19390 | 0.399 | 0.188 | 0.444 | 3e-15 | |
| 195394293 | 522 | GJ19547 [Drosophila virilis] gi|19415029 | 0.399 | 0.185 | 0.444 | 1e-14 | |
| 157107858 | 416 | cytochrome P450 [Aedes aegypti] | 0.399 | 0.233 | 0.428 | 1e-14 | |
| 195041083 | 529 | GH12529 [Drosophila grimshawi] gi|193900 | 0.399 | 0.183 | 0.434 | 1e-14 | |
| 403183505 | 499 | AAEL004888-PA [Aedes aegypti] | 0.399 | 0.194 | 0.428 | 2e-14 | |
| 170029657 | 491 | cytochrome P450 [Culex quinquefasciatus] | 0.419 | 0.207 | 0.398 | 9e-14 | |
| 242013515 | 499 | cytochrome P-450, putative [Pediculus hu | 0.390 | 0.190 | 0.371 | 2e-13 | |
| 195555366 | 331 | GD24859 [Drosophila simulans] gi|1942031 | 0.386 | 0.283 | 0.437 | 4e-13 | |
| 194892637 | 581 | GG19180 [Drosophila erecta] gi|190649346 | 0.386 | 0.161 | 0.437 | 4e-13 |
| >gi|195448799|ref|XP_002071819.1| GK10191 [Drosophila willistoni] gi|194167904|gb|EDW82805.1| GK10191 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Score = 90.1 bits (222), Expect = 7e-16, Method: Compositional matrix adjust.
Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 2/96 (2%)
Query: 132 FLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSK 191
FL+E + + E+Y +QL HLL DLFGA +DT+ +RWFLL MA D+Q LR+ +
Sbjct: 292 FLRERQPHSELYCQEQLRHLLADLFGAGVDTALATLRWFLLYMACNPDIQRQLRSHLRHL 351
Query: 192 SSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTP 227
SS +L+++ ++YL ACI+E R R++V LG P
Sbjct: 352 SSTP--SLEELEPLTYLRACISEVQRIRSVVPLGIP 385
|
Source: Drosophila willistoni Species: Drosophila willistoni Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195134596|ref|XP_002011723.1| GI11185 [Drosophila mojavensis] gi|193906846|gb|EDW05713.1| GI11185 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195394293|ref|XP_002055780.1| GJ19547 [Drosophila virilis] gi|194150290|gb|EDW65981.1| GJ19547 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|157107858|ref|XP_001649971.1| cytochrome P450 [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|195041083|ref|XP_001991189.1| GH12529 [Drosophila grimshawi] gi|193900947|gb|EDV99813.1| GH12529 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|403183505|gb|EAT43717.2| AAEL004888-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170029657|ref|XP_001842708.1| cytochrome P450 [Culex quinquefasciatus] gi|167864027|gb|EDS27410.1| cytochrome P450 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|242013515|ref|XP_002427450.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212511836|gb|EEB14712.1| cytochrome P-450, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|195555366|ref|XP_002077090.1| GD24859 [Drosophila simulans] gi|194203108|gb|EDX16684.1| GD24859 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|194892637|ref|XP_001977697.1| GG19180 [Drosophila erecta] gi|190649346|gb|EDV46624.1| GG19180 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 243 | ||||||
| FB|FBgn0004959 | 574 | phm "phantom" [Drosophila mela | 0.386 | 0.163 | 0.437 | 1.9e-14 | |
| ZFIN|ZDB-GENE-070730-1 | 533 | cyp2u1 "cytochrome P450, famil | 0.489 | 0.223 | 0.338 | 8.4e-08 | |
| UNIPROTKB|E1BFL1 | 501 | CYP2J2 "Uncharacterized protei | 0.407 | 0.197 | 0.339 | 1.7e-07 | |
| UNIPROTKB|H9KZR6 | 93 | H9KZR6 "Uncharacterized protei | 0.329 | 0.860 | 0.372 | 2e-07 | |
| ZFIN|ZDB-GENE-041001-155 | 496 | cyp2p7 "cytochrome P450, famil | 0.399 | 0.195 | 0.362 | 2.3e-07 | |
| ZFIN|ZDB-GENE-040426-1571 | 505 | cyp2k6 "cytochrome P450, famil | 0.395 | 0.190 | 0.322 | 2.4e-07 | |
| ZFIN|ZDB-GENE-040120-2 | 497 | cyp2p9 "cytochrome P450, famil | 0.399 | 0.195 | 0.362 | 3e-07 | |
| MGI|MGI:88608 | 491 | Cyp2f2 "cytochrome P450, famil | 0.390 | 0.193 | 0.357 | 3.9e-07 | |
| ZFIN|ZDB-GENE-041210-324 | 496 | cyp2j20 "cytochrome P450, fami | 0.399 | 0.195 | 0.362 | 3.9e-07 | |
| ZFIN|ZDB-GENE-090312-107 | 497 | cyp2ae1 "cytochrome P450, fami | 0.831 | 0.406 | 0.254 | 5.3e-07 |
| FB|FBgn0004959 phm "phantom" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 194 (73.4 bits), Expect = 1.9e-14, P = 1.9e-14
Identities = 42/96 (43%), Positives = 58/96 (60%)
Query: 132 FLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSK 191
FL ++ ++Y QL HLL DLFGA +DTS +RWFLL +A EQ Q L +
Sbjct: 344 FLAVRDTDSQLYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPL 403
Query: 192 SSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTP 227
G TL+++ ++YL ACI+ET R R++V LG P
Sbjct: 404 --GPSPTLEELEPLAYLRACISETMRIRSVVPLGIP 437
|
|
| ZFIN|ZDB-GENE-070730-1 cyp2u1 "cytochrome P450, family 2, subfamily U, polypeptide 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BFL1 CYP2J2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KZR6 H9KZR6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041001-155 cyp2p7 "cytochrome P450, family 2, subfamily P, polypeptide 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1571 cyp2k6 "cytochrome P450, family 2, subfamily K, polypeptide 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040120-2 cyp2p9 "cytochrome P450, family 2, subfamily P, polypeptide 9" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88608 Cyp2f2 "cytochrome P450, family 2, subfamily f, polypeptide 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-324 cyp2j20 "cytochrome P450, family 2, subfamily J, polypeptide 20" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090312-107 cyp2ae1 "cytochrome P450, family 2, subfamily AE, polypeptide 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 243 | |||
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 1e-12 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 2e-12 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 1e-08 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 2e-08 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 3e-08 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 7e-08 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 9e-08 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 4e-06 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 2e-05 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 2e-05 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 2e-05 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 6e-04 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 9e-04 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 0.001 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
Score = 66.1 bits (162), Expect = 1e-12
Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 4/67 (5%)
Query: 1 MVIPFLYSIHMNGEAHQEPHRFDPGRFL----QDKLPAQFMPFQVGKRMCMGGELARMIA 56
+VI LY++H + E P FDP RFL + + F+PF G R C+G LARM
Sbjct: 361 LVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCLGERLARMEM 420
Query: 57 TLFLSNL 63
LFL+ L
Sbjct: 421 KLFLATL 427
|
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| KOG0156|consensus | 489 | 99.95 | ||
| KOG0158|consensus | 499 | 99.93 | ||
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.93 | |
| KOG0159|consensus | 519 | 99.91 | ||
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.91 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.91 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.9 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.9 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.9 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.9 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.9 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.9 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.9 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.89 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.89 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.89 | |
| KOG0157|consensus | 497 | 99.89 | ||
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.89 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.88 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.88 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 99.88 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.88 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.87 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.87 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.87 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.86 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.85 | |
| KOG0158|consensus | 499 | 99.85 | ||
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.85 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.83 | |
| KOG0684|consensus | 486 | 99.83 | ||
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.81 | |
| KOG0156|consensus | 489 | 99.79 | ||
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.79 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 99.79 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.79 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.78 | |
| KOG0157|consensus | 497 | 99.77 | ||
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.76 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.76 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.76 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 99.76 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.75 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.75 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.74 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.74 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.74 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.74 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.74 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.73 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.73 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.72 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.72 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.72 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.72 | |
| PLN02648 | 480 | allene oxide synthase | 99.72 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.72 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.71 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.7 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.69 | |
| KOG0159|consensus | 519 | 99.66 | ||
| KOG0684|consensus | 486 | 99.61 | ||
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 99.57 | |
| PLN02648 | 480 | allene oxide synthase | 99.52 | |
| PF08492 | 59 | SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 | 82.05 |
| >KOG0156|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=3e-27 Score=201.37 Aligned_cols=134 Identities=25% Similarity=0.341 Sum_probs=118.5
Q ss_pred HHHHHHHHHHHHHHHHH--------hhhhHHHHHHhhcCCCC-CCHHHHHHHHHHHhhccccchHHHHHHHHHHHhhCHH
Q psy16032 109 ARMIATLFLSNLIKQYR--------VTYESAFLQEAKSNPEI-YTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQD 179 (243)
Q Consensus 109 ~~~~~~~~~~~~~~~~~--------~~~~~~ll~~~~~~~~~-~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~~p~ 179 (243)
.....+.+++..+++++ .|++|.++...++++.. ++++++...+.++++||.|||++++.|++.+|++||+
T Consensus 239 ~~~~~~~~~~~~i~eh~~~~~~~~~~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pe 318 (489)
T KOG0156|consen 239 VSKRLDEFLERIIDEHREKIGDEEGRDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPE 318 (489)
T ss_pred HHHHHHHHHHHHHHHHHhhhccCCCCcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHH
Confidence 33345677777777753 47999999987654333 8999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCcccccc-----cCCCCCCcccc
Q psy16032 180 VQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQVY-----LSSGLPDSERL 242 (243)
Q Consensus 180 ~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~~-----~~~~ipg~~~~ 242 (243)
+|+|+++||+++.|.++ ++.+|+.+|||++|+|+|++|++|++|+.+||.++ .||.||.|+.+
T Consensus 319 v~~K~qeEId~vvG~~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v 387 (489)
T KOG0156|consen 319 VQKKLQEEIDEVVGKGRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTV 387 (489)
T ss_pred HHHHHHHHHHHHhCCCCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEE
Confidence 99999999999999998 99999999999999999999999999999999864 77899988764
|
|
| >KOG0158|consensus | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >KOG0158|consensus | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >KOG0156|consensus | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 243 | ||||
| 3qz1_A | 496 | Crystal Structure Of Bovine Steroid Of 21-Hydroxyla | 3e-08 | ||
| 2f9q_A | 479 | Crystal Structure Of Human Cytochrome P450 2d6 Leng | 4e-08 | ||
| 3qm4_A | 479 | Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl | 4e-08 | ||
| 1dt6_A | 473 | Structure Of Mammalian Cytochrome P450 2c5 Length = | 2e-07 | ||
| 3e4e_A | 476 | Human Cytochrome P450 2e1 In Complex With The Inhib | 2e-06 | ||
| 3e4e_A | 476 | Human Cytochrome P450 2e1 In Complex With The Inhib | 1e-04 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 3e-06 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 3e-06 | ||
| 1pq2_A | 476 | Crystal Structure Of Human Drug Metabolizing Cytoch | 7e-06 | ||
| 4h1n_A | 479 | Crystal Structure Of P450 2b4 F297a Mutant In Compl | 4e-05 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 5e-05 | ||
| 2q6n_A | 478 | Structure Of Cytochrome P450 2b4 With Bound 1-(4- C | 5e-05 | ||
| 4i8v_A | 491 | Human Cytochrome P450 1a1 In Complex With Alpha-nap | 5e-05 | ||
| 1suo_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 With Bou | 5e-05 | ||
| 1po5_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 Length = | 6e-05 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 9e-05 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 9e-05 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 9e-05 | ||
| 3ebs_A | 476 | Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C | 9e-05 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 9e-05 | ||
| 2p85_A | 476 | Structure Of Human Lung Cytochrome P450 2a13 With I | 1e-04 | ||
| 1og2_A | 475 | Structure Of Human Cytochrome P450 Cyp2c9 Length = | 1e-04 | ||
| 1r9o_A | 477 | Crystal Structure Of P4502c9 With Flurbiprofen Boun | 1e-04 | ||
| 3tk3_A | 476 | Cytochrome P450 2b4 Mutant L437a In Complex With 4- | 1e-04 | ||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 1e-04 | ||
| 3pm0_A | 507 | Structural Characterization Of The Complex Between | 2e-04 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 3e-04 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 7e-04 |
| >pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 | Back alignment and structure |
|
| >pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 | Back alignment and structure |
| >pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 | Back alignment and structure |
| >pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 | Back alignment and structure |
| >pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 | Back alignment and structure |
| >pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 | Back alignment and structure |
| >pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 | Back alignment and structure |
| >pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 | Back alignment and structure |
| >pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
| >pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 | Back alignment and structure |
| >pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 | Back alignment and structure |
| >pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 | Back alignment and structure |
| >pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 | Back alignment and structure |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
| >pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 243 | |||
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 5e-18 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 6e-16 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 9e-18 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 2e-14 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 1e-17 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 1e-15 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 1e-17 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 5e-16 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 2e-17 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 3e-15 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 3e-17 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 4e-15 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 3e-17 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 4e-15 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 4e-17 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 3e-16 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 1e-16 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 2e-15 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 3e-16 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 3e-16 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 3e-14 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 1e-11 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 2e-13 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 5e-09 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 3e-12 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 1e-07 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 2e-11 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 2e-11 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 3e-10 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 7e-10 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 4e-10 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 1e-09 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 5e-10 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 9e-06 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 6e-09 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 2e-08 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 6e-09 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-08 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 7e-09 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 2e-08 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 9e-09 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 8e-06 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 3e-08 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 6e-07 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 3e-08 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 2e-05 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 3e-08 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 2e-06 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 4e-08 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 4e-07 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 9e-08 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 1e-07 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 3e-07 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 1e-04 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 1e-06 |
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
Score = 81.5 bits (202), Expect = 5e-18
Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 13/125 (10%)
Query: 116 FLSNLIKQYRVTYES--------AFL---QEAKSNPE-IYTSKQLYHLLGDLFGASLDTS 163
FLS LI++ V + A+L + K++P ++ + L +G+L A +T+
Sbjct: 230 FLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETT 289
Query: 164 TILMRWFLLVMAMEQDVQDTLRAEITSK-SSGTIVTLDDITSMSYLAACINETHRYRTIV 222
T ++RW +L MA+ ++Q ++ EI + DD M Y A ++E R+ IV
Sbjct: 290 TNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIV 349
Query: 223 TLGTP 227
LG
Sbjct: 350 PLGIF 354
|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.92 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.92 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.91 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.91 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.91 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.91 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.91 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 99.9 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 99.9 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.9 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.9 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.9 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.9 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.9 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.9 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.9 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 99.9 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 99.9 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.89 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.88 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 99.88 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.88 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 99.87 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.82 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.82 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.81 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.81 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.8 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 99.8 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.8 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.8 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.8 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.8 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.8 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.79 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.79 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.79 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.79 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.79 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.79 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.79 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.79 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 99.79 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 99.79 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.79 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 99.78 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 99.78 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 99.78 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.78 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 99.78 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.78 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.78 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.78 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.77 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 99.77 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.77 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.77 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.77 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 99.77 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.77 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.77 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.77 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.77 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.77 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 99.77 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.77 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.77 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.77 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.76 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.76 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 99.76 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.76 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.76 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 99.76 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.75 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.75 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.75 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.75 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.75 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.75 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.75 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.75 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.75 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.74 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 99.74 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.74 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.73 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.73 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.72 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.72 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.72 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.72 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.72 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.72 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.72 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 99.71 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.71 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 99.7 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.7 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.7 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.7 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.7 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 99.69 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 99.69 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.69 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.69 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.69 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.69 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 99.69 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.69 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 99.69 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.69 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.69 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.69 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.68 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.68 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 99.68 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.68 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.68 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 99.68 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.68 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.68 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.68 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.67 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.67 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.67 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.67 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.66 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 99.66 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.66 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.66 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.66 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.66 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.66 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.66 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.66 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.66 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.65 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.65 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.65 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.63 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.63 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.62 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.61 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.61 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.6 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.59 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.59 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.57 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.56 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.54 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.44 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.35 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.34 |
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
Probab=99.92 E-value=1.5e-24 Score=186.10 Aligned_cols=133 Identities=26% Similarity=0.405 Sum_probs=112.8
Q ss_pred HHHHHHHHHHHHHHHH--------hhhhHHHHHHhhc----CCCCCCHHHHHHHHHHHhhccccchHHHHHHHHHHHhhC
Q psy16032 110 RMIATLFLSNLIKQYR--------VTYESAFLQEAKS----NPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAME 177 (243)
Q Consensus 110 ~~~~~~~~~~~~~~~~--------~~~~~~ll~~~~~----~~~~~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~~ 177 (243)
......++.+.+++++ .|+++.++..... ++..++++++..++.++++||+|||+++++|++++|++|
T Consensus 224 ~~~~~~~~~~~i~~r~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~l~~~ei~~~~~~l~~AG~dTta~~l~~~l~~L~~~ 303 (481)
T 3czh_A 224 AAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALY 303 (481)
T ss_dssp HHHHHHHHHHHHHHHHTTCCTTCCSSHHHHHHHHHHHTTTCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHhcccCccccccHHHHHHHHHHHHHhccchHHHHHHHHHHHHhhC
Confidence 3344566666666654 3688888876432 133589999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCcccccc-----cCCCCCCcccc
Q psy16032 178 QDVQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQVY-----LSSGLPDSERL 242 (243)
Q Consensus 178 p~~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~~-----~~~~ipg~~~~ 242 (243)
|++|+||++|++++++++. ++++++.+|||+++||+|+||++|+++++++|.+. .|+.||.|+.+
T Consensus 304 P~~~~kl~~Ei~~~~~~~~~~~~~~~~~lpyl~a~i~E~lRl~p~~~~~~~R~~~~d~~l~G~~Ip~Gt~V 374 (481)
T 3czh_A 304 PNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTV 374 (481)
T ss_dssp HHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSSCEEETTEEECTTCEE
T ss_pred hHHHHHHHHHHHHhcCCCCCCChhhhhhChHHHHHHHHHHhhccccccCcceeecCCeEEeCEEcCCCCEE
Confidence 9999999999999998766 99999999999999999999999999988888875 47788888764
|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 243 | ||||
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 2e-12 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 0.003 | |
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 3e-12 | |
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 0.003 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 6e-12 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 0.004 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 1e-11 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 0.002 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 2e-11 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 3e-11 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 0.003 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 5e-11 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 5e-11 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 0.003 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 6e-11 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 0.001 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 4e-10 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 0.002 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 4e-10 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 1e-09 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 2e-09 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 3e-09 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 3e-09 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 3e-09 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 5e-09 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 6e-09 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 0.002 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 1e-08 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 1e-08 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 0.002 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 1e-08 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 0.003 |
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Cytochrome P450-TERP species: Pseudomonas sp. [TaxId: 306]
Score = 63.7 bits (153), Expect = 2e-12
Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 5/63 (7%)
Query: 1 MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFL 60
++ S + + E P FD RF P + + F G MC+G LA++ +F
Sbjct: 337 RIMLSYPSANRDEEVFSNPDEFDITRF-----PNRHLGFGWGAHMCLGQHLAKLEMKIFF 391
Query: 61 SNL 63
L
Sbjct: 392 EEL 394
|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 243 | |||
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.86 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.86 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 99.86 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 99.84 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.84 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.82 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 99.82 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.82 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 99.82 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.81 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.77 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.75 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.74 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.74 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.73 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.73 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.7 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.7 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.7 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.69 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.69 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.66 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.65 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.64 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.63 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.63 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.61 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.59 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.58 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.56 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.48 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.37 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.36 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.32 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.31 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.23 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.14 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.03 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 98.96 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 98.93 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 98.76 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 98.72 |
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51) species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.86 E-value=3.2e-22 Score=167.60 Aligned_cols=135 Identities=10% Similarity=0.153 Sum_probs=110.7
Q ss_pred HHHHHHHHHHHHHHHHHHHh---------hhhHHHHHHhhcC-CCCCCHHHHHHHHHHHhhccccchHHHHHHHHHHHhh
Q psy16032 107 ELARMIATLFLSNLIKQYRV---------TYESAFLQEAKSN-PEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAM 176 (243)
Q Consensus 107 ~~~~~~~~~~~~~~~~~~~~---------~~~~~ll~~~~~~-~~~~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~ 176 (243)
..+++...+++.+.+++++. |+++.++....+. ...++++++.+++..+++||+|||+.+++|+++.|+.
T Consensus 191 ~~~~~~l~~~~~~~i~~~~~~~~~~~~~~dll~~ll~~~~~~~~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~ 270 (445)
T d2ciba1 191 DEARNGLVALVADIMNGRIANPPTDKSDRDMLDVLIAVKAETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMR 270 (445)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCC-----CCCHHHHHHHCBCTTSSBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhhhcccccccccccchhhhhhccccccccccCCcchhhhhhhhhhhhccccchhhcccccccccc
Confidence 34445555566555554432 5888888765433 3358999999999999999999999999999999999
Q ss_pred CHHHHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCccccc-----ccCCCCCCcccc
Q psy16032 177 EQDVQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQV-----YLSSGLPDSERL 242 (243)
Q Consensus 177 ~p~~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~-----~~~~~ipg~~~~ 242 (243)
||++|+|+++|++++.+++. ++++++.+||||++||+|++|++|+++... |.+ ..|+.||.|+.+
T Consensus 271 ~p~~~~~lr~Ei~~~~~~~~~~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~-~~~~~~~~~~~~~ip~g~~v 341 (445)
T d2ciba1 271 HRDAYAAVIDELDELYGDGRSVSFHALRQIPQLENVLKETLRLHPPLIILM-RVAKGEFEVQGHRIHEGDLV 341 (445)
T ss_dssp CHHHHHHHHHHHHHHGGGCCCHHHHTTSCCHHHHHHHHHHHHHSCSCCCEE-EEECSCEEETTEEECTTCEE
T ss_pred cccccccccccccccccccccchhhhcccchhhccccccccccccccceec-cccccccccceeeccccccc
Confidence 99999999999999998777 899999999999999999999999998754 443 477888888754
|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|