Psyllid ID: psy16032


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240---
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLSSGLPDSERLA
cEEEccccccccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccc
cccccHHHHHcccHHccccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccEccccEEEEccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHcccccccccEEEEEccccccHccc
mvipflysihmngeahqephrfdpgrflqdklpaqfmpfqvgkRMCMGGELARMIATLFLSnlnqipisplssvrLATYYQVdltltpdqihlsglpdgkrmcmGGELARMIATLFLSNLIKQYRVTYESAFLQeaksnpeiytsKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEItskssgtivtldditSMSYLAACINETHRYRTIVtlgtpdqvylssglpdserla
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRaeitskssgtivtldditSMSYLAACINETHRYRTIVTLgtpdqvylssglpdserla
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLSSGLPDSERLA
**IPFLYSIHM*************GRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYL***********
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEA******YTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLSSGLPDS****
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLS**********
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLSSGLP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFLSNLNQIPISPLSSVRLATYYQVDLTLTPDQIHLSGLPDGKRMCMGGELARMIATLFLSNLIKQYRVTYESAFLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSKSSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTPDQVYLSSGLPDSERLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query243 2.2.26 [Sep-21-2011]
Q9VWR5 574 Cytochrome P450 306a1 OS= yes N/A 0.386 0.163 0.437 8e-15
O54750 501 Cytochrome P450 2J6 OS=Mu yes N/A 0.502 0.243 0.328 6e-09
P51590 502 Cytochrome P450 2J3 OS=Ra no N/A 0.502 0.243 0.318 7e-09
Q2LA59492 Steroid 21-hydroxylase OS N/A N/A 0.382 0.189 0.326 5e-08
Q2LA60492 Steroid 21-hydroxylase OS N/A N/A 0.382 0.189 0.326 5e-08
O18992 497 Cytochrome P450 2D19 OS=C no N/A 0.448 0.219 0.328 6e-08
Q95078538 Cytochrome P450 18a1 OS=D no N/A 0.255 0.115 0.409 7e-08
P33267491 Cytochrome P450 2F2 OS=Mu no N/A 0.390 0.193 0.357 7e-08
Q91X77490 Cytochrome P450 2C50 OS=M no N/A 0.395 0.195 0.351 1e-07
Q6XVG2490 Cytochrome P450 2C54 OS=M no N/A 0.395 0.195 0.351 1e-07
>sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 Back     alignment and function desciption
 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 58/96 (60%), Gaps = 2/96 (2%)

Query: 132 FLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSK 191
           FL    ++ ++Y   QL HLL DLFGA +DTS   +RWFLL +A EQ  Q  L   +   
Sbjct: 344 FLAVRDTDSQLYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLL-- 401

Query: 192 SSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTP 227
             G   TL+++  ++YL ACI+ET R R++V LG P
Sbjct: 402 PLGPSPTLEELEPLAYLRACISETMRIRSVVPLGIP 437




Involved in the metabolism of insect hormones; responsible for ecdysteroid C25-hydroxylase activity. May be involved in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 Back     alignment and function description
>sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 Back     alignment and function description
>sp|Q2LA59|CP21A_LYNLY Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 Back     alignment and function description
>sp|Q2LA60|CP21A_FELCA Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 Back     alignment and function description
>sp|O18992|CP2DJ_CALJA Cytochrome P450 2D19 OS=Callithrix jacchus GN=CYP2D19 PE=2 SV=1 Back     alignment and function description
>sp|Q95078|CP18A_DROME Cytochrome P450 18a1 OS=Drosophila melanogaster GN=Cyp18a1 PE=2 SV=2 Back     alignment and function description
>sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=2 SV=1 Back     alignment and function description
>sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 Back     alignment and function description
>sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
195448799 513 GK10191 [Drosophila willistoni] gi|19416 0.386 0.183 0.447 7e-16
195134596 514 GI11185 [Drosophila mojavensis] gi|19390 0.399 0.188 0.444 3e-15
195394293 522 GJ19547 [Drosophila virilis] gi|19415029 0.399 0.185 0.444 1e-14
157107858 416 cytochrome P450 [Aedes aegypti] 0.399 0.233 0.428 1e-14
195041083 529 GH12529 [Drosophila grimshawi] gi|193900 0.399 0.183 0.434 1e-14
403183505 499 AAEL004888-PA [Aedes aegypti] 0.399 0.194 0.428 2e-14
170029657 491 cytochrome P450 [Culex quinquefasciatus] 0.419 0.207 0.398 9e-14
242013515 499 cytochrome P-450, putative [Pediculus hu 0.390 0.190 0.371 2e-13
195555366331 GD24859 [Drosophila simulans] gi|1942031 0.386 0.283 0.437 4e-13
194892637 581 GG19180 [Drosophila erecta] gi|190649346 0.386 0.161 0.437 4e-13
>gi|195448799|ref|XP_002071819.1| GK10191 [Drosophila willistoni] gi|194167904|gb|EDW82805.1| GK10191 [Drosophila willistoni] Back     alignment and taxonomy information
 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 63/96 (65%), Gaps = 2/96 (2%)

Query: 132 FLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSK 191
           FL+E + + E+Y  +QL HLL DLFGA +DT+   +RWFLL MA   D+Q  LR+ +   
Sbjct: 292 FLRERQPHSELYCQEQLRHLLADLFGAGVDTALATLRWFLLYMACNPDIQRQLRSHLRHL 351

Query: 192 SSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTP 227
           SS    +L+++  ++YL ACI+E  R R++V LG P
Sbjct: 352 SSTP--SLEELEPLTYLRACISEVQRIRSVVPLGIP 385




Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195134596|ref|XP_002011723.1| GI11185 [Drosophila mojavensis] gi|193906846|gb|EDW05713.1| GI11185 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195394293|ref|XP_002055780.1| GJ19547 [Drosophila virilis] gi|194150290|gb|EDW65981.1| GJ19547 [Drosophila virilis] Back     alignment and taxonomy information
>gi|157107858|ref|XP_001649971.1| cytochrome P450 [Aedes aegypti] Back     alignment and taxonomy information
>gi|195041083|ref|XP_001991189.1| GH12529 [Drosophila grimshawi] gi|193900947|gb|EDV99813.1| GH12529 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|403183505|gb|EAT43717.2| AAEL004888-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170029657|ref|XP_001842708.1| cytochrome P450 [Culex quinquefasciatus] gi|167864027|gb|EDS27410.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242013515|ref|XP_002427450.1| cytochrome P-450, putative [Pediculus humanus corporis] gi|212511836|gb|EEB14712.1| cytochrome P-450, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195555366|ref|XP_002077090.1| GD24859 [Drosophila simulans] gi|194203108|gb|EDX16684.1| GD24859 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194892637|ref|XP_001977697.1| GG19180 [Drosophila erecta] gi|190649346|gb|EDV46624.1| GG19180 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query243
FB|FBgn0004959 574 phm "phantom" [Drosophila mela 0.386 0.163 0.437 1.9e-14
ZFIN|ZDB-GENE-070730-1 533 cyp2u1 "cytochrome P450, famil 0.489 0.223 0.338 8.4e-08
UNIPROTKB|E1BFL1501 CYP2J2 "Uncharacterized protei 0.407 0.197 0.339 1.7e-07
UNIPROTKB|H9KZR693 H9KZR6 "Uncharacterized protei 0.329 0.860 0.372 2e-07
ZFIN|ZDB-GENE-041001-155496 cyp2p7 "cytochrome P450, famil 0.399 0.195 0.362 2.3e-07
ZFIN|ZDB-GENE-040426-1571 505 cyp2k6 "cytochrome P450, famil 0.395 0.190 0.322 2.4e-07
ZFIN|ZDB-GENE-040120-2497 cyp2p9 "cytochrome P450, famil 0.399 0.195 0.362 3e-07
MGI|MGI:88608491 Cyp2f2 "cytochrome P450, famil 0.390 0.193 0.357 3.9e-07
ZFIN|ZDB-GENE-041210-324496 cyp2j20 "cytochrome P450, fami 0.399 0.195 0.362 3.9e-07
ZFIN|ZDB-GENE-090312-107 497 cyp2ae1 "cytochrome P450, fami 0.831 0.406 0.254 5.3e-07
FB|FBgn0004959 phm "phantom" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 194 (73.4 bits), Expect = 1.9e-14, P = 1.9e-14
 Identities = 42/96 (43%), Positives = 58/96 (60%)

Query:   132 FLQEAKSNPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQDVQDTLRAEITSK 191
             FL    ++ ++Y   QL HLL DLFGA +DTS   +RWFLL +A EQ  Q  L   +   
Sbjct:   344 FLAVRDTDSQLYCDDQLRHLLADLFGAGVDTSLATLRWFLLYLAREQRCQRRLHELLLPL 403

Query:   192 SSGTIVTLDDITSMSYLAACINETHRYRTIVTLGTP 227
               G   TL+++  ++YL ACI+ET R R++V LG P
Sbjct:   404 --GPSPTLEELEPLAYLRACISETMRIRSVVPLGIP 437


GO:0048477 "oogenesis" evidence=IMP
GO:0001700 "embryonic development via the syncytial blastoderm" evidence=IMP
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0017143 "insecticide metabolic process" evidence=NAS
GO:0020037 "heme binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0006697 "ecdysone biosynthetic process" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0035302 "ecdysteroid 25-hydroxylase activity" evidence=IDA
ZFIN|ZDB-GENE-070730-1 cyp2u1 "cytochrome P450, family 2, subfamily U, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BFL1 CYP2J2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZR6 H9KZR6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041001-155 cyp2p7 "cytochrome P450, family 2, subfamily P, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1571 cyp2k6 "cytochrome P450, family 2, subfamily K, polypeptide 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040120-2 cyp2p9 "cytochrome P450, family 2, subfamily P, polypeptide 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:88608 Cyp2f2 "cytochrome P450, family 2, subfamily f, polypeptide 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-324 cyp2j20 "cytochrome P450, family 2, subfamily J, polypeptide 20" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-107 cyp2ae1 "cytochrome P450, family 2, subfamily AE, polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
pfam00067461 pfam00067, p450, Cytochrome P450 1e-12
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-12
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-08
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-08
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 3e-08
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 7e-08
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 9e-08
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-06
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-05
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 2e-05
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 2e-05
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-04
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 9e-04
PLN02290 516 PLN02290, PLN02290, cytokinin trans-hydroxylase 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
 Score = 66.1 bits (162), Expect = 1e-12
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 1   MVIPFLYSIHMNGEAHQEPHRFDPGRFL----QDKLPAQFMPFQVGKRMCMGGELARMIA 56
           +VI  LY++H + E    P  FDP RFL    + +    F+PF  G R C+G  LARM  
Sbjct: 361 LVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCLGERLARMEM 420

Query: 57  TLFLSNL 63
            LFL+ L
Sbjct: 421 KLFLATL 427


Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461

>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 243
KOG0156|consensus 489 99.95
KOG0158|consensus 499 99.93
PLN02971 543 tryptophan N-hydroxylase 99.93
KOG0159|consensus 519 99.91
PLN03234 499 cytochrome P450 83B1; Provisional 99.91
PLN00168 519 Cytochrome P450; Provisional 99.91
PLN03112 514 cytochrome P450 family protein; Provisional 99.9
PLN02394 503 trans-cinnamate 4-monooxygenase 99.9
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.9
PLN02290516 cytokinin trans-hydroxylase 99.9
PLN02966 502 cytochrome P450 83A1 99.9
PLN02687 517 flavonoid 3'-monooxygenase 99.9
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.9
PTZ00404482 cytochrome P450; Provisional 99.89
PLN02183 516 ferulate 5-hydroxylase 99.89
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.89
KOG0157|consensus 497 99.89
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.89
PLN03018 534 homomethionine N-hydroxylase 99.88
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.88
PLN02500 490 cytochrome P450 90B1 99.88
PLN02738 633 carotene beta-ring hydroxylase 99.88
PLN02774463 brassinosteroid-6-oxidase 99.87
PLN02936 489 epsilon-ring hydroxylase 99.87
PLN02655 466 ent-kaurene oxidase 99.87
PLN02302490 ent-kaurenoic acid oxidase 99.86
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.85
KOG0158|consensus499 99.85
PLN02196463 abscisic acid 8'-hydroxylase 99.85
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.83
KOG0684|consensus 486 99.83
PTZ00404482 cytochrome P450; Provisional 99.81
KOG0156|consensus489 99.79
PLN02394503 trans-cinnamate 4-monooxygenase 99.79
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.79
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.79
PLN02971543 tryptophan N-hydroxylase 99.78
KOG0157|consensus497 99.77
PLN00168519 Cytochrome P450; Provisional 99.76
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.76
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.76
PLN02500490 cytochrome P450 90B1 99.76
PLN03018534 homomethionine N-hydroxylase 99.75
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.75
PLN02738633 carotene beta-ring hydroxylase 99.74
PLN03234499 cytochrome P450 83B1; Provisional 99.74
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.74
PLN02183516 ferulate 5-hydroxylase 99.74
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.74
PLN02655466 ent-kaurene oxidase 99.73
PLN02290516 cytokinin trans-hydroxylase 99.73
PLN02196463 abscisic acid 8'-hydroxylase 99.72
PLN02966502 cytochrome P450 83A1 99.72
PLN03112514 cytochrome P450 family protein; Provisional 99.72
PLN02687517 flavonoid 3'-monooxygenase 99.72
PLN02648 480 allene oxide synthase 99.72
PLN02302490 ent-kaurenoic acid oxidase 99.72
PLN02774463 brassinosteroid-6-oxidase 99.71
PLN02936489 epsilon-ring hydroxylase 99.7
PLN02987472 Cytochrome P450, family 90, subfamily A 99.69
KOG0159|consensus519 99.66
KOG0684|consensus486 99.61
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.57
PLN02648480 allene oxide synthase 99.52
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 82.05
>KOG0156|consensus Back     alignment and domain information
Probab=99.95  E-value=3e-27  Score=201.37  Aligned_cols=134  Identities=25%  Similarity=0.341  Sum_probs=118.5

Q ss_pred             HHHHHHHHHHHHHHHHH--------hhhhHHHHHHhhcCCCC-CCHHHHHHHHHHHhhccccchHHHHHHHHHHHhhCHH
Q psy16032        109 ARMIATLFLSNLIKQYR--------VTYESAFLQEAKSNPEI-YTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAMEQD  179 (243)
Q Consensus       109 ~~~~~~~~~~~~~~~~~--------~~~~~~ll~~~~~~~~~-~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~~p~  179 (243)
                      .....+.+++..+++++        .|++|.++...++++.. ++++++...+.++++||.|||++++.|++.+|++||+
T Consensus       239 ~~~~~~~~~~~~i~eh~~~~~~~~~~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pe  318 (489)
T KOG0156|consen  239 VSKRLDEFLERIIDEHREKIGDEEGRDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPE  318 (489)
T ss_pred             HHHHHHHHHHHHHHHHHhhhccCCCCcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHH
Confidence            33345677777777753        47999999987654333 8999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCcccccc-----cCCCCCCcccc
Q psy16032        180 VQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQVY-----LSSGLPDSERL  242 (243)
Q Consensus       180 ~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~~-----~~~~ipg~~~~  242 (243)
                      +|+|+++||+++.|.++ ++.+|+.+|||++|+|+|++|++|++|+.+||.++     .||.||.|+.+
T Consensus       319 v~~K~qeEId~vvG~~r~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v  387 (489)
T KOG0156|consen  319 VQKKLQEEIDEVVGKGRLVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTV  387 (489)
T ss_pred             HHHHHHHHHHHHhCCCCCCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEE
Confidence            99999999999999998 99999999999999999999999999999999864     77899988764



>KOG0158|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 3e-08
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 4e-08
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 4e-08
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-07
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 1e-04
3c6g_A 479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-06
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-06
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 7e-06
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-05
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 5e-05
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-05
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 5e-05
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-05
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 6e-05
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 9e-05
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 9e-05
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 9e-05
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 9e-05
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 9e-05
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-04
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 1e-04
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-04
3pm0_A507 Structural Characterization Of The Complex Between 2e-04
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-04
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 7e-04
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 6/99 (6%) Query: 1 MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFL 60 +VIP L H++ ++PH F P RFL+ + F G R+C+G LAR+ + L Sbjct: 382 VVIPNLQGAHLDETVWEQPHEFRPDRFLEPGANPSALAFGCGARVCLGESLARLELFVVL 441 Query: 61 SNLNQI------PISPLSSVRLATYYQVDLTLTPDQIHL 93 + L Q P+ L S++ Y V+L + P Q+ L Sbjct: 442 ARLLQAFTLLPPPVGALPSLQPDPYCGVNLKVQPFQVRL 480
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query243
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-18
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-16
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-18
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-14
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-17
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 1e-15
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-17
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-16
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 2e-17
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-15
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-17
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 4e-15
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 3e-17
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-15
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 4e-17
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-16
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 1e-16
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-15
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-16
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-16
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-14
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 1e-11
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-13
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 5e-09
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-12
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-07
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-11
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-11
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 3e-10
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 7e-10
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-10
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 1e-09
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-10
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 9e-06
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 6e-09
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-08
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 6e-09
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 2e-08
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 7e-09
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-08
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 9e-09
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 8e-06
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 3e-08
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 6e-07
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-08
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-05
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-08
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 2e-06
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-08
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 4e-07
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 9e-08
3dan_A 473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-07
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-07
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-04
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 1e-06
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
 Score = 81.5 bits (202), Expect = 5e-18
 Identities = 35/125 (28%), Positives = 61/125 (48%), Gaps = 13/125 (10%)

Query: 116 FLSNLIKQYRVTYES--------AFL---QEAKSNPE-IYTSKQLYHLLGDLFGASLDTS 163
           FLS LI++  V  +         A+L    + K++P   ++ + L   +G+L  A  +T+
Sbjct: 230 FLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETT 289

Query: 164 TILMRWFLLVMAMEQDVQDTLRAEITSK-SSGTIVTLDDITSMSYLAACINETHRYRTIV 222
           T ++RW +L MA+  ++Q  ++ EI          + DD   M Y  A ++E  R+  IV
Sbjct: 290 TNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIV 349

Query: 223 TLGTP 227
            LG  
Sbjct: 350 PLGIF 354


>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.92
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.92
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.91
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.91
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.91
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.91
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.91
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.9
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.9
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.9
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.9
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.9
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.9
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.9
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.9
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.9
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.9
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.9
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.89
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.88
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.88
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.88
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.87
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.82
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.82
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.81
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.81
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.8
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.8
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.8
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.8
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.8
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.8
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.8
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.79
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.79
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.79
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.79
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.79
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.79
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.79
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.79
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.79
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.79
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.79
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.78
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.78
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.78
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.78
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.78
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.78
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.78
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.78
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.77
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.77
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.77
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.77
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.77
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.77
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.77
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.77
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.77
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.77
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.77
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.77
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.77
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.77
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.77
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.76
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.76
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.76
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.76
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.76
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.76
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.75
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.75
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.75
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.75
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.75
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.75
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.75
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.75
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.75
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.74
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 99.74
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.74
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.73
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.73
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.72
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.72
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.72
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.72
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.72
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.72
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.72
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.71
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.71
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.7
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.7
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.7
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.7
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.7
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.69
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.69
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.69
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.69
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.69
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.69
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.69
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.69
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.69
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.69
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.69
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.69
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.68
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.68
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.68
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.68
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.68
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.68
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.68
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.68
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.68
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.67
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.67
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.67
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.67
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.66
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.66
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.66
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.66
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.66
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.66
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.66
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.66
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.66
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.66
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.65
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.65
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.65
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.63
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.63
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.62
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.61
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.61
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.6
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.59
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.59
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.57
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.56
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.54
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.44
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.35
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.34
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
Probab=99.92  E-value=1.5e-24  Score=186.10  Aligned_cols=133  Identities=26%  Similarity=0.405  Sum_probs=112.8

Q ss_pred             HHHHHHHHHHHHHHHH--------hhhhHHHHHHhhc----CCCCCCHHHHHHHHHHHhhccccchHHHHHHHHHHHhhC
Q psy16032        110 RMIATLFLSNLIKQYR--------VTYESAFLQEAKS----NPEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAME  177 (243)
Q Consensus       110 ~~~~~~~~~~~~~~~~--------~~~~~~ll~~~~~----~~~~~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~~  177 (243)
                      ......++.+.+++++        .|+++.++.....    ++..++++++..++.++++||+|||+++++|++++|++|
T Consensus       224 ~~~~~~~~~~~i~~r~~~~~~~~~~d~l~~ll~~~~~~~~~~~~~l~~~ei~~~~~~l~~AG~dTta~~l~~~l~~L~~~  303 (481)
T 3czh_A          224 AAVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALY  303 (481)
T ss_dssp             HHHHHHHHHHHHHHHHTTCCTTCCSSHHHHHHHHHHHTTTCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHhcccCccccccHHHHHHHHHHHHHhccchHHHHHHHHHHHHhhC
Confidence            3344566666666654        3688888876432    133589999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCcccccc-----cCCCCCCcccc
Q psy16032        178 QDVQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQVY-----LSSGLPDSERL  242 (243)
Q Consensus       178 p~~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~~-----~~~~ipg~~~~  242 (243)
                      |++|+||++|++++++++. ++++++.+|||+++||+|+||++|+++++++|.+.     .|+.||.|+.+
T Consensus       304 P~~~~kl~~Ei~~~~~~~~~~~~~~~~~lpyl~a~i~E~lRl~p~~~~~~~R~~~~d~~l~G~~Ip~Gt~V  374 (481)
T 3czh_A          304 PNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTV  374 (481)
T ss_dssp             HHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHHHHHCSSTTCSCEECSSCEEETTEEECTTCEE
T ss_pred             hHHHHHHHHHHHHhcCCCCCCChhhhhhChHHHHHHHHHHhhccccccCcceeecCCeEEeCEEcCCCCEE
Confidence            9999999999999998766 99999999999999999999999999988888875     47788888764



>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 243
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-12
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 0.003
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-12
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 0.003
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-12
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 0.004
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-11
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 0.002
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-11
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 3e-11
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 0.003
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-11
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 0.003
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 6e-11
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 0.001
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-10
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 0.002
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-10
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-09
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 2e-09
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 3e-09
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-09
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 3e-09
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 5e-09
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 6e-09
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.002
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-08
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 1e-08
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 0.002
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-08
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.003
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome P450-TERP
species: Pseudomonas sp. [TaxId: 306]
 Score = 63.7 bits (153), Expect = 2e-12
 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 5/63 (7%)

Query: 1   MVIPFLYSIHMNGEAHQEPHRFDPGRFLQDKLPAQFMPFQVGKRMCMGGELARMIATLFL 60
            ++    S + + E    P  FD  RF     P + + F  G  MC+G  LA++   +F 
Sbjct: 337 RIMLSYPSANRDEEVFSNPDEFDITRF-----PNRHLGFGWGAHMCLGQHLAKLEMKIFF 391

Query: 61  SNL 63
             L
Sbjct: 392 EEL 394


>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query243
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.86
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.86
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.86
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.84
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.84
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.82
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.82
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.82
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.82
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.81
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.77
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.75
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.74
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.74
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.73
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.73
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.7
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.7
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.7
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.69
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.69
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.66
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.65
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.64
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.63
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.63
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.61
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.59
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.58
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.56
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.48
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.37
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.36
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.32
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.31
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.23
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.14
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.03
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 98.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 98.93
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 98.76
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 98.72
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.86  E-value=3.2e-22  Score=167.60  Aligned_cols=135  Identities=10%  Similarity=0.153  Sum_probs=110.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHh---------hhhHHHHHHhhcC-CCCCCHHHHHHHHHHHhhccccchHHHHHHHHHHHhh
Q psy16032        107 ELARMIATLFLSNLIKQYRV---------TYESAFLQEAKSN-PEIYTSKQLYHLLGDLFGASLDTSTILMRWFLLVMAM  176 (243)
Q Consensus       107 ~~~~~~~~~~~~~~~~~~~~---------~~~~~ll~~~~~~-~~~~~~~~~~~~~~~l~~ag~~tt~~~l~~~l~~l~~  176 (243)
                      ..+++...+++.+.+++++.         |+++.++....+. ...++++++.+++..+++||+|||+.+++|+++.|+.
T Consensus       191 ~~~~~~l~~~~~~~i~~~~~~~~~~~~~~dll~~ll~~~~~~~~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~  270 (445)
T d2ciba1         191 DEARNGLVALVADIMNGRIANPPTDKSDRDMLDVLIAVKAETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMR  270 (445)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCC-----CCCHHHHHHHCBCTTSSBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhhhcccccccccccchhhhhhccccccccccCCcchhhhhhhhhhhhccccchhhcccccccccc
Confidence            34445555566555554432         5888888765433 3358999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHhhcCCCC-CChhhhcCChhHHHHHHHHhccCCCccCCccccc-----ccCCCCCCcccc
Q psy16032        177 EQDVQDTLRAEITSKSSGTI-VTLDDITSMSYLAACINETHRYRTIVTLGTPDQV-----YLSSGLPDSERL  242 (243)
Q Consensus       177 ~p~~~~~l~~Ei~~~~~~~~-~~~~~~~~l~yl~~~i~E~lR~~p~~~~~~~r~~-----~~~~~ipg~~~~  242 (243)
                      ||++|+|+++|++++.+++. ++++++.+||||++||+|++|++|+++... |.+     ..|+.||.|+.+
T Consensus       271 ~p~~~~~lr~Ei~~~~~~~~~~~~~~l~~lp~L~a~i~E~lRl~p~~~~~~-~~~~~~~~~~~~~ip~g~~v  341 (445)
T d2ciba1         271 HRDAYAAVIDELDELYGDGRSVSFHALRQIPQLENVLKETLRLHPPLIILM-RVAKGEFEVQGHRIHEGDLV  341 (445)
T ss_dssp             CHHHHHHHHHHHHHHGGGCCCHHHHTTSCCHHHHHHHHHHHHHSCSCCCEE-EEECSCEEETTEEECTTCEE
T ss_pred             cccccccccccccccccccccchhhhcccchhhccccccccccccccceec-cccccccccceeeccccccc
Confidence            99999999999999998777 899999999999999999999999998754 443     477888888754



>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure