Psyllid ID: psy16067

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------
IVETLRQKADADKNDKAVKDLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPERLIAAVPIRQTCQHEDNRVYERQANPEREPEVRGYGTRYRQSSYSSSYGYNRNSRESREYGRTETSGSRETYGRPDPSSGRPDQASGLCKPRINKFKAQPEADQNIADQCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVYHAPKEKHRFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEEKKEEEKEEDKTPKLEDEAQLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNSLMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEVSH
cHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHccHHHHccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHccccccccEEEcccccccccccccccccHHHHHHHHHccccccEEEEccccccccccccccHHHHHHHccHHcccHHHHHHHcccccccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEccccccccccEEEEEEEccccHHcccHHHHHHHHHHccccccccEEEEEEEEEEcccccHHHHHHHHHHcccccccccccHHHHccccccccccccccccccccHHHHHHHHcccccccccHHHHcHHcccccccccccccccccccEEcccccccEEEccccccccHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEEEEccEEcccccHHHHcccccccccEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHEEEEEEEEEEcccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHEEEEEEEEEEEccccHHHccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHHcHHHHHHHHHHHHccccccccEEEccccccccccccccccEEHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEccccccEEEEEEccccccHHHHHHccccccccHHHHHHHHHHccccccccccccccccEEEEEccEEEEEEccccccEEEEEEcccccEEEEccccccccccEEEEEEEcccccccccHHHHHHHHHcccccccccEEEEEEEEEcccccccHHHccc
ccHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccccccccEEcEcccccccccccccccccccccccccccccccHHEEccccccHHHHHHHHcHHHHccccccccHHHHHHHHHHHcccccHHcHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHccHHHHHHHHHHHcccccccEEEccccccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHcccccccEEEcccccEEEcccccccccEEEEEEcccccEEEEEEccccEEEEEEccccccccEEEEEEEEccccHHHHcHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHHHcccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccHHccHHHcccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHccccccEcccccccccccccccccccccccccccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcccccccHHccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHcccccccccccccccHHHHHHHcccHHHHcccccccHHccccccccccccccHHHHHcccHHHHcccccccHHHHHHccccccccHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHcccHHHHHHHHHHHcccccccEEEccccccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHcHHHHHHccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccEEEEccccEEEEEEccccccHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHccHHHHHHHcEEEEEEEEEcccccEEEEEEccccEEEEEEccccccccEEEEEEEEccccHHHHcHHHHHHHHHHHcccccccEEEcccccccccccccHHcccc
IVETLRQKADADKNDKAVKDLVNLLFETsllssgftledpqveltlsgrpdrsperliaavpirqtcqhednrvyerqanperepevrgygtryrqssysssygynrnsresreygrtetsgsretygrpdpssgrpdqasglckprinkfkaqpeadqNIADqcfasqapqcnrrtkyrtldgtcnnlrrpwwgavdTAHVRLmrpyyedgvssyrvsqvdasplpnarvlsrvflpdrnisdVHTRMYLEFSQLVAhditlnpqestavptrglrgefgddlaardiqrgrdyglrpyvdyrelcglstvrsfgdlndfmdseqvTRLSQVYRGVNDIDYYIGGLLESVirgtlsspsfRCVFAEAFYRykygdryfyegppatnpgaftpgkqltltsLTSLASWRLQkvyhapkekhrfswlttvrggpmtvtskhnddeqyiwessaggsftikpdnseplgrgtKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEEKKEEekeedktpkledEAQLDAIKKVFLSQIICIGSDRIVKMQlqsfympserqfnvtlsdnlHLDLLCVslgpkccsdsgdrvrstsgncrpilipsnddfYSQFNRRCLEYKRSLAincsvgalqpdkicpgresnprpsaykADVLATKLIRLknffftdvetctfQIVQSTHFidvsfmygshpdkARELRSLSRgklrvrevngrtfmptgdpsncvnassnicydagdirVNQQLDLAVSQTVWLRFHNYVAEKLIqqnpswsnrdELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIqqnpswsnrdELVYQEARRLVIGCFQHivynewlpiligesytkdvglsptssgyfqgydpevnpstladfaagafrgesytkdvglsptssgyfqgydpevnpstlaDFAAGAFrglhslipgtiKLVNErrvtnqelpfsstmqhpgdiLEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVirgtlsspsfRCVFAEAFYRykygdryfyegppatnpgaftpgkqltltslTSLASLCIFSCFQaldkirpsnhpgpnslmdqpcrggaapgpgdgdVVANVNnnnnnnnnnnitNVYFflfpgfgqdpiipnkeektltiidsgigmtKADLVNNLGTIAKSGTKAFMEALQAgadismigqfgvGFYSAYLVADKVTvtskhnddeqyiwessaggsftikpdnseplgrgtKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKelsedeeevsh
ivetlrqkadadkndkaVKDLVNLLFETsllssgftledPQVELtlsgrpdrsperliaavpirqtcqhednrvyerqanperepevrgygtryrqssysssygynrnsresreygrtetsgsretygrpdpssgrpdqasgLCKPRINKFKAQPEADQNIADQCfasqapqcnrrtkyrtldgtcnnlrrpwwgavDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDitlnpqestavptrglrgefgddlaardiqrgrdyglrpyvDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVyhapkekhrfswlttvrggPMTVTSKHNDDEQYIWESSAggsftikpdnseplGRGTKIVLHMKEDQAEYIEEKKIKEIVKkhsqfigypikllvekerekelsedeeeekkeeekeedktpkledeaqLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDsgdrvrstsgncrpilipsnddFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPdkarelrslsrgklrvrevngrtfmptgdpsncvNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKliqqnpswsnRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKliqqnpswsnRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELpfsstmqhpgdILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNSLMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWEssaggsftikpdnseplGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKERekelsedeeevsh
IVETLRQkadadkndkavkdLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPERLIAAVPIRQTCQHEDNRVYERQANPEREPEVrgygtryrqssysssygynrnsresrEYGRTETSGSRETYGRPDPSSGRPDQASGLCKPRINKFKAQPEADQNIADQCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQltltsltslasWRLQKVYHAPKEKHRFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYieekkikeivkkHSQFIGYPIkllvekerekelsedeeeekkeeekeedktpkledeAQLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQltltsltslaslCIFSCFQALDKIRPSNHPGPNSLMDQPCRggaapgpgdgdvvanvnnnnnnnnnnnitnvYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYieekkikeivkkHSQFIGYPIkllvekerekelsedeeeVSH
*****************VKDLVNLLFETSLLSSGFTL*********************AAV*I****************************************************************************************************QCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNP*****VPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVYHAPKEKHRFSWLTTVRGGPMTV********QYIWE*********************KIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLV**********************************LDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKIC***********YKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGS*********************************NCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLS*TSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDK**********************************************TNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWES*******************TKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLV*****************
IVETL*Q*********AVKDLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPE*******************************************************************************************RINKFK*************F**********TKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYE*******************RVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPG*FTPGKQLTLTSLTSLASWRLQKV********RFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKE************************KLEDEAQLDAIKKVFLSQIIC****RIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPD**************VREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPT*SG********VNPSTLADFAAGAFRGLHSLIPGTIK************PFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPA*****FTPGKQLTLTSLTSLASLCIFSCFQALDKI**********LMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVE****************
***********DKNDKAVKDLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPERLIAAVPIRQTCQHEDNRVYER***************************************************************SGLCKPRINKFKAQPEADQNIADQCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVYHAPKEKHRFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEK***************************EDEAQLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCC**********SGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNSLMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKE**************
IVETLRQKADADKNDKAVKDLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPERLIAAVPIRQTCQHEDNRVYERQANPE*EPEVRGYGTRYRQSSYSSSYGYNRNSRESREYGRTETSGSRETYGRPDPSSGRPDQASGLCKPRINKFKAQPEADQNIADQCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVYHAPKEKHRFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVE*************EKKEEEKEEDKTPKLEDEAQLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNSLMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEK***************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IVETLRQKADADKNDKAVKDLVNLLFETSLLSSGFTLEDPQVELTLSGRPDRSPERLIAAVPIRQTCQHEDNRVYERQANPEREPEVRGYGTRYRQSSYSSSYGYNRNSRESREYGRTETSGSRETYGRPDPSSGRPDQASGLCKPRINKFKAQPEADQNIADQCFASQAPQCNRRTKYRTLDGTCNNLRRPWWGAVDTAHVRLMRPYYEDGVSSYRVSQVDASPLPNARVLSRVFLPDRNISDVHTRMYLEFSQLVAHDITLNPQESTAVPTRGLRGEFGDDLAARDIQRGRDYGLRPYVDYRELCGLSTVRSFGDLNDFMDSEQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASWRLQKVYHAPKEKHRFSWLTTVRGGPMTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLxxxxxxxxxxxxxxxxxxxxxxxxxxxTPKLEDEAQLDAIKKVFLSQIICIGSDRIVKMQLQSFYMPSERQFNVTLSDNLHLDLLCVSLGPKCCSDSGDRVRSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNICYDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQELPFSSTMQHPGDILEVxxxxxxxxxxxxxxxxxxxxxFITEQTIDFLFRVGSLSLEKVIVDLVGLTLGFFYLWYCGGFLLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNSLMDQPCRGGAAPGPGDGDVVANVNNNNNNNNNNNITNVYFFLFPGFGQDPIIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEVSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1386 2.2.26 [Sep-21-2011]
P02828 717 Heat shock protein 83 OS= yes N/A 0.111 0.216 0.870 1e-74
P04810 375 Heat shock protein 83 (Fr N/A N/A 0.111 0.413 0.870 3e-74
Q7PT10 720 Heat shock protein 83 OS= yes N/A 0.109 0.211 0.881 4e-74
O02192 716 Heat shock protein 83 OS= N/A N/A 0.109 0.212 0.881 2e-73
P82995 733 Heat shock protein HSP 90 yes N/A 0.111 0.211 0.812 5e-73
P04809 717 Heat shock protein 83 OS= yes N/A 0.109 0.211 0.868 7e-73
P30946 694 Heat shock protein HSP 90 yes N/A 0.106 0.213 0.819 8e-73
P04811 374 Heat shock protein 83 (Fr N/A N/A 0.109 0.406 0.875 2e-72
P07901 733 Heat shock protein HSP 90 yes N/A 0.111 0.211 0.806 2e-72
O16087269 Heat shock protein 83 (Fr N/A N/A 0.106 0.550 0.861 8e-72
>sp|P02828|HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1 Back     alignment and function desciption
 Score =  282 bits (722), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 148/155 (95%)

Query: 1227 IIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 1286
            +IPNK   TLTIID+GIGMTK+DLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY
Sbjct: 68   LIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 127

Query: 1287 SAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIE 1346
            SAYLVADKVTVTSK+NDDEQY+WESSAGGSFT++ DNSEPLGRGTKIVL++KEDQ +Y+E
Sbjct: 128  SAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLE 187

Query: 1347 EKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDE 1381
            E KIKEIV KHSQFIGYPIKLLVEKEREKE+S+DE
Sbjct: 188  ESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDE 222
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Drosophila melanogaster (taxid: 7227)
>sp|P04810|HSP83_DROSI Heat shock protein 83 (Fragment) OS=Drosophila simulans GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3 Back     alignment and function description
>sp|O02192|HSP83_DROAV Heat shock protein 83 OS=Drosophila auraria GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3 Back     alignment and function description
>sp|P04809|HSP83_DROPS Heat shock protein 83 OS=Drosophila pseudoobscura pseudoobscura GN=Hsp83 PE=3 SV=2 Back     alignment and function description
>sp|P30946|HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus GN=HSP90AA1 PE=1 SV=2 Back     alignment and function description
>sp|P04811|HSP83_DROVI Heat shock protein 83 (Fragment) OS=Drosophila virilis GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4 Back     alignment and function description
>sp|O16087|HSP83_DROMI Heat shock protein 83 (Fragment) OS=Drosophila miranda GN=Hsp83 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1386
301137080723 heat shock protein 90 [Gryllus firmus] 0.111 0.213 0.902 3e-76
190402564725 HSP90 [Macrocentrus cingulum] gi|1937951 0.109 0.209 0.907 3e-75
226446417253 heat shock protein 90 [Apis mellifera] 0.106 0.584 0.865 4e-75
292606981730 heat shock protein 90 [Nilaparvata lugen 0.103 0.197 0.883 8e-75
157419936723 heat shock protein 90 [Microplitis media 0.113 0.217 0.885 8e-75
195431710716 GK15907 [Drosophila willistoni] gi|19415 0.111 0.215 0.885 2e-74
332373064709 unknown [Dendroctonus ponderosae] 0.109 0.214 0.901 1e-73
399894429727 heat shock protein 90 [Paratlanticus uss 0.109 0.209 0.888 2e-73
117499964716 heat shock protein 83 [Drosophila buzzat 0.109 0.212 0.883 2e-73
37963515330 heat shock protein 83 [Drosophila sturte 0.111 0.469 0.890 2e-73
>gi|301137080|gb|ADK64952.1| heat shock protein 90 [Gryllus firmus] Back     alignment and taxonomy information
 Score =  294 bits (752), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 152/154 (98%)

Query: 1227 IIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 1286
            I+PNK ++TLTIID+GIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY
Sbjct: 70   IVPNKNDRTLTIIDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 129

Query: 1287 SAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIE 1346
            SAYLVADKVTVTSKHNDDEQY+WESSAGGSFTI+PD+SEPLGRGTKIVLH+KEDQ E++E
Sbjct: 130  SAYLVADKVTVTSKHNDDEQYLWESSAGGSFTIRPDHSEPLGRGTKIVLHIKEDQTEFLE 189

Query: 1347 EKKIKEIVKKHSQFIGYPIKLLVEKEREKELSED 1380
            E+KIKEIVKKHSQFIGYPIKLLVEKER+KELS+D
Sbjct: 190  ERKIKEIVKKHSQFIGYPIKLLVEKERDKELSDD 223

Source: Gryllus firmus

Species: Gryllus firmus

Genus: Gryllus

Family: Gryllidae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|190402564|gb|ACE77780.1| HSP90 [Macrocentrus cingulum] gi|193795158|gb|ACE77781.2| heat shock protein 90 [Macrocentrus cingulum] Back     alignment and taxonomy information
>gi|226446417|gb|ACO58574.1| heat shock protein 90 [Apis mellifera] Back     alignment and taxonomy information
>gi|292606981|gb|ADE34169.1| heat shock protein 90 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|157419936|gb|ABV55506.1| heat shock protein 90 [Microplitis mediator] Back     alignment and taxonomy information
>gi|195431710|ref|XP_002063871.1| GK15907 [Drosophila willistoni] gi|194159956|gb|EDW74857.1| GK15907 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|332373064|gb|AEE61673.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|399894429|gb|AFP54306.1| heat shock protein 90 [Paratlanticus ussuriensis] Back     alignment and taxonomy information
>gi|117499964|gb|ABK34943.1| heat shock protein 83 [Drosophila buzzatii] Back     alignment and taxonomy information
>gi|37963515|gb|AAR05881.1| heat shock protein 83 [Drosophila sturtevanti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1386
ZFIN|ZDB-GENE-031001-3 734 hsp90aa1.2 "heat shock protein 0.100 0.189 0.805 4.5e-58
UNIPROTKB|F1NKM6220 F1NKM6 "Uncharacterized protei 0.100 0.631 0.784 9.8e-58
UNIPROTKB|F1NKM8217 F1NKM8 "Uncharacterized protei 0.100 0.640 0.784 9.8e-58
UNIPROTKB|F1NVN4 583 F1NVN4 "Uncharacterized protei 0.100 0.238 0.784 9.8e-58
FB|FBgn0001233 717 Hsp83 "Heat shock protein 83" 0.100 0.193 0.805 3.3e-57
UNIPROTKB|Q76LV2 733 HSP90AA1 "Heat shock protein H 0.100 0.189 0.762 4.3e-57
UNIPROTKB|P07900 732 HSP90AA1 "Heat shock protein H 0.100 0.189 0.762 4.3e-57
UNIPROTKB|O02705 733 HSP90AA1 "Heat shock protein H 0.100 0.189 0.762 4.3e-57
UNIPROTKB|Q9GKX7 733 HSP90AA1 "Heat shock protein H 0.100 0.189 0.762 4.3e-57
RGD|631409 733 Hsp90aa1 "heat shock protein 9 0.100 0.189 0.762 4.3e-57
ZFIN|ZDB-GENE-031001-3 hsp90aa1.2 "heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 586 (211.3 bits), Expect = 4.5e-58, Sum P(2) = 4.5e-58
 Identities = 112/139 (80%), Positives = 122/139 (87%)

Query:  1227 IIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 1286
             IIPNKEE+TLTIID+GIGMTKADL+NNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY
Sbjct:    78 IIPNKEERTLTIIDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 137

Query:  1287 SAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYXX 1346
             SAYLVA+KVTV +KH DDEQY WESSAGGSFT+K DNSEP+GRGTK++LH+KEDQ EY  
Sbjct:   138 SAYLVAEKVTVITKHLDDEQYAWESSAGGSFTVKVDNSEPIGRGTKVILHLKEDQTEYIE 197

Query:  1347 XXXXXXXXXXHSQFIGYPI 1365
                       HSQFIGYPI
Sbjct:   198 ERRIKEIVKKHSQFIGYPI 216
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0006950 "response to stress" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1NKM6 F1NKM6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKM8 F1NKM8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVN4 F1NVN4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0001233 Hsp83 "Heat shock protein 83" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q76LV2 HSP90AA1 "Heat shock protein HSP 90-alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P07900 HSP90AA1 "Heat shock protein HSP 90-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O02705 HSP90AA1 "Heat shock protein HSP 90-alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GKX7 HSP90AA1 "Heat shock protein HSP 90-alpha" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
RGD|631409 Hsp90aa1 "heat shock protein 90, alpha (cytosolic), class A member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.11.1.7LOW CONFIDENCE prediction!
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1386
cd09823378 cd09823, peroxinectin_like, peroxinectin_like anim 2e-81
PTZ00272 701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 3e-70
pfam03098521 pfam03098, An_peroxidase, Animal haem peroxidase 5e-64
PRK05218 613 PRK05218, PRK05218, heat shock protein 90; Provisi 5e-63
COG0326 623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 6e-62
pfam03098521 pfam03098, An_peroxidase, Animal haem peroxidase 6e-47
PTZ00130 814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 2e-46
cd05396370 cd05396, An_peroxidase_like, Animal heme peroxidas 1e-43
cd09823378 cd09823, peroxinectin_like, peroxinectin_like anim 7e-42
cd09826440 cd09826, peroxidasin_like, Animal heme peroxidase 1e-41
cd09822420 cd09822, peroxinectin_like_bacterial, Uncharacteri 1e-37
pfam03098521 pfam03098, An_peroxidase, Animal haem peroxidase 4e-35
cd09825565 cd09825, thyroid_peroxidase, Thyroid peroxidase (T 2e-34
PTZ00272701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 2e-33
cd09822420 cd09822, peroxinectin_like_bacterial, Uncharacteri 1e-29
cd09824411 cd09824, myeloperoxidase_like, Myeloperoxidases, e 1e-28
cd09826440 cd09826, peroxidasin_like, Animal heme peroxidase 1e-27
cd09820558 cd09820, dual_peroxidase_like, Dual oxidase and re 1e-25
cd09820558 cd09820, dual_peroxidase_like, Dual oxidase and re 3e-23
COG0326623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 9e-23
pfam03098521 pfam03098, An_peroxidase, Animal haem peroxidase 3e-22
cd05396370 cd05396, An_peroxidase_like, Animal heme peroxidas 5e-22
cd09822420 cd09822, peroxinectin_like_bacterial, Uncharacteri 3e-21
PRK05218613 PRK05218, PRK05218, heat shock protein 90; Provisi 1e-20
pfam00183529 pfam00183, HSP90, Hsp90 protein 1e-20
cd09825565 cd09825, thyroid_peroxidase, Thyroid peroxidase (T 3e-18
PRK14083 601 PRK14083, PRK14083, HSP90 family protein; Provisio 4e-18
PTZ00130814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 1e-15
cd09824411 cd09824, myeloperoxidase_like, Myeloperoxidases, e 1e-15
pfam00183 529 pfam00183, HSP90, Hsp90 protein 6e-15
cd09820558 cd09820, dual_peroxidase_like, Dual oxidase and re 1e-14
pfam00183529 pfam00183, HSP90, Hsp90 protein 4e-13
cd09816490 cd09816, prostaglandin_endoperoxide_synthase, Anim 4e-12
cd09818484 cd09818, PIOX_like, Animal heme oxidases similar t 2e-10
PTZ00272701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 6e-10
cd09821570 cd09821, An_peroxidase_bacterial_2, Uncharacterize 6e-09
cd09819465 cd09819, An_peroxidase_bacterial_1, Uncharacterize 2e-08
cd09818484 cd09818, PIOX_like, Animal heme oxidases similar t 3e-08
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 4e-08
cd09820558 cd09820, dual_peroxidase_like, Dual oxidase and re 7e-08
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 1e-06
cd09816490 cd09816, prostaglandin_endoperoxide_synthase, Anim 3e-06
cd09819465 cd09819, An_peroxidase_bacterial_1, Uncharacterize 4e-06
cd09816490 cd09816, prostaglandin_endoperoxide_synthase, Anim 5e-06
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 2e-05
cd09821570 cd09821, An_peroxidase_bacterial_2, Uncharacterize 0.001
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 0.001
PRK14083601 PRK14083, PRK14083, HSP90 family protein; Provisio 0.002
pfam0870180 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase 0.002
>gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases Back     alignment and domain information 
 Score =  272 bits (698), Expect = 2e-81
 Identities = 142/485 (29%), Positives = 198/485 (40%), Gaps = 136/485 (28%)

Query: 693  QIVQSTHFIDVSFMYGSHPDKARELRSLSRGKLRVREVNGRTFMPTGDPSNCVNASSNIC 752
            Q+ Q T F+D S +YGS  ++AR+L               RTF                 
Sbjct: 3    QLNQVTSFLDGSQVYGSSEEEARKL---------------RTF----------------- 30

Query: 753  YDAGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQH 812
               G ++  +      +    L F N   +       S                  CF  
Sbjct: 31   -KGGLLKTQR-----RNGRELLPFSNNPTDD--CSLSSAGKP--------------CF-- 66

Query: 813  IVYNEWLPILIGDIRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARR 872
                     L GD RVN+Q  L    T++LR HN +A++L + NP W   DE ++QEAR+
Sbjct: 67   ---------LAGDGRVNEQPGLTSMHTLFLREHNRIADELKKLNPHWD--DERLFQEARK 115

Query: 873  LVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGE 932
            +VI   QHI YNE+LPIL+G    +  GL   +SGYF GYDP V+PS L +FAA AFR  
Sbjct: 116  IVIAQMQHITYNEFLPILLGRELMEKFGLYLLTSGYFNGYDPNVDPSILNEFAAAAFR-- 173

Query: 933  SYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQEL 992
                          +                        HSL+PGT + ++E       +
Sbjct: 174  --------------FG-----------------------HSLVPGTFERLDENYRPQGSV 196

Query: 993  PFSSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQDRFITEQTIDFLFRVGSLSLEKVIVD 1052
                   +P  + E     D  LRGL  Q  Q  DRF T++     F  G        +D
Sbjct: 197  NLHDLFFNPDRLYEE-GGLDPLLRGLATQPAQKVDRFFTDELTTHFFFRGGNPFG---LD 252

Query: 1053 LVGLTL------GFF----YLWYCGG-----FLLQ--------VTRLSQVYRGVNDIDYY 1089
            L  L +      G      Y  +CG      F           + +L ++Y+ V+DID Y
Sbjct: 253  LAALNIQRGRDHGLPGYNDYREFCGLPRATTFDDLLGIMSPETIQKLRRLYKSVDDIDLY 312

Query: 1090 IGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPPATNPGAFTPGKQLTLTSLT 1149
            +GGL E  + G L  P+F C+  E F R + GDR++YE      P +FTP  QL      
Sbjct: 313  VGGLSEKPVPGGLVGPTFACIIGEQFRRLRRGDRFWYENGGQ--PSSFTP-AQLNEIRKV 369

Query: 1150 SLASL 1154
            SLA +
Sbjct: 370  SLARI 374

Peroxinectin is an arthropod protein that plays a role in invertebrate immunity mechanisms. Specifically, peroxinectins are secreted as cell-adhesive and opsonic peroxidases. The immunity mechanism appears to involve an interaction between peroxinectin and a transmembrane receptor of the integrin family. Human myeloperoxidase, which is included in this wider family, has also been reported to interact with integrins. Length = 378
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins Back     alignment and domain information
>gnl|CDD|188655 cd09823, peroxinectin_like, peroxinectin_like animal heme peroxidases Back     alignment and domain information
>gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins Back     alignment and domain information
>gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial Back     alignment and domain information
>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) Back     alignment and domain information
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial Back     alignment and domain information
>gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases Back     alignment and domain information
>gnl|CDD|188658 cd09826, peroxidasin_like, Animal heme peroxidase domain of peroxidasin and related proteins Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|217366 pfam03098, An_peroxidase, Animal haem peroxidase Back     alignment and domain information
>gnl|CDD|188647 cd05396, An_peroxidase_like, Animal heme peroxidases and related proteins Back     alignment and domain information
>gnl|CDD|188654 cd09822, peroxinectin_like_bacterial, Uncharacterized family of heme peroxidases, mostly bacterial Back     alignment and domain information
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|188657 cd09825, thyroid_peroxidase, Thyroid peroxidase (TPO) Back     alignment and domain information
>gnl|CDD|237603 PRK14083, PRK14083, HSP90 family protein; Provisional Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|188656 cd09824, myeloperoxidase_like, Myeloperoxidases, eosinophil peroxidases, and lactoperoxidases Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|188648 cd09816, prostaglandin_endoperoxide_synthase, Animal prostaglandin endoperoxide synthase and related bacterial proteins Back     alignment and domain information
>gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases Back     alignment and domain information
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>gnl|CDD|188653 cd09821, An_peroxidase_bacterial_2, Uncharacterized bacterial family of heme peroxidases Back     alignment and domain information
>gnl|CDD|188651 cd09819, An_peroxidase_bacterial_1, Uncharacterized bacterial family of heme peroxidases Back     alignment and domain information
>gnl|CDD|188650 cd09818, PIOX_like, Animal heme oxidases similar to plant pathogen-inducible oxygenases Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|188652 cd09820, dual_peroxidase_like, Dual oxidase and related animal heme peroxidases Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|188648 cd09816, prostaglandin_endoperoxide_synthase, Animal prostaglandin endoperoxide synthase and related bacterial proteins Back     alignment and domain information
>gnl|CDD|188651 cd09819, An_peroxidase_bacterial_1, Uncharacterized bacterial family of heme peroxidases Back     alignment and domain information
>gnl|CDD|188648 cd09816, prostaglandin_endoperoxide_synthase, Animal prostaglandin endoperoxide synthase and related bacterial proteins Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|188653 cd09821, An_peroxidase_bacterial_2, Uncharacterized bacterial family of heme peroxidases Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|237603 PRK14083, PRK14083, HSP90 family protein; Provisional Back     alignment and domain information
>gnl|CDD|219978 pfam08701, GN3L_Grn1, GNL3L/Grn1 putative GTPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1386
KOG2408|consensus719 100.0
PF03098530 An_peroxidase: Animal haem peroxidase; InterPro: I 100.0
PLN02283633 alpha-dioxygenase 100.0
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 100.0
KOG0020|consensus 785 100.0
KOG0019|consensus 656 100.0
PTZ00130 814 heat shock protein 90; Provisional 100.0
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 100.0
KOG2408|consensus719 100.0
PLN02283633 alpha-dioxygenase 99.97
PF03098530 An_peroxidase: Animal haem peroxidase; InterPro: I 99.97
PRK14083 601 HSP90 family protein; Provisional 99.96
PRK05218 613 heat shock protein 90; Provisional 99.95
KOG0020|consensus785 98.81
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 98.7
TIGR00585 312 mutl DNA mismatch repair protein MutL. All protein 98.63
KOG0019|consensus656 98.21
PF00183531 HSP90: Hsp90 protein; InterPro: IPR001404 Molecula 97.75
PRK04184 535 DNA topoisomerase VI subunit B; Validated 97.65
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 97.6
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 97.46
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 97.28
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 97.23
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 97.01
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 96.9
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 96.59
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 96.49
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 96.28
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 96.27
PRK05644 638 gyrB DNA gyrase subunit B; Validated 96.01
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 95.95
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 95.94
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 95.88
PTZ00130814 heat shock protein 90; Provisional 95.85
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 92.5
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 92.44
PTZ00109 903 DNA gyrase subunit b; Provisional 89.92
KOG1979|consensus 694 89.51
PLN03237 1465 DNA topoisomerase 2; Provisional 88.35
KOG1978|consensus 672 87.04
PRK10755356 sensor protein BasS/PmrB; Provisional 86.87
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 86.6
PLN03128 1135 DNA topoisomerase 2; Provisional 86.59
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 85.09
PRK10549466 signal transduction histidine-protein kinase BaeS; 84.87
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 84.17
PRK15347 921 two component system sensor kinase SsrA; Provision 83.27
PRK10604433 sensor protein RstB; Provisional 83.0
PRK11100475 sensory histidine kinase CreC; Provisional 80.72
>KOG2408|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-106  Score=998.60  Aligned_cols=422  Identities=37%  Similarity=0.584  Sum_probs=354.3

Q ss_pred             CCCCCCCccccCCCCCCccccCCccccccccccccccCCCCCCCCCCCCCCCCCCCCCchhhhHHHHHHhhcccccccCc
Q psy16067        608 RSTSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDV  687 (1386)
Q Consensus       608 ~~~~p~C~pI~vp~~Dp~~~~~~~~Cm~f~RS~~~~c~~G~~~~~~~~~~~~~~pr~~~~~~~~~~~~~~~~~~~~~~~~  687 (1386)
                      ...+|.|+||.||++||+|...+ +||+|+||+++ |..|+       .                               
T Consensus       256 ~~~~p~C~pi~~p~~dp~~~~~~-~C~~f~Rs~~~-~~~~~-------~-------------------------------  295 (719)
T KOG2408|consen  256 QLPSPPCFPIKIPPNDPYFPSNQ-RCLPFVRSLPA-CGSGY-------N-------------------------------  295 (719)
T ss_pred             cCCCCcccceecCCCCCccCCcc-cceeceecCCC-ccccc-------c-------------------------------
Confidence            45889999999999999998766 99999999997 44321       0                               


Q ss_pred             cccccccccccCcccCCcCCCCCHHhhHhhhcCCC--Cceeeec---cCCccCCCCCCC--CCCCCCC---CccccccCC
Q psy16067        688 ETCTFQIVQSTHFIDVSFMYGSHPDKARELRSLSR--GKLRVRE---VNGRTFMPTGDP--SNCVNAS---SNICYDAGD  757 (1386)
Q Consensus       688 ~~~reQiNq~TsfLD~S~VYGSs~~~a~~LRsf~~--G~Lk~~~---~~g~~llP~~~~--~~C~~~~---~~~Cf~aGD  757 (1386)
                      -..|+|+||+|||||+|+||||+++++++||.|++  |+|+++.   .+++.++|...+  ..|....   ...||.|||
T Consensus       296 ~~~reQlNq~T~~lD~S~IYGss~~~~~~lR~f~~~~g~l~~~~~~~~~~~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD  375 (719)
T KOG2408|consen  296 LGPREQLNQLTSFLDASVIYGSSDEDARKLRLFKDGKGLLRVDTGLFENGRPLLPFSTDPPNSCRSKPPGAPKPCFTAGD  375 (719)
T ss_pred             CChhhhhccccccccchhccCCCHHHHHHHhcccCcccceeecccccccCcccCCCCCCCCccccccCCCCCCcccccCc
Confidence            01379999999999999999999999999999998  7888773   468889998643  4787654   368999999


Q ss_pred             ccccccchhhhHHHhHhhhchHHHHHHHhhCCCCCCchhHHHHHhHhhhhheeeeeeecccccccccccccccchhhhhh
Q psy16067        758 IRVNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVS  837 (1386)
Q Consensus       758 ~R~Ne~pgLtalhtlflReHNrIA~~L~~iNP~W~~~De~lfq~AR~i~ia~~q~I~~~e~LP~llGD~R~NEn~~L~al  837 (1386)
                      .|+|++|+|++|||+|+|||||||.+|+.+||||+                                             
T Consensus       376 ~R~~~~pgL~~~hti~lREHNRiA~~Lk~~np~W~---------------------------------------------  410 (719)
T KOG2408|consen  376 ERANEQPGLAALHTLFLREHNRIATELKALNPHWS---------------------------------------------  410 (719)
T ss_pred             cccccCcchHHHHHHHHHHHHHHHHHHHhhCCCCc---------------------------------------------
Confidence            99999999999999999999999999999999998                                             


Q ss_pred             hhHHHHHhHHHHHHHHhcCCCCCCchhHHHHHHHHHHHhhhhhhhhhchhhhhhccchhhhcCCCCCCCCCccCCCCCCC
Q psy16067        838 QTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVN  917 (1386)
Q Consensus       838 hTlflReHNriA~~L~~~Np~Ws~~DE~LFQEARrIViA~~QhItYnEfLP~LLG~~~~~~~gL~~~~~G~y~gYd~~vd  917 (1386)
                                               ||+|||||||||+|++|||||+||||.+||...      ... .|+|.||     
T Consensus       411 -------------------------dE~lfQeaRkI~~A~~q~Ity~e~LP~ilG~~~------~~~-~g~~~gY-----  453 (719)
T KOG2408|consen  411 -------------------------DERLFQEARKIVGAQVQHITYNEYLPKLLGAPL------KVS-LGGYRGY-----  453 (719)
T ss_pred             -------------------------HHHHHHHHHHHHHHHHhhhhHHhhhhhhcCccc------ccC-CccccCc-----
Confidence                                     899999999999999999999999999999211      111 2555555     


Q ss_pred             CcchhhhcccccccccccccCCCCCCCCCCccCCCCCCCCcchHHHHhhhhccccccCccceeecccccccCC---CCCc
Q psy16067        918 PSTLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVTNQ---ELPF  994 (1386)
Q Consensus       918 p~i~neFAtaAfR~hs~~~~~~l~~~~~~~~~~Yd~~vnpsi~~EFatAAfRfgHSlI~~~i~~~~~~~~~~~---~~~l  994 (1386)
                                                        +|++||+|++||++|||||||++|++.+.+++.++....   .+++
T Consensus       454 ----------------------------------~~~~dp~IsneFataAfRfgHsli~~~~~~l~~~~~~~~~~~~l~~  499 (719)
T KOG2408|consen  454 ----------------------------------DPNVDPTISNEFATAAFRFGHSLIPPFFQRLDENFQPIGEVVNLPL  499 (719)
T ss_pred             ----------------------------------CCCCChhhhhhhhHHHHhhhcccCchhhhhhcccCcccccccCchh
Confidence                                              555566677788899999999999999999999886443   5788


Q ss_pred             cccccCcccccccccchhhhhhhhhhhhhhhc-CCCCCHHHHhhccccCCCCccccccccccCcc----------hhhhH
Q psy16067        995 SSTMQHPGDILEVMDVFDSTLRGLTNQLQQYQ-DRFITEQTIDFLFRVGSLSLEKVIVDLVGLTL----------GFFYL 1063 (1386)
Q Consensus       995 ~~~~~~p~~il~~~~~~d~llrGl~~q~~~~~-D~~i~~~l~n~LF~~~~~~~~~~g~DL~~lni----------~n~~r 1063 (1386)
                      ++.|++|+.++ ..+++|+++|||+.++++.. |++++.+++++||......   ..+||++|||          ||.||
T Consensus       500 ~~~~~~~~~i~-~~ggid~llrGl~~~~~~~~~d~~~~~~i~~~lf~~~~~~---~~~DL~ainIQRgRDhGlp~Yn~yR  575 (719)
T KOG2408|consen  500 HDAFFNPWLIL-NEGGIDPLLRGLTTQPAKMPDDQLLNGEITERLFVKTDED---GELDLAALNIQRGRDHGLPPYNEYR  575 (719)
T ss_pred             hhhhcchhhhh-hccChhHHHHHHHhchhhcccchhcCHHHHHHHhhhcCcc---cccchhhhhhhccccCCCCCHHHHH
Confidence            89999998655 46799999999999999999 9999999999999854321   1278888877          78999


Q ss_pred             HhhCCC-------------HHHHHHHHHhcCCCCccccceeeecccccCCCCcchHHHHHHHHHHHHhhcCCcccccCCC
Q psy16067       1064 WYCGGF-------------LLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPP 1130 (1386)
Q Consensus      1064 ~~cgL~-------------~~~i~~L~~lY~~vdDIDL~vGgLaE~p~~G~~vGPTf~CII~~QF~rLr~GDRFwYEn~~ 1130 (1386)
                      ++|||+             .+++++|+.+|++|||||||||+|+|+|++|++|||||+|||++||+|+|+||||||||  
T Consensus       576 ~~cgL~~~~s~edL~~~i~~~~~~kl~~lY~~~ddiDL~vG~~~E~~~~g~~vGPTl~cii~~Qf~r~r~gDRf~yen--  653 (719)
T KOG2408|consen  576 KFCGLSPATSFEDLSDEIEPEIINKLRTLYGTPDDIDLYVGLLLEKPLPGGLVGPTLACIIAEQFLRLRDGDRFWYEN--  653 (719)
T ss_pred             HHcCCCCCCCHHHhhhhhhHHHHHHHHHhcCCchhhcccccccccccCCCceecccHHHHHHHHHHHHhccCceeecC--
Confidence            999996             13578999999999999999999999999999999999999999999999999999998  


Q ss_pred             CCCCCCcChhhHHHHHhhccccceecccCCcccccc-CCCCCCCCCCC-CCCCCCCCCCCCCCCCCcc
Q psy16067       1131 ATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKI-RPSNHPGPNSL-MDQPCRGGAAPGPGDGDVV 1196 (1386)
Q Consensus      1131 ~~~p~~FT~~qql~~irk~sla~l~~~~~sDaiDkI-Qps~f~~pn~l-~nv~C~~~~~~~~~~~~~~ 1196 (1386)
                       .+|+.||++ ||++|||+|||+|+|.+ ...+.++ +.++|..++.. .-++|.  .||.+++..|.
T Consensus       654 -~~~~~Ft~~-QL~ei~k~sLariiC~N-~~~~~~~~~~~~f~~~~~~~~~~~c~--~ip~~dl~~w~  716 (719)
T KOG2408|consen  654 -FNPGVFTPE-QLEEIRKVSLARIICDN-GTKITKVSRFDVFDFPDAPNDPVPCS--SIPGLDLNAWR  716 (719)
T ss_pred             -CCCCccCHH-HHHHHHHhhchheeecC-CcccccccccCCccccccCCCCCCcc--ccchhhhhhhh
Confidence             279999997 89999999999987653 2334444 55888754443 347894  59999998774

>PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>PLN02283 alpha-dioxygenase Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0020|consensus Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>KOG2408|consensus Back     alignment and domain information
>PLN02283 alpha-dioxygenase Back     alignment and domain information
>PF03098 An_peroxidase: Animal haem peroxidase; InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>KOG0020|consensus Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PF00183 HSP90: Hsp90 protein; InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell [] Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1386
2yjw_A209 Tricyclic Series Of Hsp90 Inhibitors Length = 209 8e-62
2qf6_A207 Hsp90 Complexed With A56322 Length = 207 8e-62
3tuh_A209 Crystal Structure Of The N-Terminal Domain Of An Hs 9e-62
2qfo_A207 Hsp90 Complexed With A143571 And A516383 Length = 2 9e-62
2k5b_A210 Human Cdc37-Hsp90 Docking Model Based On Nmr Length 1e-61
3k98_A232 Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-C 1e-61
3eko_A226 Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 1e-61
2xdu_A236 Structre Of Hsp90 With Small Molecule Inhibitor Bou 1e-61
2jjc_A218 Hsp90 Alpha Atpase Domain With Bound Small Molecule 1e-61
2ye7_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 2e-61
1osf_A215 Human Hsp90 In Complex With 17-desmethoxy-17-n,n- D 2e-61
2ye2_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 2e-61
3inw_A228 Hsp90 N-Terminal Domain With Pochoxime A Length = 2 2e-61
2xjg_A249 Structure Of Hsp90 With Small Molecule Inhibitor Bo 2e-61
4egh_A232 Hsp90-Alpha Atpase Domain In Complex With (4-Hydrox 2e-61
3b24_A229 Hsp90 Alpha N-Terminal Domain In Complex With An Am 2e-61
3bm9_A226 Discovery Of Benzisoxazoles As Potent Inhibitors Of 2e-61
1byq_A228 Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 22 2e-61
4eeh_A229 Hsp90 Alpha N-Terminal Domain In Complex With An In 2e-61
3ft5_A249 Structure Of Hsp90 Bound With A Novel Fragment Leng 2e-61
3r4m_A228 Optimization Of Potent, Selective, And Orally Bioav 3e-61
1yc1_A264 Crystal Structures Of Human Hsp90alpha Complexed Wi 3e-61
4awo_A230 Complex Of Hsp90 Atpase Domain With Tropane Derived 3e-61
3hhu_A224 Human Heat-Shock Protein 90 (Hsp90) In Complex With 3e-61
3k97_A251 Hsp90 N-Terminal Domain In Complex With 4-Chloro-6- 4e-61
2yi0_A229 Structural Characterization Of 5-Aryl-4-(5-Substitu 4e-61
1uyi_A236 Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-F 4e-61
3qdd_A237 Hsp90a N-Terminal Domain In Complex With Biib021 Le 4e-61
3d0b_A232 Crystal Structure Of Benzamide Tetrahydro-4h-Carbaz 4e-61
2ccs_A236 Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Py 4e-61
1uy6_A236 Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy- 5e-61
2fwy_A256 Structure Of Human Hsp90-Alpha Bound To The Potent 5e-61
2bsm_A235 Novel, Potent Small Molecule Inhibitors Of The Mole 6e-61
2yee_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 2e-60
2xjj_A249 Structre Of Hsp90 With Small Molecule Inhibitor Bou 2e-60
1uym_A220 Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimetho 4e-60
3nmq_A239 Hsp90b N-Terminal Domain In Complex With Ec44, A Py 1e-59
4gqt_A227 N-Terminal Domain Of C. Elegans Hsp90 Length = 227 5e-57
2xcm_A214 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 8e-54
2jki_A223 Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng 2e-53
3k60_A223 Crystal Structure Of N-Terminal Domain Of Plasmodiu 1e-52
3h80_A231 Crystal Structure Of The Amino-Terminal Domain Of H 1e-51
3opd_A231 Crystal Structure Of The N-Terminal Domain Of An Hs 2e-49
3o6o_A214 Crystal Structure Of The N-Terminal Domain Of An Hs 2e-49
2cgf_A225 A Radicicol Analogue Bound To The Atp Binding Site 9e-48
2cg9_A 677 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 1e-47
1us7_A214 Complex Of Hsp90 And P50 Length = 214 1e-47
2bre_A219 Structure Of A Hsp90 Inhibitor Bound To The N-Termi 1e-47
1bgq_A225 Radicicol Bound To The Atp Binding Site Of The N-Te 1e-47
2xx2_A214 Macrolactone Inhibitor Bound To Hsp90 N-Term Length 2e-47
1am1_A213 Atp Binding Site In The Hsp90 Molecular Chaperone L 2e-47
1ah8_A220 Structure Of The Orthorhombic Form Of The N-Termina 2e-47
2wep_A220 Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp 2e-47
1a4h_A230 Structure Of The N-Terminal Domain Of The Yeast Hsp 2e-47
2akp_A186 Hsp90 Delta24-n210 Mutant Length = 186 2e-47
1zw9_A240 Yeast Hsp82 In Complex With The Novel Hsp90 Inhibit 3e-47
2yge_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 1e-46
2ygf_A220 L89v, L93i And V136m Mutant Of N-term Hsp90 Complex 2e-46
3c0e_A240 Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 9 2e-46
2yga_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 5e-46
3peh_A281 Crystal Structure Of The N-Terminal Domain Of An Hs 6e-40
1u0y_A273 N-Domain Of Grp94, With The Charged Domain, In Comp 6e-32
1u2o_A236 Crystal Structure Of The N-Domain Of Grp94 Lacking 6e-32
1qy5_A269 Crystal Structure Of The N-Domain Of The Er Hsp90 C 6e-32
2o1u_A 666 Structure Of Full Length Grp94 With Amp-Pnp Bound L 3e-31
2o1w_A 506 Structure Of N-Terminal Plus Middle Domains (N+m) O 3e-31
2esa_A236 Grp94 N-Terminal Domain Bound To Geldanamycin: Effe 6e-31
3ied_A272 Crystal Structure Of N-Terminal Domain Of Plasmodiu 3e-30
2ior_A235 Crystal Structure Of The N-Terminal Domain Of Htpg, 3e-25
2iop_A 624 Crystal Structure Of Full-Length Htpg, The Escheric 4e-25
1y4s_A 559 Conformation Rearrangement Of Heat Shock Protein 90 5e-25
2ikc_A595 Crystal Structure Of Sheep Lactoperoxidase At 3.25 3e-17
3r5q_A595 Crystal Structure Of Sheep Lactoperoxidase In Compl 3e-17
2e9e_A595 Crystal Structure Of The Complex Of Goat Lactoperox 8e-17
2r5l_A595 Crystal Structure Of Lactoperoxidase At 2.4a Resolu 1e-16
1cxp_C466 Cryogenic Crystal Structure Of Human Myeloperoxidas 7e-16
1myp_C466 X-Ray Crystal Structure Of Canine Myeloperoxidase A 8e-16
3f9p_C467 Crystal Structure Of Myeloperoxidase From Human Leu 8e-16
2gj1_A583 Crystal Structure Of Bovine Lactoperoxidase At 2.3a 8e-15
2ips_A595 Crystal Structure Of A Ternary Complex Of Bovine La 9e-15
2pt3_A595 Crystal Structure Of Bovine Lactoperoxidase At 2.34 1e-14
2gjm_A583 Crystal Structure Of Buffalo Lactoperoxidase At 2.7 2e-14
3erh_A595 First Structural Evidence Of Substrate Specificity 2e-14
2o86_A595 Crystal Structure Of A Ternary Complex Of Buffalo L 4e-14
2z5z_A595 Crystal Structure Of The Complex Of Buffalo Lactope 5e-14
2oye_P600 Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To 5e-09
1cqe_A580 Prostaglandin H2 Synthase-1 Complex With Flurbiprof 5e-09
1pth_A576 The Structural Basis Of Aspirin Activity Inferred F 5e-09
1pge_A576 Prostaglandin H2 Synthase-1 Complexed With P-(2'-Io 5e-09
3n8w_B553 Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 H 6e-09
3n8y_B553 Structure Of Aspirin Acetylated Cyclooxygenase-1 In 6e-09
1diy_A553 Crystal Structure Of Arachidonic Acid Bound In The 6e-09
1ht5_A551 The 2.75 Angstrom Resolution Model Of Ovine Cox-1 C 7e-09
1ebv_A551 Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid 7e-09
3rr3_A560 Structure Of (R)-Flurbiprofen Bound To Mcox-2 Lengt 8e-09
1u67_A600 Crystal Structure Of Arachidonic Acid Bound To A Mu 8e-09
3krk_A591 X-Ray Crystal Structure Of Arachidonic Acid Bound I 8e-09
3hs5_A591 X-Ray Crystal Structure Of Arachidonic Acid Bound T 8e-09
3mdl_A587 X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol 9e-09
3tzi_A593 X-Ray Crystal Structure Of Arachidonic Acid Bound I 9e-09
3olt_A592 X-Ray Crystal Structure Of Arachidonic Acid Bound T 9e-09
3nt1_A587 High Resolution Structure Of Naproxen:cox-2 Complex 9e-09
1ddx_A552 Crystal Structure Of A Mixture Of Arachidonic Acid 9e-09
3qh0_A610 X-Ray Crystal Structure Of Palmitic Acid Bound To T 1e-08
1pxx_A604 Crystal Structure Of Diclofenac Bound To The Cycloo 1e-08
1prh_A554 The X-Ray Crystal Structure Of The Membrane Protein 7e-08
1cvu_A552 Crystal Structure Of Arachidonic Acid Bound To The 1e-07
3pgh_A587 Cyclooxygenase-2 (Prostaglandin Synthase-2) Complex 1e-07
1cxp_A104 Cryogenic Crystal Structure Of Human Myeloperoxidas 1e-06
3f9p_A114 Crystal Structure Of Myeloperoxidase From Human Leu 1e-06
1myp_A108 X-Ray Crystal Structure Of Canine Myeloperoxidase A 2e-06
3q6m_A448 Crystal Structure Of Human Mc-Hsp90 In C2221 Space 1e-04
>pdb|2YJW|A Chain A, Tricyclic Series Of Hsp90 Inhibitors Length = 209 Back     alignment and structure 
Iteration: 1

 Score =  236 bits (601), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 106/139 (76%), Positives = 121/139 (87%)
Query: 1227 IIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 1286
            +IPNK+++TLTI+D+GIGMTKADL+NNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY
Sbjct: 66   LIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 125
Query: 1287 SAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYXX 1346
            SAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D  EP+GRGTK++LH+KEDQ EY  
Sbjct: 126  SAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLE 185
Query: 1347 XXXXXXXXXXHSQFIGYPI 1365
                      HSQFIGYPI
Sbjct: 186  ERRIKEIVKKHSQFIGYPI 204
>pdb|2QF6|A Chain A, Hsp90 Complexed With A56322 Length = 207 Back     alignment and structure
>pdb|3TUH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 In The Presence Of An The Inhibitor Ganetespib Length = 209 Back     alignment and structure
>pdb|2QFO|A Chain A, Hsp90 Complexed With A143571 And A516383 Length = 207 Back     alignment and structure
>pdb|2K5B|A Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr Length = 210 Back     alignment and structure
>pdb|3K98|A Chain A, Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-Chloro-2, 4-Dihydroxybenzoyl)-N-Ethylisoindoline-1-Carboxamide Length = 232 Back     alignment and structure
>pdb|3EKO|A Chain A, Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 Molecular Chaperone Length = 226 Back     alignment and structure
>pdb|2XDU|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 236 Back     alignment and structure
>pdb|2JJC|A Chain A, Hsp90 Alpha Atpase Domain With Bound Small Molecule Fragment Length = 218 Back     alignment and structure
>pdb|2YE7|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|1OSF|A Chain A, Human Hsp90 In Complex With 17-desmethoxy-17-n,n- Dimethylaminoethylamino-geldanamycin Length = 215 Back     alignment and structure
>pdb|2YE2|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3INW|A Chain A, Hsp90 N-Terminal Domain With Pochoxime A Length = 228 Back     alignment and structure
>pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|4EGH|A Chain A, Hsp90-Alpha Atpase Domain In Complex With (4-Hydroxyphenyl)morpholin- 4-Yl Methanone Length = 232 Back     alignment and structure
>pdb|3B24|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Aminotriazine Fragment Molecule Length = 229 Back     alignment and structure
>pdb|3BM9|A Chain A, Discovery Of Benzisoxazoles As Potent Inhibitors Of Chaperone Hsp90 Length = 226 Back     alignment and structure
>pdb|1BYQ|A Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 228 Back     alignment and structure
>pdb|4EEH|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Inhibitor 3-(4- Hydroxy-Phenyl)-1h-Indazol-6-Ol Length = 229 Back     alignment and structure
>pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment Length = 249 Back     alignment and structure
>pdb|3R4M|A Chain A, Optimization Of Potent, Selective, And Orally Bioavailable Pyrrolodinopyrimidine-Containing Inhibitors Of Heat Shock Protein 90. Identification Of Development Candidate 2-Amino-4-{4-Chloro-2-[2-(4- Fluoro-1h-Pyrazol-1-Yl)ethoxy]-6-Methylphenyl}-N-(2,2- Difluoropropyl)-5,7-Dihydro-6h-Pyrrolo[3, 4-D]pyrimidine-6-Carboxamide Length = 228 Back     alignment and structure
>pdb|1YC1|A Chain A, Crystal Structures Of Human Hsp90alpha Complexed With Dihydroxyphenylpyrazoles Length = 264 Back     alignment and structure
>pdb|4AWO|A Chain A, Complex Of Hsp90 Atpase Domain With Tropane Derived Inhibitors Length = 230 Back     alignment and structure
>pdb|3HHU|A Chain A, Human Heat-Shock Protein 90 (Hsp90) In Complex With {4-[3- (2,4-Dihydroxy-5-Isopropyl-Phenyl)-5-Thioxo- 1,5-Dihydro- [1,2,4]triazol-4-Yl]-Benzyl}-Carbamic Acid Ethyl Ester {zk 2819} Length = 224 Back     alignment and structure
>pdb|3K97|A Chain A, Hsp90 N-Terminal Domain In Complex With 4-Chloro-6-{[(2r)-2- (2-Methylphenyl)pyrrolidin-1-Yl]carbonyl}benzene-1,3-Diol Length = 251 Back     alignment and structure
>pdb|2YI0|A Chain A, Structural Characterization Of 5-Aryl-4-(5-Substituted-2-4- Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Length = 229 Back     alignment and structure
>pdb|1UYI|A Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-Fluoro-9- Pent-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|3QDD|A Chain A, Hsp90a N-Terminal Domain In Complex With Biib021 Length = 237 Back     alignment and structure
>pdb|3D0B|A Chain A, Crystal Structure Of Benzamide Tetrahydro-4h-Carbazol-4-One Bound To Hsp90 Length = 232 Back     alignment and structure
>pdb|2CCS|A Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Pyrazol-3- Yl)-Benzene-1,2-Diol Length = 236 Back     alignment and structure
>pdb|1UY6|A Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 Length = 256 Back     alignment and structure
>pdb|2BSM|A Chain A, Novel, Potent Small Molecule Inhibitors Of The Molecular Chaperone Hsp90 Discovered Through Structure-Based Design Length = 235 Back     alignment and structure
>pdb|2YEE|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|2XJJ|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|1UYM|A Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine) Length = 220 Back     alignment and structure
>pdb|3NMQ|A Chain A, Hsp90b N-Terminal Domain In Complex With Ec44, A Pyrrolo-Pyrimidine Methoxypyridine Inhibitor Length = 239 Back     alignment and structure
>pdb|4GQT|A Chain A, N-Terminal Domain Of C. Elegans Hsp90 Length = 227 Back     alignment and structure
>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 214 Back     alignment and structure
>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 223 Back     alignment and structure
>pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf07_0029) Bound To Adp Length = 223 Back     alignment and structure
>pdb|3H80|A Chain A, Crystal Structure Of The Amino-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312:m1-K213 Length = 231 Back     alignment and structure
>pdb|3OPD|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of A Benzamide Derivative Length = 231 Back     alignment and structure
>pdb|3O6O|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of An The Inhibitor Biib021 Length = 214 Back     alignment and structure
>pdb|2CGF|A Chain A, A Radicicol Analogue Bound To The Atp Binding Site Of The N- Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 Back     alignment and structure
>pdb|1US7|A Chain A, Complex Of Hsp90 And P50 Length = 214 Back     alignment and structure
>pdb|2BRE|A Chain A, Structure Of A Hsp90 Inhibitor Bound To The N-Terminus Of Yeast Hsp90. Length = 219 Back     alignment and structure
>pdb|1BGQ|A Chain A, Radicicol Bound To The Atp Binding Site Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|2XX2|A Chain A, Macrolactone Inhibitor Bound To Hsp90 N-Term Length = 214 Back     alignment and structure
>pdb|1AM1|A Chain A, Atp Binding Site In The Hsp90 Molecular Chaperone Length = 213 Back     alignment and structure
>pdb|1AH8|A Chain A, Structure Of The Orthorhombic Form Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 220 Back     alignment and structure
>pdb|2WEP|A Chain A, Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp Length = 220 Back     alignment and structure
>pdb|1A4H|A Chain A, Structure Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone In Complex With Geldanamycin Length = 230 Back     alignment and structure
>pdb|2AKP|A Chain A, Hsp90 Delta24-n210 Mutant Length = 186 Back     alignment and structure
>pdb|1ZW9|A Chain A, Yeast Hsp82 In Complex With The Novel Hsp90 Inhibitor 8-(6-Bromo- Benzo[1, 3]dioxol-5-Ylsulfanyl)-9-(3-Isopropylamino-Propyl)- Adenine Length = 240 Back     alignment and structure
>pdb|2YGE|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|2YGF|A Chain A, L89v, L93i And V136m Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3C0E|A Chain A, Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 98-99 Ks- Aa Length = 240 Back     alignment and structure
>pdb|2YGA|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Plasmodium Falciparum, Pfl1070c In The Presence Of A Thienopyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex With The Novel Ligand N-Propyl Carboxyamido Adenosine Length = 273 Back     alignment and structure
>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca Length = 236 Back     alignment and structure
>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone Grp94 In Complex With The Specific Ligand Neca Length = 269 Back     alignment and structure
>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 Back     alignment and structure
>pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94 Length = 506 Back     alignment and structure
>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of Mutants 168- 169 Ks-Aa Length = 236 Back     alignment and structure
>pdb|3IED|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf14_0417) In Complex With Amppn Length = 272 Back     alignment and structure
>pdb|2IOR|A Chain A, Crystal Structure Of The N-Terminal Domain Of Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 235 Back     alignment and structure
>pdb|2IOP|A Chain A, Crystal Structure Of Full-Length Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 624 Back     alignment and structure
>pdb|1Y4S|A Chain A, Conformation Rearrangement Of Heat Shock Protein 90 Upon Adp Binding Length = 559 Back     alignment and structure
>pdb|2IKC|A Chain A, Crystal Structure Of Sheep Lactoperoxidase At 3.25 A Resolution Reveals The Binding Sites For Formate Length = 595 Back     alignment and structure
>pdb|3R5Q|A Chain A, Crystal Structure Of Sheep Lactoperoxidase In Complex With Tetrahydrofuran At 2.7 A Resolution Length = 595 Back     alignment and structure
>pdb|2E9E|A Chain A, Crystal Structure Of The Complex Of Goat Lactoperoxidase With Nitrate At 3.25 A Resolution Length = 595 Back     alignment and structure
>pdb|2R5L|A Chain A, Crystal Structure Of Lactoperoxidase At 2.4a Resolution Length = 595 Back     alignment and structure
>pdb|1CXP|C Chain C, Cryogenic Crystal Structure Of Human Myeloperoxidase Isoform C Length = 466 Back     alignment and structure
>pdb|1MYP|C Chain C, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3 Angstroms Resolution Length = 466 Back     alignment and structure
>pdb|3F9P|C Chain C, Crystal Structure Of Myeloperoxidase From Human Leukocytes Length = 467 Back     alignment and structure
>pdb|2GJ1|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.3a Resolution Length = 583 Back     alignment and structure
>pdb|2IPS|A Chain A, Crystal Structure Of A Ternary Complex Of Bovine Lactoperoxidase With Thiocyanate And Iodide At 3.1 A Resolution Length = 595 Back     alignment and structure
>pdb|2PT3|A Chain A, Crystal Structure Of Bovine Lactoperoxidase At 2.34 A Resolution Reveals Multiple Anion Binding Sites Length = 595 Back     alignment and structure
>pdb|2GJM|A Chain A, Crystal Structure Of Buffalo Lactoperoxidase At 2.75a Resolution Length = 583 Back     alignment and structure
>pdb|3ERH|A Chain A, First Structural Evidence Of Substrate Specificity In Mammalian Peroxidases: Crystal Structures Of Substrate Complexes With Lactoperoxidases From Two Different Species Length = 595 Back     alignment and structure
>pdb|2O86|A Chain A, Crystal Structure Of A Ternary Complex Of Buffalo Lactoperoxidase With Nitrate And Iodide At 2.8 A Resolution Length = 595 Back     alignment and structure
>pdb|2Z5Z|A Chain A, Crystal Structure Of The Complex Of Buffalo Lactoperoxidase With Fluoride Ion At 3.5a Resolution Length = 595 Back     alignment and structure
>pdb|2OYE|P Chain P, Indomethacin-(r)-alpha-ethyl-ethanolamide Bound To Cyclooxygenase-1 Length = 600 Back     alignment and structure
>pdb|1CQE|A Chain A, Prostaglandin H2 Synthase-1 Complex With Flurbiprofen Length = 580 Back     alignment and structure
>pdb|1PTH|A Chain A, The Structural Basis Of Aspirin Activity Inferred From The Crystal Structure Of Inactivated Prostaglandin H2 Synthase Length = 576 Back     alignment and structure
>pdb|1PGE|A Chain A, Prostaglandin H2 Synthase-1 Complexed With P-(2'-Iodo-5'-Thenoyl) Hydrotropic Acid (Iodosuprofen) Length = 576 Back     alignment and structure
>pdb|3N8W|B Chain B, Crystal Structure Of R120qNATIVE CYCLOOXYGENASE-1 Heterodimer Mutant In Complex With Flurbiprofen Length = 553 Back     alignment and structure
>pdb|3N8Y|B Chain B, Structure Of Aspirin Acetylated Cyclooxygenase-1 In Complex With Diclofenac Length = 553 Back     alignment and structure
>pdb|1DIY|A Chain A, Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Active Site Of Pghs-1 Length = 553 Back     alignment and structure
>pdb|1HT5|A Chain A, The 2.75 Angstrom Resolution Model Of Ovine Cox-1 Complexed With Methyl Ester Flurbiprofen Length = 551 Back     alignment and structure
>pdb|1EBV|A Chain A, Ovine Pghs-1 Complexed With Salicyl Hydroxamic Acid Length = 551 Back     alignment and structure
>pdb|3RR3|A Chain A, Structure Of (R)-Flurbiprofen Bound To Mcox-2 Length = 560 Back     alignment and structure
>pdb|1U67|A Chain A, Crystal Structure Of Arachidonic Acid Bound To A Mutant Of Prostagladin H Synthase-1 That Forms Predominantly 11-hpete Length = 600 Back     alignment and structure
>pdb|3KRK|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of L531f Murine Cox-2 Length = 591 Back     alignment and structure
>pdb|3HS5|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 591 Back     alignment and structure
>pdb|3MDL|A Chain A, X-Ray Crystal Structure Of 1-Arachidonoyl Glycerol Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 587 Back     alignment and structure
>pdb|3TZI|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound In The Cyclooxygenase Channel Of G533v Murine Cox-2 Length = 593 Back     alignment and structure
>pdb|3OLT|A Chain A, X-Ray Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Channel Of R513h Murine Cox-2 Length = 592 Back     alignment and structure
>pdb|3NT1|A Chain A, High Resolution Structure Of Naproxen:cox-2 Complex. Length = 587 Back     alignment and structure
>pdb|1DDX|A Chain A, Crystal Structure Of A Mixture Of Arachidonic Acid And Prostaglandin Bound To The Cyclooxygenase Active Site Of Cox-2: Prostaglandin Structure Length = 552 Back     alignment and structure
>pdb|3QH0|A Chain A, X-Ray Crystal Structure Of Palmitic Acid Bound To The Cyclooxygenase Channel Of Cyclooxygenase-2 Length = 610 Back     alignment and structure
>pdb|1PXX|A Chain A, Crystal Structure Of Diclofenac Bound To The Cyclooxygenase Active Site Of Cox-2 Length = 604 Back     alignment and structure
>pdb|1PRH|A Chain A, The X-Ray Crystal Structure Of The Membrane Protein Prostaglandin H2 Synthase-1 Length = 554 Back     alignment and structure
>pdb|1CVU|A Chain A, Crystal Structure Of Arachidonic Acid Bound To The Cyclooxygenase Active Site Of Cox-2 Length = 552 Back     alignment and structure
>pdb|3PGH|A Chain A, Cyclooxygenase-2 (Prostaglandin Synthase-2) Complexed With A Non- Selective Inhibitor, Flurbiprofen Length = 587 Back     alignment and structure
>pdb|1CXP|A Chain A, Cryogenic Crystal Structure Of Human Myeloperoxidase Isoform C Length = 104 Back     alignment and structure
>pdb|3F9P|A Chain A, Crystal Structure Of Myeloperoxidase From Human Leukocytes Length = 114 Back     alignment and structure
>pdb|1MYP|A Chain A, X-Ray Crystal Structure Of Canine Myeloperoxidase At 3 Angstroms Resolution Length = 108 Back     alignment and structure
>pdb|3Q6M|A Chain A, Crystal Structure Of Human Mc-Hsp90 In C2221 Space Group Length = 448 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1386
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 1e-109
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 4e-50
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 1e-109
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 3e-50
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 1e-108
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 7e-50
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 1e-106
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 2e-47
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 1e-105
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 2e-46
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 1e-103
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 8e-53
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 1e-103
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 3e-47
3peh_A281 Endoplasmin homolog; structural genomics, structur 1e-102
3peh_A281 Endoplasmin homolog; structural genomics, structur 4e-49
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 1e-91
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 1e-36
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 4e-91
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 2e-36
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 6e-88
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone 6e-43
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone 2e-07
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 1e-85
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 2e-39
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 9e-09
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 5e-79
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 5e-29
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 6e-79
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 2e-29
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 1e-04
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 3e-43
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 1e-38
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 1e-29
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 1e-04
3q9k_A595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 1e-42
3q9k_A595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 6e-26
3q9k_A595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 7e-20
1d2v_C466 Myeloperoxidase; heme-protein, oxidoreductase, per 2e-41
1d2v_C466 Myeloperoxidase; heme-protein, oxidoreductase, per 2e-36
1d2v_C466 Myeloperoxidase; heme-protein, oxidoreductase, per 2e-26
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 1e-40
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 5e-38
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 2e-29
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 2e-07
1d2v_A104 Myeloperoxidase; heme-protein, oxidoreductase, per 8e-25
3hjc_A444 Heat shock protein 83-1; sleeping sickness, struct 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3q6m_A448 Heat shock protein HSP 90-alpha; three domains, tr 8e-10
2cge_A405 ATP-dependent molecular chaperone HSP82; chaperone 7e-09
1sf8_A126 Chaperone protein HTPG; four helix bundle dimeriza 1e-08
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-06
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 Back     alignment and structure
 Score =  343 bits (882), Expect = e-109
 Identities = 127/157 (80%), Positives = 148/157 (94%)

Query: 1227 IIPNKEEKTLTIIDSGIGMTKADLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 1286
            +IPNK+++TLTI+D+GIGMTKADL+NNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY
Sbjct: 108  LIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFY 167

Query: 1287 SAYLVADKVTVTSKHNDDEQYIWESSAGGSFTIKPDNSEPLGRGTKIVLHMKEDQAEYIE 1346
            SAYLVA+KVTV +KHNDDEQY WESSAGGSFT++ D  EP+GRGTK++LH+KEDQ EY+E
Sbjct: 168  SAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLE 227

Query: 1347 EKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEE 1383
            E++IKEIVKKHSQFIGYPI L VEKER+KE+S+DE E
Sbjct: 228  ERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAE 264
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Length = 595 Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Length = 466 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>1d2v_A Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_A* 1d5l_A* 1d7w_A* 1dnu_A* 1dnw_A* 4dl1_A* 3zs1_A* 3f9p_A* 1mhl_A* 1myp_A* 3zs0_A* Length = 104 Back     alignment and structure
>3hjc_A Heat shock protein 83-1; sleeping sickness, structura genomics, stress response protein, chaperone, structural GE consortium, SGC; 2.50A {Leishmania major} Length = 444 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3q6m_A Heat shock protein HSP 90-alpha; three domains, trimer of dimer, hexamer, chaperone; 3.00A {Homo sapiens} PDB: 3q6n_A Length = 448 Back     alignment and structure
>2cge_A ATP-dependent molecular chaperone HSP82; chaperone complex, heat shock protein, CO-chaperone, ATP-binding, heat shock; 3.0A {Saccharomyces cerevisiae} Length = 405 Back     alignment and structure
>1sf8_A Chaperone protein HTPG; four helix bundle dimerization interface, exposed amphipathic helix, three stranded beta sheet; 2.60A {Escherichia coli} SCOP: d.271.1.1 Length = 126 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1386
3q9k_A595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 100.0
1d2v_C466 Myeloperoxidase; heme-protein, oxidoreductase, per 100.0
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 100.0
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 100.0
3peh_A281 Endoplasmin homolog; structural genomics, structur 100.0
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 100.0
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 100.0
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 100.0
3q9k_A595 Lactoperoxidase, LPO; bovine lactoperoxidase, oxid 100.0
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 100.0
1d2v_C466 Myeloperoxidase; heme-protein, oxidoreductase, per 100.0
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 100.0
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 100.0
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 99.97
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.97
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 99.96
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.96
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 99.96
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 99.95
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 99.95
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 99.95
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 99.93
1d2v_A104 Myeloperoxidase; heme-protein, oxidoreductase, per 99.91
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 99.07
3q6m_A448 Heat shock protein HSP 90-alpha; three domains, tr 98.91
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 98.89
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 98.85
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 98.51
3hjc_A444 Heat shock protein 83-1; sleeping sickness, struct 98.27
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 97.83
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 97.71
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 97.63
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 97.53
1sf8_A126 Chaperone protein HTPG; four helix bundle dimeriza 97.39
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 97.11
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 96.98
1s16_A 390 Topoisomerase IV subunit B; two-domain protein com 96.68
4duh_A220 DNA gyrase subunit B; structure-based drug design, 96.26
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 96.26
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 96.22
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 96.13
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genom 96.02
3peh_A281 Endoplasmin homolog; structural genomics, structur 95.76
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 95.62
3lnu_A 408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 95.3
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 94.33
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 93.49
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 93.11
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 92.67
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 91.92
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 90.28
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 89.91
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 87.13
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 87.0
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 86.78
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 86.69
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 83.96
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 83.13
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 82.79
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 81.34
3zxo_A129 Redox sensor histidine kinase response regulator; 81.24
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 80.72
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 80.6
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 80.34
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 80.25
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Back     alignment and structure
Probab=100.00  E-value=4.8e-115  Score=1063.58  Aligned_cols=417  Identities=28%  Similarity=0.465  Sum_probs=354.5

Q ss_pred             CCCCCccccCCCCCCccccCCccccccccccccccCCCCCCCCCCCCCCCCCCCCCchhhhHHHHHHhhcccccccCccc
Q psy16067        610 TSGNCRPILIPSNDDFYSQFNRRCLEYKRSLAINCSVGALQPDKICPGRESNPRPSAYKADVLATKLIRLKNFFFTDVET  689 (1386)
Q Consensus       610 ~~p~C~pI~vp~~Dp~~~~~~~~Cm~f~RS~~~~c~~G~~~~~~~~~~~~~~pr~~~~~~~~~~~~~~~~~~~~~~~~~~  689 (1386)
                      .||+|+||+||++||+|...+ .||+|+||.++ |+.|..           .                          ..
T Consensus       135 ~~~~C~pI~ip~~Dp~~~~~~-~Cm~f~RS~~~-~~~~~~-----------~--------------------------~~  175 (595)
T 3q9k_A          135 QGDNCFPIMFPKNDPKLKTQG-KCMPFFRAGFV-CPTPPY-----------Q--------------------------SL  175 (595)
T ss_dssp             CBTTBCCEECCTTCHHHHHSC-SEECCBCBCBS-SCSSCC-----------C--------------------------SS
T ss_pred             CCCCceeeeCCCCCCcccCCC-ceeEeecCCCc-CCCCCC-----------C--------------------------cc
Confidence            578999999999999997655 49999999986 544310           0                          01


Q ss_pred             cccccccccCcccCCcCCCCCHHhhHhhhcCCC--Cceeeecc---CCccCCCCCCC--CCCCC---CCCccccccCCcc
Q psy16067        690 CTFQIVQSTHFIDVSFMYGSHPDKARELRSLSR--GKLRVREV---NGRTFMPTGDP--SNCVN---ASSNICYDAGDIR  759 (1386)
Q Consensus       690 ~reQiNq~TsfLD~S~VYGSs~~~a~~LRsf~~--G~Lk~~~~---~g~~llP~~~~--~~C~~---~~~~~Cf~aGD~R  759 (1386)
                      +|||||++|||||||+||||+++++++||+|++  |+||++..   +|+.+||....  ..|..   .....||.+||.|
T Consensus       176 ~reQiN~~Ts~lD~S~VYGss~~~~~~LR~~~~~~G~Lk~~~~~~~~g~~~lP~~~~~~~~c~~~~~~~~~~cf~aGD~R  255 (595)
T 3q9k_A          176 AREQINAVTSFLDASLVYGSEPSLASRLRNLSSPLGLMAVNQEAWDHGLAYLPFNNKKPSPCEFINTTARVPCFLAGDFR  255 (595)
T ss_dssp             CCCBEECSCSSSSCHHHHCSSHHHHHHTBCCSSTTCCBCCCSSCCBTTBCCCCBCCCSSCHHHHTCTTTCCCCBCCSSTT
T ss_pred             hHhhhccccceeeeeeccCCCHHHHHHHhCCCCCCceeecccccCCCCccCCCCCCCCCCcccccCCCCCCcccccCCcc
Confidence            379999999999999999999999999999998  99998875   78899998643  35742   1235699999999


Q ss_pred             ccccchhhhHHHhHhhhchHHHHHHHhhCCCCCCchhHHHHHhHhhhhheeeeeeecccccccccccccccchhhhhhhh
Q psy16067        760 VNQQLDLAVSQTVWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGDIRVNQQLDLAVSQT  839 (1386)
Q Consensus       760 ~Ne~pgLtalhtlflReHNrIA~~L~~iNP~W~~~De~lfq~AR~i~ia~~q~I~~~e~LP~llGD~R~NEn~~L~alhT  839 (1386)
                      +||+|+|++|||||+|||||||++|+++||+|+                                               
T Consensus       256 ~ne~p~L~~lhtlflREHNria~~L~~~nP~W~-----------------------------------------------  288 (595)
T 3q9k_A          256 ASEQILLATAHTLLLREHNRLARELKKLNPHWN-----------------------------------------------  288 (595)
T ss_dssp             TTSBHHHHHHHHHHHHHHHHHHHHHHHHCTTCC-----------------------------------------------
T ss_pred             ccccHHHHHHHHHHHHHHHHHHHHHHhhCCCCC-----------------------------------------------
Confidence            999999999999999999999999999999988                                               


Q ss_pred             HHHHHhHHHHHHHHhcCCCCCCchhHHHHHHHHHHHhhhhhhhhhchhhhhhccchhhhcCCCCCCCCCccCCCCCCCCc
Q psy16067        840 VWLRFHNYVAEKLIQQNPSWSNRDELVYQEARRLVIGCFQHIVYNEWLPILIGESYTKDVGLSPTSSGYFQGYDPEVNPS  919 (1386)
Q Consensus       840 lflReHNriA~~L~~~Np~Ws~~DE~LFQEARrIViA~~QhItYnEfLP~LLG~~~~~~~gL~~~~~G~y~gYd~~vdp~  919 (1386)
                                             ||+|||||||||||+||||||+||||+|||.+ |.++      .|+|.|        
T Consensus       289 -----------------------dE~LfQeAR~Iv~A~~Q~Ity~E~LP~ilG~~-~~~~------~~~~~g--------  330 (595)
T 3q9k_A          289 -----------------------GEKLYQEARKILGAFIQIITFRDYLPIVLGSE-MQKW------IPPYQG--------  330 (595)
T ss_dssp             -----------------------HHHHHHHHHHHHHHHHHHHHHHTHHHHHHGGG-HHHH------SCSCCC--------
T ss_pred             -----------------------HHHHHHHHHHHHHHHeeeeeHHHHHHHHhCch-hhhh------CCCccC--------
Confidence                                   89999999999999999999999999999998 5542      133444        


Q ss_pred             chhhhcccccccccccccCCCCCCCCCCccCCCCCCCCcchHHHHhhhhccccccCccceeeccccccc---CCCCCccc
Q psy16067        920 TLADFAAGAFRGESYTKDVGLSPTSSGYFQGYDPEVNPSTLADFAAGAFRGLHSLIPGTIKLVNERRVT---NQELPFSS  996 (1386)
Q Consensus       920 i~neFAtaAfR~hs~~~~~~l~~~~~~~~~~Yd~~vnpsi~~EFatAAfRfgHSlI~~~i~~~~~~~~~---~~~~~l~~  996 (1386)
                                                     |++.++|+|++|| +||||||||+|++.+.++++.+..   ...++|.+
T Consensus       331 -------------------------------Y~~~v~p~i~neF-~aafRfgHsli~~~~~~~~~~~~~~~~~~~~~L~~  378 (595)
T 3q9k_A          331 -------------------------------YNNSVDPRISNVF-TFAFRFGHMEVPSTVSRLDENYQPWGPEAELPLHT  378 (595)
T ss_dssp             -------------------------------CCTTSCCCCBTTH-HHHGGGGGGGCCSEEECBCTTSSBCSTTCEEEGGG
T ss_pred             -------------------------------CCCCCCCccHHHH-HHHHHhHHhhCcchhhccCccccccCCCCceeHHH
Confidence                                           5566677788889 899999999999999998876543   35789999


Q ss_pred             cccCcccccccccchhhhhhhhhhhhhh--hcCCCCCHHHHhhccccCCCCccccccccccCcc----------hhhhHH
Q psy16067        997 TMQHPGDILEVMDVFDSTLRGLTNQLQQ--YQDRFITEQTIDFLFRVGSLSLEKVIVDLVGLTL----------GFFYLW 1064 (1386)
Q Consensus       997 ~~~~p~~il~~~~~~d~llrGl~~q~~~--~~D~~i~~~l~n~LF~~~~~~~~~~g~DL~~lni----------~n~~r~ 1064 (1386)
                      .||+|+.++. .+++|.+++||+.|+++  ..|.+++++|+++||+....   ..++||+++||          ||.||+
T Consensus       379 ~ff~~~~~~~-~~gid~llrGl~~q~a~~~~~d~~~~~~l~~~Lf~~~~~---~~g~DL~alnIqRgRdhGlp~yn~~R~  454 (595)
T 3q9k_A          379 LFFNTWRIIK-DGGIDPLVRGLLAKKSKLMNQDKMVTSELRNKLFQPTHK---IHGFDLAAINLQRCRDHGMPGYNSWRG  454 (595)
T ss_dssp             GBTCCHHHHT-TTCSHHHHHHHHHSEEECCCTTSCSCHHHHTCEECTTSC---SEEECHHHHHHHHHHHTTCCCHHHHHH
T ss_pred             HhcChHHhhh-ccchHHHHHHHhhCcccccCCCccCCHHHHHHhccCCCc---cccccHHHHHHHHHHHhCCCCHHHHHH
Confidence            9999986553 56899999999999998  88999999999999985432   12678877766          799999


Q ss_pred             hhCCC--------------HHHHHHHHHhcCCCCccccceeeecccccCCCCcchHHHHHHHHHHHHhhcCCcccccCCC
Q psy16067       1065 YCGGF--------------LLQVTRLSQVYRGVNDIDYYIGGLLESVIRGTLSSPSFRCVFAEAFYRYKYGDRYFYEGPP 1130 (1386)
Q Consensus      1065 ~cgL~--------------~~~i~~L~~lY~~vdDIDL~vGgLaE~p~~G~~vGPTf~CII~~QF~rLr~GDRFwYEn~~ 1130 (1386)
                      +|||+              ++++++|++||++|||||||||||+|++++|+++||||+|||++||+|||+||||||||  
T Consensus       455 ~~gl~~~~sf~dl~~~~~~~~~~~~l~~lY~~~d~iDl~vG~l~E~~~~g~~~Gptf~~ii~~qf~~lr~gDRf~yen--  532 (595)
T 3q9k_A          455 FCGLSQPKTLKGLQTVLKNKILAKKLMDLYKTPDNIDIWIGGNAEPMVERGRVGPLLACLLGRQFQQIRDGDRFWWEN--  532 (595)
T ss_dssp             HTTCCCCCSHHHHHHHHTCHHHHHHHHHHHSSGGGSCHHHHHHHSCCCTTBSSCHHHHHHHHHHHHHHHHTCTTCTTS--
T ss_pred             HcCCCCCCCHHHHhhhcCcHHHHHHHHHHhCCccccceeecccccccCCCCCcCHHHHHHHHHHHHHHHhcCCCeecC--
Confidence            99996              12468999999999999999999999999999999999999999999999999999996  


Q ss_pred             CCCCCCcChhhHHHHHhhccccceecccCCccccccCCCCCCCCCC-CCCCCCCCCCCCCCCCCCcc
Q psy16067       1131 ATNPGAFTPGKQLTLTSLTSLASLCIFSCFQALDKIRPSNHPGPNS-LMDQPCRGGAAPGPGDGDVV 1196 (1386)
Q Consensus      1131 ~~~p~~FT~~qql~~irk~sla~l~~~~~sDaiDkIQps~f~~pn~-l~nv~C~~~~~~~~~~~~~~ 1196 (1386)
                         |+.||++ |+++|||+|||+|+|.+ + .++.||+++|..++. ...++|.  .||++|+..|+
T Consensus       533 ---~~~ft~~-ql~ei~~~sla~iic~n-~-~i~~vq~~~F~~~~~~n~~v~C~--~ip~~dL~~W~  591 (595)
T 3q9k_A          533 ---PGVFTEK-QRDSLQKVSFSRLICDN-T-HITKVPLHAFQANNYPHDFVDCS--TVDKLDLSPWA  591 (595)
T ss_dssp             ---BTTBCHH-HHHHHTTCCHHHHHHHH-S-SCCEEESSTTSCCCTTTTEEEGG--GSCCCCCGGGC
T ss_pred             ---CCcCCHH-HHHHHHhCCHHHHHhcC-C-CcccccHhhccCCCCCCCCccCC--CCCCCChHHhh
Confidence               6899997 89999999999987653 3 378999999985442 2347895  49999999986
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3q9k_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, phenyl isothiocyanat iodide, PEG, edman reagent; HET: SEP HEM NAG; 1.70A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3ogw_A* 3py4_A* 3nyh_A* 3ql6_A* 3r4x_A* ... Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1d2v_C Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_C* 1d5l_C* 1d7w_C* 1dnu_C* 1dnw_C* 1mhl_C* 1myp_C* 4dl1_C* 3zs0_C* 3f9p_C* 3zs1_C* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1d2v_A Myeloperoxidase; heme-protein, oxidoreductase, peroxidase-bromide; HET: NAG BMA MAN FUC HEM; 1.75A {Homo sapiens} SCOP: a.93.1.2 PDB: 1cxp_A* 1d5l_A* 1d7w_A* 1dnu_A* 1dnw_A* 4dl1_A* 3zs1_A* 3f9p_A* 1mhl_A* 1myp_A* 3zs0_A* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3q6m_A Heat shock protein HSP 90-alpha; three domains, trimer of dimer, hexamer, chaperone; 3.00A {Homo sapiens} PDB: 3q6n_A Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3hjc_A Heat shock protein 83-1; sleeping sickness, structura genomics, stress response protein, chaperone, structural GE consortium, SGC; 2.50A {Leishmania major} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>1sf8_A Chaperone protein HTPG; four helix bundle dimerization interface, exposed amphipathic helix, three stranded beta sheet; 2.60A {Escherichia coli} SCOP: d.271.1.1 Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1386
g1cxp.1570 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi 1e-54
g1cxp.1570 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi 4e-33
g1cxp.1570 a.93.1.2 (A:,C:) Myeloperoxidase {Human (Homo sapi 7e-23
d1cvua1511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 2e-47
d1cvua1511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 2e-40
d1cvua1511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 4e-32
d1cvua1511 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mou 1e-06
d1uyla_208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 6e-44
d1uyla_208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9e-23
d1q4ga1511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 7e-44
d1q4ga1511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 1e-41
d1q4ga1511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 3e-29
d1q4ga1511 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {She 1e-06
d2iwxa1213 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo 6e-43
d2iwxa1213 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo 5e-23
d2gqpa1227 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) 1e-40
d2gqpa1227 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) 1e-20
d1sf8a_115 d.271.1.1 (A:) Chaperone protein HtpG {Escherichia 4e-07
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Length = 511 Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Length = 511 Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 Back     information, alignment and structure
>d1sf8a_ d.271.1.1 (A:) Chaperone protein HtpG {Escherichia coli [TaxId: 562]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1386
g1cxp.1570 Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 100.0
d1cvua1511 Prostaglandin H2 synthase {Mouse (Mus musculus) [T 100.0
d1q4ga1511 Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax 100.0
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 100.0
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
g1cxp.1570 Myeloperoxidase {Human (Homo sapiens) [TaxId: 9606 100.0
d1cvua1511 Prostaglandin H2 synthase {Mouse (Mus musculus) [T 99.97
d1q4ga1511 Prostaglandin H2 synthase {Sheep (Ovis aries) [Tax 99.97
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 97.96
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 97.84
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 96.81
d1sf8a_115 Chaperone protein HtpG {Escherichia coli [TaxId: 5 94.88
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 94.31
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 92.49
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 92.1
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 92.02
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 91.33
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 89.35
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 88.41
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 88.1
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 88.01
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 84.86
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 83.61
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 81.2
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvua1 a.93.1.2 (A:74-583) Prostaglandin H2 synthase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga1 a.93.1.2 (A:74-584) Prostaglandin H2 synthase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1sf8a_ d.271.1.1 (A:) Chaperone protein HtpG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure