Psyllid ID: psy16078

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MSFIPETPNEKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKERLSKYEVVESDQPISDDNSAI
cccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
msfipetpnekNKEAFRRYLEQSGVVDAITSALVMLYSieekpedplDFIRRNlgderpevAEYEAVLQDLDEAKAELDQLTATVANLKERLSkyevvesdqpisddnsai
msfipetpneknKEAFRRYLEQSGVVDAITSALVMLYSieekpedplDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKerlskyevvesdqpisddnsai
MSFIPETPNEKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKERLSKYEVVESDQPISDDNSAI
****************RRYLEQSGVVDAITSALVMLYSIEE*****LDFIRR**********EYEAVLQD**********LTATVA*************************
****************RRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVA*************************
************KEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKERLSKYE***************
*****ETPNEKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKERLSK*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFIPETPNEKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxESDQPISDDNSAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q2TBP7103 C-Myc-binding protein OS= yes N/A 0.765 0.825 0.423 2e-11
Q99417103 C-Myc-binding protein OS= yes N/A 0.765 0.825 0.423 2e-11
Q5R7A8103 C-Myc-binding protein OS= yes N/A 0.765 0.825 0.423 3e-11
Q9EQS3103 C-Myc-binding protein OS= yes N/A 0.765 0.825 0.435 5e-11
Q54I5790 C-Myc-binding protein hom yes N/A 0.738 0.911 0.416 4e-10
Q9VG76181 C-Myc-binding protein hom no N/A 0.855 0.524 0.333 2e-09
>sp|Q2TBP7|MYCBP_BOVIN C-Myc-binding protein OS=Bos taurus GN=MYCBP PE=3 SV=3 Back     alignment and function desciption
 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%)

Query: 12 NKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQDL 71
           +E FRRYLE+SGV+D +T  LV LY   EKP   LDF++ +LG   PE  E E +  +L
Sbjct: 10 KREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLEL 69

Query: 72 DEAKAELDQLTATVANLKERLSKYE 96
           E K + + +      LK +L++YE
Sbjct: 70 AEMKEKYEAIVEENKKLKTKLAQYE 94
May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Bos taurus (taxid: 9913)
>sp|Q99417|MYCBP_HUMAN C-Myc-binding protein OS=Homo sapiens GN=MYCBP PE=1 SV=3 Back     alignment and function description
>sp|Q5R7A8|MYCBP_PONAB C-Myc-binding protein OS=Pongo abelii GN=MYCBP PE=3 SV=3 Back     alignment and function description
>sp|Q9EQS3|MYCBP_MOUSE C-Myc-binding protein OS=Mus musculus GN=Mycbp PE=2 SV=4 Back     alignment and function description
>sp|Q54I57|MYCBP_DICDI C-Myc-binding protein homolog OS=Dictyostelium discoideum GN=mycbp PE=3 SV=1 Back     alignment and function description
>sp|Q9VG76|MYCBP_DROME C-Myc-binding protein homolog OS=Drosophila melanogaster GN=CG17202 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
242013462100 C-Myc-binding protein, putative [Pedicul 0.801 0.89 0.467 4e-14
260818256104 hypothetical protein BRAFLDRAFT_115113 [ 0.756 0.807 0.452 4e-13
209734708103 C-Myc-binding protein [Salmo salar] 0.864 0.932 0.401 4e-12
225704314103 C-Myc-binding protein [Oncorhynchus myki 0.864 0.932 0.401 5e-12
225703768103 C-Myc-binding protein [Oncorhynchus myki 0.837 0.902 0.419 5e-12
156386800104 predicted protein [Nematostella vectensi 0.756 0.807 0.428 5e-12
291227332105 PREDICTED: hypothetical protein [Saccogl 0.819 0.866 0.413 9e-12
198423480104 PREDICTED: similar to predicted protein 0.756 0.807 0.464 1e-11
38385671993 PREDICTED: c-Myc-binding protein-like [M 0.774 0.924 0.451 1e-11
307198407142 C-Myc-binding protein [Harpegnathos salt 0.774 0.605 0.397 2e-11
>gi|242013462|ref|XP_002427425.1| C-Myc-binding protein, putative [Pediculus humanus corporis] gi|212511805|gb|EEB14687.1| C-Myc-binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 82.0 bits (201), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/92 (46%), Positives = 62/92 (67%), Gaps = 3/92 (3%)

Query: 8  PNEKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAV 67
          P +  +E FR+YLE++GV+DA+T  LV LY   E+PE P+D + +NLGD+RPE  E +A 
Sbjct: 6  PIDSKREEFRKYLERAGVMDALTKVLVALY---EEPEKPVDAMEKNLGDDRPERCELDAA 62

Query: 68 LQDLDEAKAELDQLTATVANLKERLSKYEVVE 99
          L DL +A+ ++  L  T+   K RL KYE +E
Sbjct: 63 LNDLADAQNKIAVLEETLQEFKARLEKYEPIE 94

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|260818256|ref|XP_002604299.1| hypothetical protein BRAFLDRAFT_115113 [Branchiostoma floridae] gi|229289625|gb|EEN60310.1| hypothetical protein BRAFLDRAFT_115113 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|209734708|gb|ACI68223.1| C-Myc-binding protein [Salmo salar] Back     alignment and taxonomy information
>gi|225704314|gb|ACO08003.1| C-Myc-binding protein [Oncorhynchus mykiss] gi|225704370|gb|ACO08031.1| C-Myc-binding protein [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|225703768|gb|ACO07730.1| C-Myc-binding protein [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|156386800|ref|XP_001634099.1| predicted protein [Nematostella vectensis] gi|156221178|gb|EDO42036.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|291227332|ref|XP_002733639.1| PREDICTED: hypothetical protein [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|198423480|ref|XP_002127905.1| PREDICTED: similar to predicted protein [Ciona intestinalis] Back     alignment and taxonomy information
>gi|383856719|ref|XP_003703855.1| PREDICTED: c-Myc-binding protein-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307198407|gb|EFN79349.1| C-Myc-binding protein [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
UNIPROTKB|Q2TBP7103 MYCBP "C-Myc-binding protein" 0.837 0.902 0.387 1.3e-13
UNIPROTKB|J9P9G9103 MYCBP "Uncharacterized protein 0.837 0.902 0.387 1.3e-13
UNIPROTKB|Q99417103 MYCBP "C-Myc-binding protein" 0.837 0.902 0.387 1.3e-13
UNIPROTKB|F2Z5W0103 MYCBP "Uncharacterized protein 0.837 0.902 0.387 1.3e-13
UNIPROTKB|Q5R7A8103 MYCBP "C-Myc-binding protein" 0.837 0.902 0.387 1.3e-13
ZFIN|ZDB-GENE-060331-97104 mycbp "c-myc binding protein" 0.792 0.846 0.409 2.7e-13
MGI|MGI:1891750103 Mycbp "c-myc binding protein" 0.837 0.902 0.397 3.4e-13
RGD|2320727103 Mycbp "c-myc binding protein" 0.837 0.902 0.387 7.1e-13
FB|FBgn0038373 457 CG4546 [Drosophila melanogaste 0.792 0.192 0.352 1.8e-12
DICTYBASE|DDB_G028899190 DDB_G0288991 "unknown" [Dictyo 0.738 0.911 0.416 3.9e-12
UNIPROTKB|Q2TBP7 MYCBP "C-Myc-binding protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 177 (67.4 bits), Expect = 1.3e-13, P = 1.3e-13
 Identities = 36/93 (38%), Positives = 55/93 (59%)

Query:    10 EKNKEAFRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLGDERPEVAEYEAVLQ 69
             +  +E FRRYLE+SGV+D +T  LV LY   EKP   LDF++ +LG   PE  E E +  
Sbjct:     8 DSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRL 67

Query:    70 DLDEAKAELDQLTATVANLKERLSKYEVVESDQ 102
             +L E K + + +      LK +L++YE  + ++
Sbjct:    68 ELAEMKEKYEAIVEENKKLKTKLAQYEPPQEEK 100
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0003713 "transcription coactivator activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=IEA
GO:0007283 "spermatogenesis" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
UNIPROTKB|J9P9G9 MYCBP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q99417 MYCBP "C-Myc-binding protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5W0 MYCBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R7A8 MYCBP "C-Myc-binding protein" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060331-97 mycbp "c-myc binding protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1891750 Mycbp "c-myc binding protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2320727 Mycbp "c-myc binding protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0038373 CG4546 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288991 DDB_G0288991 "unknown" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q99417MYCBP_HUMANNo assigned EC number0.42350.76570.8252yesN/A
Q9EQS3MYCBP_MOUSENo assigned EC number0.43520.76570.8252yesN/A
Q5R7A8MYCBP_PONABNo assigned EC number0.42350.76570.8252yesN/A
Q54I57MYCBP_DICDINo assigned EC number0.41660.73870.9111yesN/A
Q2TBP7MYCBP_BOVINNo assigned EC number0.42350.76570.8252yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PF0518642 Dpy-30: Dpy-30 motif; InterPro: IPR007858 This mot 97.8
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 95.34
PRK14127109 cell division protein GpsB; Provisional 94.79
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 94.63
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 94.57
TIGR01834320 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synth 93.29
PRK00888105 ftsB cell division protein FtsB; Reviewed 93.28
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 93.07
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 92.97
PHA0175075 hypothetical protein 92.5
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 92.34
smart0033865 BRLZ basic region leucin zipper. 92.22
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 91.5
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 91.47
KOG4797|consensus123 90.56
PRK13169110 DNA replication intiation control protein YabA; Re 90.35
PF03980109 Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essent 90.15
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 89.41
PF0438079 BMFP: Membrane fusogenic activity; InterPro: IPR00 89.39
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 89.19
KOG4109|consensus116 88.96
PRK00888105 ftsB cell division protein FtsB; Reviewed 88.16
KOG0994|consensus 1758 87.65
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 87.53
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 87.3
PRK14127109 cell division protein GpsB; Provisional 86.17
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 85.92
COG2433 652 Uncharacterized conserved protein [Function unknow 85.88
PRK09413121 IS2 repressor TnpA; Reviewed 85.73
smart0034044 HALZ homeobox associated leucin zipper. 85.41
PF11853 489 DUF3373: Protein of unknown function (DUF3373); In 84.92
PF09712293 PHA_synth_III_E: Poly(R)-hydroxyalkanoic acid synt 84.85
TIGR0220985 ftsL_broad cell division protein FtsL. This model 84.77
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 84.41
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 84.23
PRK13922 276 rod shape-determining protein MreC; Provisional 83.75
PF05597132 Phasin: Poly(hydroxyalcanoate) granule associated 83.62
PF1477560 NYD-SP28_assoc: Sperm tail C-terminal domain 83.6
PRK1539678 murein lipoprotein; Provisional 82.59
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 82.46
TIGR01837118 PHA_granule_1 poly(hydroxyalkanoate) granule-assoc 82.23
PF1419383 DUF4315: Domain of unknown function (DUF4315) 82.09
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 81.86
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 81.79
COG4026290 Uncharacterized protein containing TOPRIM domain, 81.63
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 81.48
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 81.06
TIGR0244965 conserved hypothetical protein TIGR02449. Members 80.87
KOG3119|consensus269 80.32
KOG1333|consensus241 80.28
PF1154476 Spc42p: Spindle pole body component Spc42p; InterP 80.22
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 80.16
>PF05186 Dpy-30: Dpy-30 motif; InterPro: IPR007858 This motif is about 40 residues long and is probably formed of two alpha-helices Back     alignment and domain information 
Probab=97.80  E-value=1.8e-05  Score=47.72  Aligned_cols=36  Identities=39%  Similarity=0.724  Sum_probs=31.0

Q ss_pred             HHHHHHhcChHHHHHHHHHHHhcCCCCCCCHHHHHHHhh
Q psy16078         16 FRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNL   54 (111)
Q Consensus        16 FRkYLE~~GVlDaLTkvLV~LYEe~ekP~dalefir~~L   54 (111)
                      -|+||.+. |+..|++.|..+-  ..||+||++||-++|
T Consensus         2 ~r~YL~~~-v~p~L~~gL~~l~--~~rP~DPi~~La~~L   37 (42)
T PF05186_consen    2 ARQYLKET-VGPVLTEGLAELA--KERPEDPIEFLAEYL   37 (42)
T ss_dssp             HHHHHHHH-THHHHHHHHHHHH--HH--SSHHHHHHHHH
T ss_pred             HHHHHHHH-hHHHHHHHHHHHH--HHCCCChHHHHHHHH
Confidence            48999986 9999999999996  789999999999887

It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation []. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control []. There is also a human homologue of Dpy-30 []. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 from INTERPRO.; PDB: 3G36_D.
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>TIGR01834 PHA_synth_III_E poly(R)-hydroxyalkanoic acid synthase, class III, PhaE subunit Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PHA01750 hypothetical protein Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG4797|consensus Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF03980 Nnf1: Nnf1 ; InterPro: IPR007128 NNF1 is an essential yeast gene required for proper spindle orientation, nucleolar and nuclear envelope structure and mRNA export [] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF04380 BMFP: Membrane fusogenic activity; InterPro: IPR007475 BMFP consists of two structural domains, a coiled-coil C-terminal domain via which the protein self-associates as a trimer, and an N-terminal domain disordered at neutral pH but adopting an amphipathic alpha-helical structure in the presence of phospholipid vesicles, high ionic strength, acidic pH or SDS Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4109|consensus Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK14127 cell division protein GpsB; Provisional Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PF11853 DUF3373: Protein of unknown function (DUF3373); InterPro: IPR021803 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF09712 PHA_synth_III_E: Poly(R)-hydroxyalkanoic acid synthase subunit (PHA_synth_III_E) Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF05597 Phasin: Poly(hydroxyalcanoate) granule associated protein (phasin); InterPro: IPR008769 Polyhydroxyalkanoates (PHAs) are storage polyesters synthesised by various bacteria as intracellular carbon and energy reserve material Back     alignment and domain information
>PF14775 NYD-SP28_assoc: Sperm tail C-terminal domain Back     alignment and domain information
>PRK15396 murein lipoprotein; Provisional Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>TIGR01837 PHA_granule_1 poly(hydroxyalkanoate) granule-associated protein Back     alignment and domain information
>PF14193 DUF4315: Domain of unknown function (DUF4315) Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>KOG3119|consensus Back     alignment and domain information
>KOG1333|consensus Back     alignment and domain information
>PF11544 Spc42p: Spindle pole body component Spc42p; InterPro: IPR021611 Spc42p is a 42kDa component of the S Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.8 bits (92), Expect = 6e-05
 Identities = 21/118 (17%), Positives = 45/118 (38%), Gaps = 17/118 (14%)

Query: 1   MSFIPETPNEKNKEAFRRYLEQSGV--VDA-ITSALVMLYSIEEKPEDPLD----FIRRN 53
            S     P E     +R+  ++  V    A I + L+ L   +    D +       + +
Sbjct: 361 SSLNVLEPAE-----YRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYS 415

Query: 54  LGDERPEVAEYEAVLQDLD-EAKAELDQLTATVANLKERLSKYEVVESDQ--PISDDN 108
           L +++P+  E    +  +  E K +L+   A   ++ +  +  +  +SD   P   D 
Sbjct: 416 LVEKQPK--ESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQ 471

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 99.66
3g36_A55 Protein DPY-30 homolog; X-type four-helix bundle, 97.4
4f9k_A95 CAMP-dependent protein kinase type I-beta regulat 96.45
3ra3_A28 P1C; coiled coil domain, fiber, KIH interactions, 94.94
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 94.54
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 94.12
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 93.51
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 93.16
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 93.01
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 92.61
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 92.34
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 92.23
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 91.13
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 91.01
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 90.34
1dip_A78 Delta-sleep-inducing peptide immunoreactive peptid 90.26
3ra3_B28 P2F; coiled coil domain, fiber, KIH interactions, 89.04
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 88.47
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 87.36
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 86.11
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 85.71
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.83
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 84.58
2wuj_A57 Septum site-determining protein diviva; bacterial 84.11
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 84.06
3viq_B85 Mating-type switching protein SWI5; recombination 83.99
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 83.9
2wuj_A57 Septum site-determining protein diviva; bacterial 83.88
1deb_A54 APC protein, adenomatous polyposis coli protein; c 83.4
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 83.38
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 83.18
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 83.03
1r8d_A109 Transcription activator MTAN; protein-DNA complex, 82.34
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 82.33
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 81.66
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 81.6
4e61_A106 Protein BIM1; EB1-like motif, coiled-coil, spindle 81.35
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 81.32
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 80.69
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 80.49
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 80.37
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=1.1e-16  Score=100.13  Aligned_cols=53  Identities=32%  Similarity=0.582  Sum_probs=37.1

Q ss_pred             CCHHHHHHHhhCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccc
Q psy16078         44 EDPLDFIRRNLGDERPEVAEYEAVLQDLDEAKAELDQLTATVANLKERLSKYE   96 (111)
Q Consensus        44 ~dalefir~~Lg~~~p~~~e~e~Lk~E~~~lk~~i~~L~~e~~eL~~~l~~~e   96 (111)
                      +||++||++|||+.+|+.+|+++|++||++||++++.|++++++|+++|.+|+
T Consensus         1 ~~AlefIk~~LG~~~p~~~d~eaLk~E~~eLk~k~~~L~~~~~el~~~l~~~e   53 (53)
T 2yy0_A            1 NSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYE   53 (53)
T ss_dssp             ---------------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             CcHHHHHHHHcCCCCCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccC
Confidence            48999999999966699999999999999999999999999999999999885
>3g36_A Protein DPY-30 homolog; X-type four-helix bundle, nucleus, nuclear protein; 1.20A {Homo sapiens} Back     alignment and structure
>4f9k_A CAMP-dependent protein kinase type I-beta regulat subunit; structural genomics, PSI-biology; 2.80A {Homo sapiens} PDB: 2ezw_A 3im3_A 3im4_A Back     alignment and structure
>3ra3_A P1C; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1dip_A Delta-sleep-inducing peptide immunoreactive peptide; structure, leucine zipper, PIG, acetylation; NMR {Sus scrofa} SCOP: h.1.12.1 Back     alignment and structure
>3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2wuj_A Septum site-determining protein diviva; bacterial cell division, septation, cell cycle, sporulation; 1.40A {Bacillus subtilis} PDB: 2wuk_A Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1r8d_A Transcription activator MTAN; protein-DNA complex, transcription/DNA complex; 2.70A {Bacillus subtilis} SCOP: a.6.1.3 PDB: 1jbg_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>4e61_A Protein BIM1; EB1-like motif, coiled-coil, spindle orientation, mitosis, K phosphorylation, mitotic spindle, microtubules, cell cycle; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d2ezwa150 cAMP-dependent protein kinase type I-alpha regulat 96.01
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 86.67
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 85.85
d1r8da_109 Multidrug transporter activator MtaN {Bacillus sub 84.55
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 83.64
>d2ezwa1 a.31.1.1 (A:12-61) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
superfamily: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
family: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit
domain: cAMP-dependent protein kinase type I-alpha regulatory subunit
species: Cow (Bos taurus) [TaxId: 9913]

Probab=96.01  E-value=0.0022  Score=37.97  Aligned_cols=38  Identities=21%  Similarity=0.539  Sum_probs=33.4

Q ss_pred             HHHHHHhcChHHHHHHHHHHHhcCCCCCCCHHHHHHHhhC
Q psy16078         16 FRRYLEQSGVVDAITSALVMLYSIEEKPEDPLDFIRRNLG   55 (111)
Q Consensus        16 FRkYLE~~GVlDaLTkvLV~LYEe~ekP~dalefir~~Lg   55 (111)
                      -..|+.+.+|=.-|-..+|.|  .-.||++|+.|||+||.
T Consensus         5 ce~Yvq~Hniq~lLKdcIVqL--Ci~rPe~P~~FLreyFe   42 (50)
T d2ezwa1           5 CELYVQKHNIQALLKDSIVQL--CTARPERPMAFLREYFE   42 (50)
T ss_dssp             HTTTSSTTSSHHHHHHHHHHH--TTCCCSCHHHHHHHHHH
T ss_pred             HHHHHHHHhHHHHHHHHHHHH--HhcCCCCHHHHHHHHHH
Confidence            345888899888888999999  79999999999999984
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8da_ a.6.1.3 (A:) Multidrug transporter activator MtaN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure