Psyllid ID: psy1615
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| 157131847 | 486 | coup transcription factor [Aedes aegypti | 0.362 | 0.220 | 0.975 | 2e-64 | |
| 312374364 | 566 | hypothetical protein AND_16003 [Anophele | 0.355 | 0.185 | 0.991 | 4e-64 | |
| 347968055 | 717 | AGAP002544-PB [Anopheles gambiae str. PE | 0.338 | 0.139 | 0.991 | 2e-63 | |
| 170048340 | 489 | coup transcription factor [Culex quinque | 0.362 | 0.218 | 0.975 | 3e-63 | |
| 195329610 | 1085 | GM24010 [Drosophila sechellia] gi|194120 | 0.338 | 0.092 | 0.974 | 1e-62 | |
| 345494381 | 465 | PREDICTED: hypothetical protein LOC10011 | 0.362 | 0.230 | 0.974 | 3e-62 | |
| 24646228 | 746 | seven up, isoform A [Drosophila melanoga | 0.349 | 0.138 | 0.974 | 3e-62 | |
| 307171274 | 229 | Steroid receptor seven-up, isoform A [Ca | 0.366 | 0.471 | 0.983 | 6e-62 | |
| 322800405 | 204 | hypothetical protein SINV_07844 [Solenop | 0.366 | 0.529 | 0.983 | 1e-61 | |
| 332021408 | 326 | Steroid receptor seven-up, isoform A [Ac | 0.362 | 0.328 | 0.991 | 1e-61 |
| >gi|157131847|ref|XP_001655965.1| coup transcription factor [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 251 bits (641), Expect = 2e-64, Method: Compositional matrix adjust.
Identities = 118/121 (97%), Positives = 120/121 (99%)
Query: 1 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 60
MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV
Sbjct: 113 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 172
Query: 61 APLLAAAGLHASPMAADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKR 120
APLLAAAGLHASPMAADRVVAFMDHIR+FQEQVEKLKALHVDSAEYSCLKAIVLFTTGK
Sbjct: 173 APLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKM 232
Query: 121 I 121
+
Sbjct: 233 L 233
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312374364|gb|EFR21933.1| hypothetical protein AND_16003 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347968055|ref|XP_003436151.1| AGAP002544-PB [Anopheles gambiae str. PEST] gi|333468185|gb|EGK96862.1| AGAP002544-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|170048340|ref|XP_001851989.1| coup transcription factor [Culex quinquefasciatus] gi|167870435|gb|EDS33818.1| coup transcription factor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195329610|ref|XP_002031503.1| GM24010 [Drosophila sechellia] gi|194120446|gb|EDW42489.1| GM24010 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|345494381|ref|XP_001599309.2| PREDICTED: hypothetical protein LOC100114206 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|24646228|ref|NP_731681.1| seven up, isoform A [Drosophila melanogaster] gi|62512142|sp|P16376.3|7UP2_DROME RecName: Full=Steroid receptor seven-up, isoform A; AltName: Full=Nuclear receptor subfamily 2 group F member 3, isoform A gi|23171091|gb|AAN13541.1| seven up, isoform A [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|307171274|gb|EFN63200.1| Steroid receptor seven-up, isoform A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322800405|gb|EFZ21409.1| hypothetical protein SINV_07844 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332021408|gb|EGI61776.1| Steroid receptor seven-up, isoform A [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 295 | ||||||
| FB|FBgn0003651 | 746 | svp "seven up" [Drosophila mel | 0.403 | 0.159 | 0.974 | 4.8e-60 | |
| UNIPROTKB|A6QPQ9 | 273 | NR2F1 "NR2F1 protein" [Bos tau | 0.447 | 0.483 | 0.838 | 1.4e-55 | |
| UNIPROTKB|F1N056 | 353 | NR2F1 "COUP transcription fact | 0.447 | 0.373 | 0.838 | 1.4e-55 | |
| UNIPROTKB|Q9TTR8 | 424 | NR2F1 "COUP transcription fact | 0.447 | 0.311 | 0.838 | 1.4e-55 | |
| UNIPROTKB|P10589 | 423 | NR2F1 "COUP transcription fact | 0.447 | 0.312 | 0.838 | 1.4e-55 | |
| UNIPROTKB|F1RNX7 | 422 | NR2F1 "Uncharacterized protein | 0.447 | 0.312 | 0.838 | 1.4e-55 | |
| MGI|MGI:1352451 | 422 | Nr2f1 "nuclear receptor subfam | 0.447 | 0.312 | 0.838 | 1.4e-55 | |
| UNIPROTKB|F2Z3S9 | 420 | Nr2f1 "Protein Nr2f1" [Rattus | 0.447 | 0.314 | 0.838 | 1.4e-55 | |
| UNIPROTKB|F1NAB6 | 281 | LOC100859519 "Uncharacterized | 0.396 | 0.416 | 0.931 | 2.3e-55 | |
| UNIPROTKB|F1NGT1 | 267 | LOC100859519 "Uncharacterized | 0.396 | 0.438 | 0.931 | 2.3e-55 |
| FB|FBgn0003651 svp "seven up" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 596 (214.9 bits), Expect = 4.8e-60, Sum P(2) = 4.8e-60
Identities = 116/119 (97%), Positives = 119/119 (100%)
Query: 1 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 60
MGIDNICELAARLLFSAVEWA+NIPFFP+LQVTDQVALLRLVWSELFVLNASQCSMPLHV
Sbjct: 336 MGIDNICELAARLLFSAVEWAKNIPFFPELQVTDQVALLRLVWSELFVLNASQCSMPLHV 395
Query: 61 APLLAAAGLHASPMAADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTTGK 119
APLLAAAGLHASPMAADRVVAFMDHIR+FQEQVEKLKALHVDSAEYSCLKAIVLFTTGK
Sbjct: 396 APLLAAAGLHASPMAADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTTGK 454
|
|
| UNIPROTKB|A6QPQ9 NR2F1 "NR2F1 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N056 NR2F1 "COUP transcription factor 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9TTR8 NR2F1 "COUP transcription factor 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P10589 NR2F1 "COUP transcription factor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RNX7 NR2F1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1352451 Nr2f1 "nuclear receptor subfamily 2, group F, member 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z3S9 Nr2f1 "Protein Nr2f1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAB6 LOC100859519 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGT1 LOC100859519 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 2e-82 | |
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 5e-40 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 1e-37 | |
| cd06948 | 236 | cd06948, NR_LBD_COUP-TF, Ligand binding domain of | 1e-35 | |
| cd06157 | 168 | cd06157, NR_LBD, The ligand binding domain of nucl | 2e-30 | |
| cd06952 | 222 | cd06952, NR_LBD_TR2_like, The ligand binding domai | 1e-27 | |
| pfam00104 | 186 | pfam00104, Hormone_recep, Ligand-binding domain of | 2e-26 | |
| smart00430 | 163 | smart00430, HOLI, Ligand binding domain of hormone | 6e-23 | |
| cd06943 | 207 | cd06943, NR_LBD_RXR_like, The ligand binding domai | 2e-22 | |
| cd06931 | 222 | cd06931, NR_LBD_HNF4_like, The ligand binding doma | 9e-20 | |
| cd06944 | 237 | cd06944, NR_LBD_Ftz-F1_like, The ligand binding do | 2e-19 | |
| cd07069 | 241 | cd07069, NR_LBD_Lrh-1, The ligand binding domain o | 3e-15 | |
| cd07068 | 221 | cd07068, NR_LBD_ER_like, The ligand binding domain | 6e-14 | |
| cd07070 | 237 | cd07070, NR_LBD_SF-1, The ligand binding domain of | 4e-13 | |
| cd06946 | 221 | cd06946, NR_LBD_ERR, The ligand binding domain of | 2e-10 | |
| cd06949 | 235 | cd06949, NR_LBD_ER, Ligand binding domain of Estro | 2e-09 | |
| cd06951 | 222 | cd06951, NR_LBD_Dax1_like, The ligand binding doma | 4e-09 | |
| cd06953 | 213 | cd06953, NR_LBD_DHR4_like, The ligand binding doma | 4e-08 | |
| cd06950 | 206 | cd06950, NR_LBD_Tlx_PNR_like, The ligand binding d | 1e-06 | |
| cd06930 | 165 | cd06930, NR_LBD_F2, Ligand-binding domain of nucle | 4e-06 | |
| cd07350 | 232 | cd07350, NR_LBD_Dax1, The ligand binding domain of | 4e-06 | |
| cd07349 | 222 | cd07349, NR_LBD_SHP, The ligand binding domain of | 1e-05 | |
| cd06929 | 174 | cd06929, NR_LBD_F1, Ligand-binding domain of nucle | 2e-05 | |
| cd07076 | 247 | cd07076, NR_LBD_GR, Ligand binding domain of the g | 3e-05 | |
| cd07348 | 238 | cd07348, NR_LBD_NGFI-B, The ligand binding domain | 5e-05 | |
| cd07074 | 248 | cd07074, NR_LBD_PR, Ligand binding domain of the p | 9e-05 | |
| cd06947 | 246 | cd06947, NR_LBD_GR_Like, Ligand binding domain of | 1e-04 | |
| cd07073 | 246 | cd07073, NR_LBD_AR, Ligand binding domain of the n | 1e-04 | |
| cd06945 | 239 | cd06945, NR_LBD_Nurr1_like, The ligand binding dom | 2e-04 | |
| cd06944 | 237 | cd06944, NR_LBD_Ftz-F1_like, The ligand binding do | 4e-04 | |
| cd06157 | 168 | cd06157, NR_LBD, The ligand binding domain of nucl | 5e-04 | |
| cd06952 | 222 | cd06952, NR_LBD_TR2_like, The ligand binding domai | 0.001 | |
| cd06938 | 231 | cd06938, NR_LBD_EcR, The ligand binding domain (LB | 0.003 |
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
Score = 247 bits (633), Expect = 2e-82
Identities = 110/117 (94%), Positives = 115/117 (98%)
Query: 1 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 60
MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRL WSELFVLNA+QC MPLHV
Sbjct: 30 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLSWSELFVLNAAQCCMPLHV 89
Query: 61 APLLAAAGLHASPMAADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTT 117
APLLAAAGLHASPM+ADRVVAFMDHIR+FQEQVEKLKALHVDSAE+SCLKAIVLFT+
Sbjct: 90 APLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEFSCLKAIVLFTS 146
|
The ligand binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs): COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. In mammals two isoforms named COUP-TFI and COUP-TFII have been identified. Both genes show an exceptional homology and overlapping expression patterns, suggesting that they may serve redundant functions. Although COUP-TF was originally characterized as a transcriptional activator of the chicken ovalbumin gene, COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone receptors, such as retinoic acid receptor (RAR), thyroid hormone receptor (TR), vitamin D receptor (VDR), peroxisome proliferator activated receptor (PPAR), and hepatocyte nuclear factor 4 (HNF4). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, COUP-TFs have a central well cons erved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). Length = 236 |
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132746 cd06948, NR_LBD_COUP-TF, Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >gnl|CDD|215719 pfam00104, Hormone_recep, Ligand-binding domain of nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|214658 smart00430, HOLI, Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132741 cd06943, NR_LBD_RXR_like, The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132729 cd06931, NR_LBD_HNF4_like, The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132754 cd07069, NR_LBD_Lrh-1, The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >gnl|CDD|132753 cd07068, NR_LBD_ER_like, The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132755 cd07070, NR_LBD_SF-1, The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132744 cd06946, NR_LBD_ERR, The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132747 cd06949, NR_LBD_ER, Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >gnl|CDD|132749 cd06951, NR_LBD_Dax1_like, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132751 cd06953, NR_LBD_DHR4_like, The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >gnl|CDD|132748 cd06950, NR_LBD_Tlx_PNR_like, The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132728 cd06930, NR_LBD_F2, Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132764 cd07350, NR_LBD_Dax1, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132763 cd07349, NR_LBD_SHP, The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|132727 cd06929, NR_LBD_F1, Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132761 cd07076, NR_LBD_GR, Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132762 cd07348, NR_LBD_NGFI-B, The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132759 cd07074, NR_LBD_PR, Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132745 cd06947, NR_LBD_GR_Like, Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >gnl|CDD|132758 cd07073, NR_LBD_AR, Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >gnl|CDD|132743 cd06945, NR_LBD_Nurr1_like, The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|132742 cd06944, NR_LBD_Ftz-F1_like, The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132726 cd06157, NR_LBD, The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >gnl|CDD|132750 cd06952, NR_LBD_TR2_like, The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >gnl|CDD|132736 cd06938, NR_LBD_EcR, The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 100.0 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 100.0 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 100.0 | |
| cd07349 | 222 | NR_LBD_SHP The ligand binding domain of DAX1 prote | 100.0 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 100.0 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 100.0 | |
| cd06951 | 222 | NR_LBD_Dax1_like The ligand binding domain of DAX1 | 100.0 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 100.0 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 100.0 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 100.0 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 100.0 | |
| cd07350 | 232 | NR_LBD_Dax1 The ligand binding domain of DAX1 prot | 100.0 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 100.0 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 100.0 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 100.0 | |
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.98 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.98 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.98 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 99.98 | |
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.98 | |
| cd06940 | 189 | NR_LBD_REV_ERB The ligand binding domain of REV-ER | 99.97 | |
| cd06941 | 195 | NR_LBD_DmE78_like The ligand binding domain of Dro | 99.97 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.97 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 99.97 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 99.97 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 99.97 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 99.97 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 99.97 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 99.97 | |
| cd06952 | 222 | NR_LBD_TR2_like The ligand binding domain of the o | 99.97 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 99.97 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 99.97 | |
| cd06942 | 191 | NR_LBD_Sex_1_like The ligand binding domain of Cae | 99.97 | |
| cd06930 | 165 | NR_LBD_F2 Ligand-binding domain of nuclear recepto | 99.96 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 99.96 | |
| cd06929 | 174 | NR_LBD_F1 Ligand-binding domain of nuclear recepto | 99.96 | |
| KOG4215|consensus | 432 | 99.96 | ||
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 99.96 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 99.95 | |
| cd06157 | 168 | NR_LBD The ligand binding domain of nuclear recept | 99.9 | |
| smart00430 | 163 | HOLI Ligand binding domain of hormone receptors. | 99.88 | |
| PF00104 | 203 | Hormone_recep: Ligand-binding domain of nuclear ho | 99.87 | |
| KOG4218|consensus | 475 | 99.8 | ||
| KOG4215|consensus | 432 | 99.74 | ||
| KOG4217|consensus | 605 | 99.67 | ||
| KOG4216|consensus | 479 | 99.6 | ||
| KOG4217|consensus | 605 | 99.53 | ||
| cd07076 | 247 | NR_LBD_GR Ligand binding domain of the glucocortic | 99.41 | |
| cd07075 | 248 | NR_LBD_MR Ligand binding domain of the mineralocor | 99.31 | |
| KOG4216|consensus | 479 | 99.31 | ||
| cd07074 | 248 | NR_LBD_PR Ligand binding domain of the progesteron | 99.3 | |
| cd06949 | 235 | NR_LBD_ER Ligand binding domain of Estrogen recept | 99.29 | |
| cd07073 | 246 | NR_LBD_AR Ligand binding domain of the nuclear rec | 99.28 | |
| KOG4218|consensus | 475 | 99.27 | ||
| cd06947 | 246 | NR_LBD_GR_Like Ligand binding domain of nuclear ho | 99.27 | |
| cd06948 | 236 | NR_LBD_COUP-TF Ligand binding domain of chicken ov | 99.09 | |
| cd07072 | 239 | NR_LBD_DHR38_like Ligand binding domain of DHR38_l | 99.05 | |
| cd06945 | 239 | NR_LBD_Nurr1_like The ligand binding domain of Nur | 99.02 | |
| cd06933 | 238 | NR_LBD_VDR The ligand binding domain of vitamin D | 99.01 | |
| cd07348 | 238 | NR_LBD_NGFI-B The ligand binding domain of Nurr1, | 99.0 | |
| cd07071 | 238 | NR_LBD_Nurr1 The ligand binding domain of Nurr1, a | 98.96 | |
| cd06946 | 221 | NR_LBD_ERR The ligand binding domain of estrogen r | 98.96 | |
| cd07070 | 237 | NR_LBD_SF-1 The ligand binding domain of nuclear r | 98.89 | |
| cd06950 | 206 | NR_LBD_Tlx_PNR_like The ligand binding domain of T | 98.87 | |
| cd07069 | 241 | NR_LBD_Lrh-1 The ligand binding domain of the live | 98.85 | |
| cd06953 | 213 | NR_LBD_DHR4_like The ligand binding domain of orph | 98.84 | |
| cd06937 | 231 | NR_LBD_RAR The ligand binding domain (LBD) of reti | 98.84 | |
| cd06935 | 243 | NR_LBD_TR The ligand binding domain of thyroid hor | 98.77 | |
| cd06931 | 222 | NR_LBD_HNF4_like The ligand binding domain of hept | 98.77 | |
| cd06934 | 226 | NR_LBD_PXR_like The ligand binding domain of xenob | 98.75 | |
| cd07068 | 221 | NR_LBD_ER_like The ligand binding domain of estrog | 98.73 | |
| cd06944 | 237 | NR_LBD_Ftz-F1_like The ligand binding domain of FT | 98.66 | |
| cd06939 | 241 | NR_LBD_ROR_like The ligand binding domain of Retin | 98.63 | |
| cd06943 | 207 | NR_LBD_RXR_like The ligand binding domain of the r | 98.59 | |
| cd06954 | 236 | NR_LBD_LXR The ligand binding domain of Liver X re | 98.58 | |
| cd06936 | 221 | NR_LBD_Fxr The ligand binding domain of Farnesoid | 98.44 | |
| cd06932 | 259 | NR_LBD_PPAR The ligand binding domain of peroxisom | 98.44 | |
| KOG4846|consensus | 538 | 98.37 | ||
| cd06938 | 231 | NR_LBD_EcR The ligand binding domain (LBD) of the | 98.37 | |
| cd07166 | 89 | NR_DBD_REV_ERB DNA-binding domain of REV-ERB recep | 97.83 | |
| cd07164 | 78 | NR_DBD_PNR_like_1 DNA-binding domain of the photor | 97.83 | |
| cd06961 | 85 | NR_DBD_TR DNA-binding domain of thyroid hormone re | 97.82 | |
| cd07171 | 82 | NR_DBD_ER DNA-binding domain of estrogen receptors | 97.8 | |
| cd06957 | 82 | NR_DBD_PNR_like_2 DNA-binding domain of the photor | 97.79 | |
| cd06964 | 85 | NR_DBD_RAR DNA-binding domain of retinoic acid rec | 97.78 | |
| cd07165 | 81 | NR_DBD_DmE78_like DNA-binding domain of Drosophila | 97.77 | |
| cd07155 | 75 | NR_DBD_ER_like DNA-binding domain of estrogen rece | 97.75 | |
| cd06956 | 77 | NR_DBD_RXR DNA-binding domain of retinoid X recept | 97.74 | |
| cd06967 | 87 | NR_DBD_TR2_like DNA-binding domain of the TR2 and | 97.72 | |
| cd06968 | 95 | NR_DBD_ROR DNA-binding domain of Retinoid-related | 97.7 | |
| cd07170 | 97 | NR_DBD_ERR DNA-binding domain of estrogen related | 97.69 | |
| cd07158 | 73 | NR_DBD_Ppar_like The DNA-binding domain of peroxis | 97.63 | |
| cd07168 | 90 | NR_DBD_DHR4_like DNA-binding domain of ecdysone-in | 97.63 | |
| cd07157 | 86 | 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of | 97.63 | |
| cd07167 | 93 | NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 | 97.62 | |
| cd07179 | 74 | 2DBD_NR_DBD2 The second DNA-binding domain (DBD) o | 97.62 | |
| cd06960 | 76 | NR_DBD_HNF4A DNA-binding domain of heptocyte nucle | 97.61 | |
| cd07160 | 101 | NR_DBD_LXR DNA-binding domain of Liver X receptors | 97.61 | |
| cd06963 | 73 | NR_DBD_GR_like The DNA binding domain of GR_like n | 97.61 | |
| cd06970 | 92 | NR_DBD_PNR DNA-binding domain of the photoreceptor | 97.59 | |
| cd06969 | 75 | NR_DBD_NGFI-B DNA-binding domain of the orphan nuc | 97.59 | |
| cd07163 | 92 | NR_DBD_TLX DNA-binding domain of Tailless (TLX) is | 97.59 | |
| cd07156 | 72 | NR_DBD_VDR_like The DNA-binding domain of vitamin | 97.58 | |
| cd07169 | 90 | NR_DBD_GCNF_like DNA-binding domain of Germ cell n | 97.58 | |
| cd06958 | 73 | NR_DBD_COUP_TF DNA-binding domain of chicken ovalb | 97.56 | |
| cd06962 | 84 | NR_DBD_FXR DNA-binding domain of Farnesoid X recep | 97.55 | |
| cd07161 | 91 | NR_DBD_EcR DNA-binding domain of Ecdysone receptor | 97.53 | |
| cd06916 | 72 | NR_DBD_like DNA-binding domain of nuclear receptor | 97.53 | |
| cd06966 | 94 | NR_DBD_CAR DNA-binding domain of constitutive andr | 97.52 | |
| cd07173 | 82 | NR_DBD_AR DNA-binding domain of androgen receptor | 97.5 | |
| cd06959 | 73 | NR_DBD_EcR_like The DNA-binding domain of Ecdysone | 97.48 | |
| cd07154 | 73 | NR_DBD_PNR_like The DNA-binding domain of the phot | 97.48 | |
| cd07172 | 78 | NR_DBD_GR_PR DNA-binding domain of glucocorticoid | 97.37 | |
| cd07162 | 87 | NR_DBD_PXR DNA-binding domain of pregnane X recept | 97.36 | |
| cd06955 | 107 | NR_DBD_VDR DNA-binding domain of vitamin D recepto | 97.32 | |
| smart00399 | 70 | ZnF_C4 c4 zinc finger in nuclear hormone receptors | 97.2 | |
| cd06965 | 84 | NR_DBD_Ppar DNA-binding domain of peroxisome proli | 97.11 | |
| PF00105 | 70 | zf-C4: Zinc finger, C4 type (two domains); InterPr | 96.52 | |
| KOG4846|consensus | 538 | 94.44 |
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.6e-34 Score=244.43 Aligned_cols=174 Identities=22% Similarity=0.305 Sum_probs=146.2
Q ss_pred HHHHHHHHHHHHHHHHhHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHHhhHhhcCCCCc-ceeecCCcccChhhHHHHHH
Q psy1615 3 IDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHVA-PLLAAAGLHASPMAADRVVA 81 (295)
Q Consensus 3 ~~~~~~~~~~~l~~~v~waK~lp~F~~L~~~Dq~~LLk~~~~e~~~L~~a~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~ 81 (295)
++.+|+++++.++.+|+|||++|+|.+|+.+||++|||++|.|+++++.|||+++.... .+++.+|........ ...+
T Consensus 30 ~~~l~~la~r~L~~~VeWAK~IPgF~~L~l~DQi~LLk~sW~Ellvl~~a~rs~~~~~~~~l~fa~~~~~~~~~~-~~~~ 108 (247)
T cd07076 30 MSTLNMLGGRQVVAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSNGNLLCFAPDLIINEQRM-TLPC 108 (247)
T ss_pred HHHHHHHHHHHHHHHHHHHhcCCCcccCCHHHHHHHHHHhHHHHHHHHHHHhccCCCCCceEEecCCeeecHHHH-hhhh
Confidence 57899999999999999999999999999999999999999999999999999987655 367777777665443 4455
Q ss_pred HHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHhccC-CcccccccchhHHHHHHHHHHHHHH---Hhh--CCCCCC---c
Q psy1615 82 FMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTT-GKRIFTGVLLKALHVDSAEYSCLKA---IVL--FTTGKR---M 152 (295)
Q Consensus 82 ~~~~~~~l~~~~~~l~~L~ld~~E~~lLkai~L~~p-d~~~l~~~l~~~~~i~~~q~~~l~~---l~~--~~~~~~---R 152 (295)
+.+.++.+.+++.+|++|++|++||+|||||+|||| |++ |+++...|+++|++++.+ |+. +++.|. |
T Consensus 109 ~~~~~~~l~e~~~~~r~L~ld~~EfacLKAIvLfnp~d~~----GL~~~~~Ve~lqe~~~~aL~~yi~~~~p~~~~~~~R 184 (247)
T cd07076 109 MYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSTVPKD----GLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQR 184 (247)
T ss_pred HHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHhCCCCCCC----CCCCHHHHHHHHHHHHHHHHHHHHhcCCCcchhhhH
Confidence 666667889999999999999999999999999999 999 899999999999998555 444 565555 9
Q ss_pred ccccccccc-----------hhhhhhcCCCccchhhhhhh
Q psy1615 153 FGKPLPLNQ-----------HYTATISNVPLSSSLSTAVQ 181 (295)
Q Consensus 153 f~~lLl~~~-----------y~~r~~~~c~id~l~r~~~q 181 (295)
||+||++++ ++.+++++.++...+.+++-
T Consensus 185 F~kLLllLp~Lr~i~~~~~ef~~~~~~~~~~~~~~~~ml~ 224 (247)
T cd07076 185 FYQLTKLLDSMHEVVENLLNFCFQTFLDKTMSIEFPEMLA 224 (247)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcccchhhhhHHHHH
Confidence 999888874 23466777777777777754
|
The ligand binding domain of the glucocorticoid receptor (GR): GR is a ligand-activated transcription factor belonging to the nuclear receptor superfamily. It binds with high affinity to cortisol and other glucocorticoids. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. In the absence of hormone, the glucocorticoid receptor (GR) is complexes with a variety of heat shock proteins in the cytosol. The binding of the glucocorticoids results in release of the heat shock proteins and transforms it to its active state. One mechanism of action of GR is by direct activation of gene transcription. The activated form of GR forms dimers, translocates into the nucleus, and binds to specific hormone responsive elements, activating gene transcription |
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd07349 NR_LBD_SHP The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06951 NR_LBD_Dax1_like The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07350 NR_LBD_Dax1 The ligand binding domain of DAX1 protein, a nuclear receptor lacking DNA binding domain | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd06940 NR_LBD_REV_ERB The ligand binding domain of REV-ERB receptors, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06941 NR_LBD_DmE78_like The ligand binding domain of Drosophila ecdysone-induced protein 78, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06952 NR_LBD_TR2_like The ligand binding domain of the orphan nuclear receptors TR4 and TR2 | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06942 NR_LBD_Sex_1_like The ligand binding domain of Caenorhabditis elegans nuclear hormone receptor Sex-1 protein | Back alignment and domain information |
|---|
| >cd06930 NR_LBD_F2 Ligand-binding domain of nuclear receptor family 2 | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >cd06929 NR_LBD_F1 Ligand-binding domain of nuclear receptor family 1 | Back alignment and domain information |
|---|
| >KOG4215|consensus | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd06157 NR_LBD The ligand binding domain of nuclear receptors, a family of ligand-activated transcription regulators | Back alignment and domain information |
|---|
| >smart00430 HOLI Ligand binding domain of hormone receptors | Back alignment and domain information |
|---|
| >PF00104 Hormone_recep: Ligand-binding domain of nuclear hormone receptor; InterPro: IPR000536 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >KOG4215|consensus | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >KOG4217|consensus | Back alignment and domain information |
|---|
| >cd07076 NR_LBD_GR Ligand binding domain of the glucocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07075 NR_LBD_MR Ligand binding domain of the mineralocorticoid receptor, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >KOG4216|consensus | Back alignment and domain information |
|---|
| >cd07074 NR_LBD_PR Ligand binding domain of the progesterone receptor, a member of the nuclear hormone receptor | Back alignment and domain information |
|---|
| >cd06949 NR_LBD_ER Ligand binding domain of Estrogen receptor, which are activated by the hormone 17beta-estradiol (estrogen) | Back alignment and domain information |
|---|
| >cd07073 NR_LBD_AR Ligand binding domain of the nuclear receptor androgen receptor, ligand activated transcription regulator | Back alignment and domain information |
|---|
| >KOG4218|consensus | Back alignment and domain information |
|---|
| >cd06947 NR_LBD_GR_Like Ligand binding domain of nuclear hormone receptors:glucocorticoid receptor, mineralocorticoid receptor , progesterone receptor, and androgen receptor | Back alignment and domain information |
|---|
| >cd06948 NR_LBD_COUP-TF Ligand binding domain of chicken ovalbumin upstream promoter transcription factors, a member of the nuclear receptor family | Back alignment and domain information |
|---|
| >cd07072 NR_LBD_DHR38_like Ligand binding domain of DHR38_like proteins, members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06945 NR_LBD_Nurr1_like The ligand binding domain of Nurr1 and related nuclear receptor proteins, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06933 NR_LBD_VDR The ligand binding domain of vitamin D receptors, a member of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd07348 NR_LBD_NGFI-B The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd07071 NR_LBD_Nurr1 The ligand binding domain of Nurr1, a member of conserved family of nuclear receptors | Back alignment and domain information |
|---|
| >cd06946 NR_LBD_ERR The ligand binding domain of estrogen receptor-related nuclear receptors | Back alignment and domain information |
|---|
| >cd07070 NR_LBD_SF-1 The ligand binding domain of nuclear receptor steroidogenic factor 1, a member of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06950 NR_LBD_Tlx_PNR_like The ligand binding domain of Tailless-like proteins, orphan nuclear receptors | Back alignment and domain information |
|---|
| >cd07069 NR_LBD_Lrh-1 The ligand binding domain of the liver receptor homolog-1, a member of nuclear receptor superfamily, | Back alignment and domain information |
|---|
| >cd06953 NR_LBD_DHR4_like The ligand binding domain of orphan nuclear receptor Ecdysone-induced receptor DHR4 | Back alignment and domain information |
|---|
| >cd06937 NR_LBD_RAR The ligand binding domain (LBD) of retinoic acid receptor (RAR), a members of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06935 NR_LBD_TR The ligand binding domain of thyroid hormone receptor, a members of a superfamily of nuclear receptors | Back alignment and domain information |
|---|
| >cd06931 NR_LBD_HNF4_like The ligand binding domain of heptocyte nuclear factor 4, which is explosively expanded in nematodes | Back alignment and domain information |
|---|
| >cd06934 NR_LBD_PXR_like The ligand binding domain of xenobiotic receptors:pregnane X receptor and constitutive androstane receptor | Back alignment and domain information |
|---|
| >cd07068 NR_LBD_ER_like The ligand binding domain of estrogen receptor and estrogen receptor-related receptors | Back alignment and domain information |
|---|
| >cd06944 NR_LBD_Ftz-F1_like The ligand binding domain of FTZ-F1 like nuclear receptors | Back alignment and domain information |
|---|
| >cd06939 NR_LBD_ROR_like The ligand binding domain of Retinoid-related orphan receptors, of the nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06943 NR_LBD_RXR_like The ligand binding domain of the retinoid X receptor and Ultraspiracle, members of nuclear receptor superfamily | Back alignment and domain information |
|---|
| >cd06954 NR_LBD_LXR The ligand binding domain of Liver X receptors, a family of nuclear receptors of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06936 NR_LBD_Fxr The ligand binding domain of Farnesoid X receptor:a member of the nuclear receptor superfamily of ligand-activated transcription factors | Back alignment and domain information |
|---|
| >cd06932 NR_LBD_PPAR The ligand binding domain of peroxisome proliferator-activated receptors | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
| >cd06938 NR_LBD_EcR The ligand binding domain (LBD) of the Ecdysone receptor, a member of the nuclear receptors super family | Back alignment and domain information |
|---|
| >cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family | Back alignment and domain information |
|---|
| >cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B | Back alignment and domain information |
|---|
| >cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family | Back alignment and domain information |
|---|
| >cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors | Back alignment and domain information |
|---|
| >cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers | Back alignment and domain information |
|---|
| >PF00105 zf-C4: Zinc finger, C4 type (two domains); InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis | Back alignment and domain information |
|---|
| >KOG4846|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 295 | ||||
| 3cjw_A | 244 | Crystal Structure Of The Human Coup-Tfii Ligand Bin | 2e-61 | ||
| 3cjw_A | 244 | Crystal Structure Of The Human Coup-Tfii Ligand Bin | 6e-23 | ||
| 3p0u_A | 249 | Crystal Structure Of The Ligand Binding Domain Of H | 2e-17 | ||
| 2gl8_A | 241 | Human Retinoic Acid Receptor Rxr-Gamma Ligand-Bindi | 3e-17 | ||
| 1dkf_A | 233 | Crystal Structure Of A Heterodimeric Complex Of Rar | 9e-17 | ||
| 3dzu_A | 467 | Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Comp | 1e-16 | ||
| 1lbd_A | 282 | Ligand-Binding Domain Of The Human Nuclear Receptor | 3e-16 | ||
| 3e94_A | 244 | Crystal Structure Of Rxralpha Ligand Binding Domain | 4e-16 | ||
| 3uvv_B | 244 | Crystal Structure Of The Ligand Binding Domains Of | 4e-16 | ||
| 1rdt_A | 242 | Crystal Structure Of A New Rexinoid Bound To The Rx | 4e-16 | ||
| 3a9e_A | 240 | Crystal Structure Of A Mixed Agonist-Bound Rar-Alph | 5e-16 | ||
| 1mv9_A | 240 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 5e-16 | ||
| 1xdk_A | 238 | Crystal Structure Of The RarbetaRXRALPHA LIGAND BIN | 5e-16 | ||
| 1xv9_A | 236 | Crystal Structure Of CarRXR HETERODIMER BOUND WITH | 5e-16 | ||
| 1fby_A | 239 | Crystal Structure Of The Human Rxr Alpha Ligand Bin | 5e-16 | ||
| 1fm6_A | 238 | The 2.1 Angstrom Resolution Crystal Structure Of Th | 5e-16 | ||
| 1xls_A | 232 | Crystal Structure Of The Mouse CarRXR LBD HETERODIM | 6e-16 | ||
| 3pcu_A | 230 | Crystal Structure Of Human Retinoic X Receptor Alph | 6e-16 | ||
| 3oap_A | 231 | Crystal Structure Of Human Retinoid X Receptor Alph | 6e-16 | ||
| 3h0a_A | 228 | Crystal Structure Of Peroxisome Proliferator-Activa | 6e-16 | ||
| 1xiu_A | 230 | Crystal Structure Of The Agonist-Bound Ligand-Bindi | 7e-16 | ||
| 3eyb_A | 219 | Structural And Functional Insights Into The Ligand | 8e-16 | ||
| 1h9u_A | 224 | The Structure Of The Human Retinoid-X-Receptor Beta | 1e-15 | ||
| 1uhl_A | 236 | Crystal Structure Of The Lxralfa-Rxrbeta Lbd Hetero | 2e-15 | ||
| 2q60_A | 258 | Crystal Structure Of The Ligand Binding Domain Of P | 6e-15 | ||
| 1z5x_U | 262 | Hemipteran Ecdysone Receptor Ligand-Binding Domain | 3e-14 | ||
| 2nxx_A | 235 | Crystal Structure Of The Ligand-Binding Domains Of | 1e-13 | ||
| 1zh7_A | 243 | Structural And Biochemical Basis For Selective Repr | 3e-13 | ||
| 1pk5_A | 248 | Crystal Structure Of The Orphan Nuclear Receptor Lr | 3e-13 | ||
| 3tx7_B | 352 | Crystal Structure Of Lrh-1BETA-Catenin Complex Leng | 2e-11 | ||
| 3plz_A | 257 | Human Lrh1 Lbd Bound To Gr470 Length = 257 | 2e-11 | ||
| 1yuc_A | 255 | Human Nuclear Receptor Liver Receptor Homologue-1, | 2e-11 | ||
| 1yok_A | 256 | Crystal Structure Of Human Lrh-1 Bound With Tif-2 P | 2e-11 | ||
| 1zdu_A | 245 | The Crystal Structure Of Human Liver Receptor Homol | 3e-11 | ||
| 4dos_A | 242 | Human Nuclear Receptor Liver Receptor Homologue-1, | 3e-11 | ||
| 1m7w_A | 250 | Hnf4a Ligand Binding Domain With Bound Fatty Acid L | 6e-11 | ||
| 1lv2_A | 229 | Hepatocyte Nuclear Factor 4 Is A Transcription Fact | 3e-10 | ||
| 1pzl_A | 237 | Crystal Structure Of Hnf4a Lbd In Complex With The | 2e-09 | ||
| 3fs1_A | 230 | Crystal Structure Of Hnf4a Lbd In Complex With The | 2e-09 | ||
| 2ocf_A | 298 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 5e-09 | ||
| 2jfa_B | 252 | Estrogen Receptor Alpha Lbd In Complex With An Affi | 6e-09 | ||
| 3uu7_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 7e-09 | ||
| 3q97_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 7e-09 | ||
| 3q95_B | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 7e-09 | ||
| 1zky_A | 257 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 7e-09 | ||
| 3uu7_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 7e-09 | ||
| 2xhs_A | 245 | Crystal Structure Of The Ligand Binding Domain Of F | 8e-09 | ||
| 3d24_A | 253 | Crystal Structure Of Ligand-Binding Domain Of Estro | 8e-09 | ||
| 1r1k_A | 263 | Crystal Structure Of The Ligand-Binding Domains Of | 8e-09 | ||
| 3hm1_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 9e-09 | ||
| 1g2n_A | 264 | Crystal Structure Of The Ligand Binding Domain Of T | 1e-08 | ||
| 1xb7_A | 247 | X-Ray Structure Of Erralpha Lbd In Complex With A P | 1e-08 | ||
| 1l2i_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 1e-08 | ||
| 3k6p_A | 248 | Estrogen Related Receptor Alpha In Complex With An | 1e-08 | ||
| 2bj4_A | 252 | Estrogen Receptor Alpha Lbd In Complex With A Phage | 1e-08 | ||
| 1uom_A | 254 | The Structure Of Estrogen Receptor In Complex With | 1e-08 | ||
| 1pcg_A | 244 | Helix-Stabilized Cyclic Peptides As Selective Inhib | 1e-08 | ||
| 1qkt_A | 248 | Mutant Estrogen Nuclear Receptor Ligand Binding Dom | 1e-08 | ||
| 2yat_A | 252 | Crystal Structure Of Estradiol Derived Metal Chelat | 2e-08 | ||
| 1ymt_A | 246 | Mouse Sf-1 Lbd Length = 246 | 2e-08 | ||
| 3uua_A | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 2e-08 | ||
| 1hg4_A | 279 | Ultraspiracle Ligand Binding Domain From Drosophila | 2e-08 | ||
| 1err_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 2e-08 | ||
| 2qzo_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-08 | ||
| 2qa8_B | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-08 | ||
| 3q95_A | 260 | Crystal Structure Of Human Estrogen Receptor Alpha | 2e-08 | ||
| 3uuc_A | 251 | Crystal Structure Of Hera-Lbd (Wt) In Complex With | 2e-08 | ||
| 3uua_B | 251 | Crystal Structure Of Hera-Lbd (Y537s) In Complex Wi | 2e-08 | ||
| 1yp0_A | 239 | Structure Of The Steroidogenic Factor-1 Ligand Bind | 2e-08 | ||
| 3os8_A | 258 | Estrogen Receptor Length = 258 | 2e-08 | ||
| 3dt3_A | 255 | Human Estrogen Receptor Alpha Lbd With Gw368 Length | 2e-08 | ||
| 2p15_A | 258 | Crystal Structure Of The Er Alpha Ligand Binding Do | 2e-08 | ||
| 2qxs_A | 258 | Crystal Structure Of Antagonizing Mutant 536s Of Th | 2e-08 | ||
| 2qa8_A | 258 | Crystal Structure Of The Estrogen Receptor Alpha Li | 2e-08 | ||
| 2iog_A | 246 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 2e-08 | ||
| 1ere_A | 253 | Human Estrogen Receptor Ligand-Binding Domain In Co | 2e-08 | ||
| 3erd_A | 261 | Human Estrogen Receptor Alpha Ligand-Binding Domain | 3e-08 | ||
| 1g50_A | 247 | Crystal Structure Of A Wild Type Her Alpha Lbd At 2 | 3e-08 | ||
| 1sj0_A | 248 | Human Estrogen Receptor Alpha Ligand-binding Domain | 3e-08 | ||
| 1gwq_A | 248 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 3e-08 | ||
| 2iok_A | 254 | Human Estrogen Receptor Alpha Ligand-binding Domain | 3e-08 | ||
| 1a52_A | 258 | Estrogen Receptor Alpha Ligand-Binding Domain Compl | 3e-08 | ||
| 1qku_A | 250 | Wild Type Estrogen Nuclear Receptor Ligand Binding | 3e-08 | ||
| 3l03_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 3e-08 | ||
| 4dma_A | 247 | Crystal Structure Of Era Lbd In Complex With Ru1001 | 3e-08 | ||
| 3hlv_A | 253 | Crystal Structure Of Human Estrogen Receptor Alpha | 3e-08 | ||
| 1gwr_A | 245 | Human Oestrogen Receptor Alpha Ligand-Binding Domai | 3e-08 | ||
| 1x7e_A | 245 | Crystal Structure Of Estrogen Receptor Alpha Comple | 4e-08 | ||
| 3os8_C | 258 | Estrogen Receptor Length = 258 | 5e-08 | ||
| 2pjl_A | 247 | Crystal Structure Of Human Estrogen-Related Recepto | 1e-07 | ||
| 1vjb_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 3e-07 | ||
| 1s9q_A | 251 | Crystal Structure Of The Ligand-Binding Domain Of T | 3e-07 | ||
| 3f7d_A | 244 | Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | 4e-07 | ||
| 2e2r_A | 244 | Crystal Structure Of Human Estrogen-Related Recepto | 4e-07 | ||
| 1s9p_A | 227 | Crystal Structure Of The Ligand-Binding Domain Of T | 5e-07 | ||
| 2ewp_A | 226 | Crystal Structure Of Estrogen Related Receptor-3 (E | 5e-07 | ||
| 1kv6_A | 230 | X-Ray Structure Of The Orphan Nuclear Receptor Err3 | 5e-07 | ||
| 3ltx_A | 243 | Crystal Structure Of The Pacific Oyster Estrogen Re | 6e-06 | ||
| 1yow_A | 242 | Human Steroidogenic Factor 1 Lbd With Bound Co-Fact | 3e-05 | ||
| 2fsz_A | 246 | A Second Binding Site For Hydroxytamoxifen Within T | 4e-05 | ||
| 1l2j_A | 271 | Human Estrogen Receptor Beta Ligand-Binding Domain | 4e-05 | ||
| 1yy4_A | 268 | Crystal Structure Of Estrogen Receptor Beta Complex | 4e-05 | ||
| 1zdt_A | 241 | The Crystal Structure Of Human Steroidogenic Factor | 4e-05 | ||
| 1i37_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 4e-05 | ||
| 2q7k_A | 257 | The Androgen Receptor Prostate Cancer Mutant H874y | 4e-05 | ||
| 2am9_A | 266 | Crystal Structure Of Human Androgen Receptor Ligand | 5e-05 | ||
| 1i38_A | 260 | Crystal Structure Of The Rat Androgen Receptor Liga | 5e-05 | ||
| 2ax9_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 5e-05 | ||
| 1xj7_A | 257 | Complex Androgen Receptor Lbd And Rac3 Peptide Leng | 5e-05 | ||
| 1t73_A | 269 | Crystal Structure Of The Androgen Receptor Ligand B | 5e-05 | ||
| 1e3g_A | 263 | Human Androgen Receptor Ligand Binding In Complex W | 5e-05 | ||
| 2ax6_A | 256 | Crystal Structure Of The Androgen Receptor Ligand B | 5e-05 | ||
| 2z4j_A | 248 | Crystal Structure Of Ar Lbd With Shp Peptide Nr Box | 5e-05 | ||
| 1xow_A | 249 | Crystal Structure Of The Human Androgen Receptor Li | 5e-05 | ||
| 3l3x_A | 250 | Crystal Structure Of Dht-Bound Androgen Receptor In | 5e-05 | ||
| 1t5z_A | 251 | Crystal Structure Of The Androgen Receptor Ligand B | 5e-05 | ||
| 1qkm_A | 255 | Human Oestrogen Receptor Beta Ligand-Binding Domain | 5e-05 | ||
| 3rlj_A | 247 | Crystal Structure Of The Androgen Receptor Ligand B | 5e-05 | ||
| 2oz7_A | 249 | Crystal Structure Of The Human Androgen Receptor T8 | 6e-05 | ||
| 2hvc_A | 250 | The Crystal Structure Of Ligand-Binding Domain (Lbd | 6e-05 | ||
| 3rll_A | 247 | Crystal Structure Of The T877a Androgen Receptor Li | 6e-05 | ||
| 2i0g_A | 257 | Benzopyrans Are Selective Estrogen Receptor Beta Ag | 6e-05 | ||
| 1gs4_A | 248 | Structural Basis For The Glucocorticoid Response In | 7e-05 | ||
| 1zaf_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 7e-05 | ||
| 1u9e_A | 241 | Crystal Structure Of Estrogen Receptor Beta Complex | 7e-05 | ||
| 2yly_A | 240 | Sulfonamides As Selective Estrogen Receptor Beta Ag | 7e-05 | ||
| 2nv7_A | 238 | Crystal Structure Of Estrogen Receptor Beta Complex | 7e-05 | ||
| 1x76_A | 240 | Crystal Structure Of Estrogen Receptor Beta Complex | 8e-05 | ||
| 2giu_A | 241 | Human Estrogen Receptor Beta Ligand-Binding Domain | 8e-05 | ||
| 3oll_A | 240 | Crystal Structure Of Phosphorylated Estrogen Recept | 8e-05 | ||
| 1qkn_A | 255 | Rat Oestrogen Receptor Beta Ligand-Binding Domain I | 8e-05 | ||
| 1nde_A | 255 | Estrogen Receptor Beta With Selective Triazine Modu | 8e-05 | ||
| 2j7x_A | 255 | Structure Of Estradiol-bound Estrogen Receptor Beta | 8e-05 | ||
| 1sr7_A | 259 | Progesterone Receptor Hormone Binding Domain With B | 2e-04 | ||
| 3g8o_A | 263 | Progesterone Receptor With Bound Pyrrolidine 1 Leng | 2e-04 | ||
| 2w8y_A | 260 | Ru486 Bound To The Progesterone Receptor In A Desta | 2e-04 | ||
| 1e3k_A | 258 | Human Progesteron Receptor Ligand Binding Domain In | 2e-04 | ||
| 1sqn_A | 261 | Progesterone Receptor Ligand Binding Domain With Bo | 2e-04 | ||
| 1a28_A | 256 | Hormone-Bound Human Progesterone Receptor Ligand-Bi | 2e-04 | ||
| 3ry9_A | 250 | Crystal Structure Of The Resurrected Ancestral Gluc | 3e-04 | ||
| 3kba_A | 253 | Progesterone Receptor Bound To Sulfonamide Pyrrolid | 3e-04 | ||
| 2qw4_A | 273 | Human Nr4a1 Ligand-Binding Domain Length = 273 | 4e-04 | ||
| 1yje_A | 264 | Crystal Structure Of The Rngfi-B Ligand-Binding Dom | 5e-04 | ||
| 3mno_A | 261 | Crystal Structure Of The Agonist Form Of Mouse Gluc | 6e-04 | ||
| 4fne_A | 254 | X-Ray Crystal Structure Of The Ancestral 3-Keto Ste | 6e-04 | ||
| 1nhz_A | 280 | Crystal Structure Of The Antagonist Form Of Glucoco | 6e-04 | ||
| 3h52_A | 254 | Crystal Structure Of The Antagonist Form Of Human G | 7e-04 | ||
| 3v3e_B | 257 | Crystal Structure Of The Human Nur77 Ligand-Binding | 7e-04 |
| >pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 | Back alignment and structure |
|
| >pdb|3CJW|A Chain A, Crystal Structure Of The Human Coup-Tfii Ligand Binding Domain Length = 244 | Back alignment and structure |
| >pdb|3P0U|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Human Testicular Receptor 4 Length = 249 | Back alignment and structure |
| >pdb|2GL8|A Chain A, Human Retinoic Acid Receptor Rxr-Gamma Ligand-Binding Domain Length = 241 | Back alignment and structure |
| >pdb|1DKF|A Chain A, Crystal Structure Of A Heterodimeric Complex Of Rar And Rxr Ligand-Binding Domains Length = 233 | Back alignment and structure |
| >pdb|3DZU|A Chain A, Intact Ppar Gamma - Rxr Alpha Nuclear Receptor Complex On Dna Bound With Bvt.13, 9-Cis Retinoic Acid And Ncoa2 Peptide Length = 467 | Back alignment and structure |
| >pdb|1LBD|A Chain A, Ligand-Binding Domain Of The Human Nuclear Receptor Rxr-Alpha Length = 282 | Back alignment and structure |
| >pdb|3E94|A Chain A, Crystal Structure Of Rxralpha Ligand Binding Domain In Complex With Tributyltin And A Coactivator Fragment Length = 244 | Back alignment and structure |
| >pdb|3UVV|B Chain B, Crystal Structure Of The Ligand Binding Domains Of The Thyroid Receptor:retinoid X Receptor Complexed With 3,3',5 Triiodo-L- Thyronine And 9-Cis Retinoic Acid Length = 244 | Back alignment and structure |
| >pdb|1RDT|A Chain A, Crystal Structure Of A New Rexinoid Bound To The Rxralpha Ligand Binding Doamin In The RxralphaPPARGAMMA HETERODIMER Length = 242 | Back alignment and structure |
| >pdb|3A9E|A Chain A, Crystal Structure Of A Mixed Agonist-Bound Rar-Alpha And Antagonist- Bound Rxr-Alpha Heterodimer Ligand Binding Domains Length = 240 | Back alignment and structure |
| >pdb|1MV9|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To The Eicosanoid Dha (Docosa Hexaenoic Acid) And A Coactivator Peptide Length = 240 | Back alignment and structure |
| >pdb|1XDK|A Chain A, Crystal Structure Of The RarbetaRXRALPHA LIGAND BINDING Domain Heterodimer In Complex With 9-Cis Retinoic Acid And A Fragment Of The Trap220 Coactivator Length = 238 | Back alignment and structure |
| >pdb|1XV9|A Chain A, Crystal Structure Of CarRXR HETERODIMER BOUND WITH SRC1 Peptide, Fatty Acid, And 5b-Pregnane-3,20-Dione. Length = 236 | Back alignment and structure |
| >pdb|1FBY|A Chain A, Crystal Structure Of The Human Rxr Alpha Ligand Binding Domain Bound To 9-Cis Retinoic Acid Length = 239 | Back alignment and structure |
| >pdb|1FM6|A Chain A, The 2.1 Angstrom Resolution Crystal Structure Of The Heterodimer Of The Human Rxralpha And Ppargamma Ligand Binding Domains Respectively Bound With 9-Cis Retinoic Acid And Rosiglitazone And Co-Activator Peptides. Length = 238 | Back alignment and structure |
| >pdb|1XLS|A Chain A, Crystal Structure Of The Mouse CarRXR LBD HETERODIMER Bound To Tcpobop And 9cra And A Tif2 Peptide Containg The Third Lxxll Motifs Length = 232 | Back alignment and structure |
| >pdb|3PCU|A Chain A, Crystal Structure Of Human Retinoic X Receptor Alpha Ligand-Binding Domain Complexed With Lx0278 And Src1 Peptide Length = 230 | Back alignment and structure |
| >pdb|3OAP|A Chain A, Crystal Structure Of Human Retinoid X Receptor Alpha-Ligand Binding Domain Complex With 9-Cis Retinoic Acid And The Coactivator Peptide Grip-1 Length = 231 | Back alignment and structure |
| >pdb|3H0A|A Chain A, Crystal Structure Of Peroxisome Proliferator-Activated Receptor Gamma (Pparg) And Retinoic Acid Receptor Alpha (Rxra) In Complex With 9-Cis Retinoic Acid, Co-Activator Peptide, And A Partial Agonist Length = 228 | Back alignment and structure |
| >pdb|1XIU|A Chain A, Crystal Structure Of The Agonist-Bound Ligand-Binding Domain Of Biomphalaria Glabrata Rxr Length = 230 | Back alignment and structure |
| >pdb|3EYB|A Chain A, Structural And Functional Insights Into The Ligand Binding Domain Of A Non-Duplicated Rxr From The Invertebrate Chordate Amphioxus Length = 219 | Back alignment and structure |
| >pdb|1H9U|A Chain A, The Structure Of The Human Retinoid-X-Receptor Beta Ligand Binding Domain In Complex With The Specific Synthetic Agonist Lg100268 Length = 224 | Back alignment and structure |
| >pdb|1UHL|A Chain A, Crystal Structure Of The Lxralfa-Rxrbeta Lbd Heterodimer Length = 236 | Back alignment and structure |
| >pdb|2Q60|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Polyandrocarpa Misakiensis Rxr In Tetramer In Absence Of Ligand Length = 258 | Back alignment and structure |
| >pdb|1Z5X|U Chain U, Hemipteran Ecdysone Receptor Ligand-Binding Domain Complexed With Ponasterone A Length = 262 | Back alignment and structure |
| >pdb|2NXX|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The T.Castaneum (Coleoptera) Heterodimer Ecrusp Bound To Ponasterone A Length = 235 | Back alignment and structure |
| >pdb|1ZH7|A Chain A, Structural And Biochemical Basis For Selective Repression Of The Orphan Nuclear Receptor Lrh-1 By Shp Length = 243 | Back alignment and structure |
| >pdb|1PK5|A Chain A, Crystal Structure Of The Orphan Nuclear Receptor Lrh-1 Length = 248 | Back alignment and structure |
| >pdb|3TX7|B Chain B, Crystal Structure Of Lrh-1BETA-Catenin Complex Length = 352 | Back alignment and structure |
| >pdb|3PLZ|A Chain A, Human Lrh1 Lbd Bound To Gr470 Length = 257 | Back alignment and structure |
| >pdb|1YUC|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Phospholipid And A Fragment Of Human Shp Length = 255 | Back alignment and structure |
| >pdb|1YOK|A Chain A, Crystal Structure Of Human Lrh-1 Bound With Tif-2 Peptide And Phosphatidylglycerol Length = 256 | Back alignment and structure |
| >pdb|1ZDU|A Chain A, The Crystal Structure Of Human Liver Receptor Homologue-1 Length = 245 | Back alignment and structure |
| >pdb|4DOS|A Chain A, Human Nuclear Receptor Liver Receptor Homologue-1, Lrh-1, Bound To Dlpc And A Fragment Of Tif-2 Length = 242 | Back alignment and structure |
| >pdb|1M7W|A Chain A, Hnf4a Ligand Binding Domain With Bound Fatty Acid Length = 250 | Back alignment and structure |
| >pdb|1LV2|A Chain A, Hepatocyte Nuclear Factor 4 Is A Transcription Factor That Constitutively Binds Fatty Acids Length = 229 | Back alignment and structure |
| >pdb|1PZL|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Src-1 Peptide Length = 237 | Back alignment and structure |
| >pdb|3FS1|A Chain A, Crystal Structure Of Hnf4a Lbd In Complex With The Ligand And The Coactivator Pgc-1a Fragment Length = 230 | Back alignment and structure |
| >pdb|2OCF|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Estradiol And The E2#23 Fn3 Monobody Length = 298 | Back alignment and structure |
| >pdb|2JFA|B Chain B, Estrogen Receptor Alpha Lbd In Complex With An Affinity- Selected Corepressor Peptide Length = 252 | Back alignment and structure |
| >pdb|3UU7|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|3Q97|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Two Isomers Of Ethoxy Triphenylethylene Length = 260 | Back alignment and structure |
| >pdb|3Q95|B Chain B, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|1ZKY|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Obcp-3m And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 257 | Back alignment and structure |
| >pdb|3UU7|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-A Length = 251 | Back alignment and structure |
| >pdb|2XHS|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Fushi Tarazu Factor 1 Of Drosophila Melanogaster Length = 245 | Back alignment and structure |
| >pdb|3D24|A Chain A, Crystal Structure Of Ligand-Binding Domain Of Estrogen- Related Receptor Alpha (Erralpha) In Complex With The Peroxisome Proliferators-Activated Receptor Coactivator- 1alpha Box3 Peptide (Pgc-1alpha) Length = 253 | Back alignment and structure |
| >pdb|1R1K|A Chain A, Crystal Structure Of The Ligand-Binding Domains Of The Heterodimer EcrUSP BOUND TO PONASTERONE A Length = 263 | Back alignment and structure |
| >pdb|3HM1|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And Estrone ((8r,9s,13s,14s)-3-Hydroxy- 7,8,9,11,12,14,15, 16-Octahydro-6h-Cyclopenta[a]phenanthren- Length = 253 | Back alignment and structure |
| >pdb|1G2N|A Chain A, Crystal Structure Of The Ligand Binding Domain Of The Ultraspiracle Protein Usp, The Ortholog Of Rxrs In Insects Length = 264 | Back alignment and structure |
| >pdb|1XB7|A Chain A, X-Ray Structure Of Erralpha Lbd In Complex With A Pgc- 1alpha Peptide At 2.5a Resolution Length = 247 | Back alignment and structure |
| >pdb|1L2I|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With (R,R)-5,11-Cis-Diethyl-5,6,11,12- Tetrahydrochrysene-2,8-Diol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|3K6P|A Chain A, Estrogen Related Receptor Alpha In Complex With An Ether Based Ligand Length = 248 | Back alignment and structure |
| >pdb|2BJ4|A Chain A, Estrogen Receptor Alpha Lbd In Complex With A Phage-Display Derived Peptide Antagonist Length = 252 | Back alignment and structure |
| >pdb|1UOM|A Chain A, The Structure Of Estrogen Receptor In Complex With A Selective And Potent Tetrahydroisochiolin Ligand. Length = 254 | Back alignment and structure |
| >pdb|1PCG|A Chain A, Helix-Stabilized Cyclic Peptides As Selective Inhibitors Of Steroid Receptor-Coactivator Interactions Length = 244 | Back alignment and structure |
| >pdb|1QKT|A Chain A, Mutant Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 248 | Back alignment and structure |
| >pdb|2YAT|A Chain A, Crystal Structure Of Estradiol Derived Metal Chelate And Estrogen Receptor-Ligand Binding Domain Complex Length = 252 | Back alignment and structure |
| >pdb|1YMT|A Chain A, Mouse Sf-1 Lbd Length = 246 | Back alignment and structure |
| >pdb|3UUA|A Chain A, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|1HG4|A Chain A, Ultraspiracle Ligand Binding Domain From Drosophila Melanogaster Length = 279 | Back alignment and structure |
| >pdb|1ERR|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With Raloxifene Length = 253 | Back alignment and structure |
| >pdb|2QZO|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed With Way-169916 Length = 258 | Back alignment and structure |
| >pdb|2QA8|B Chain B, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|3Q95|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Lbd In Complex With Grip Peptide And Estriol Length = 260 | Back alignment and structure |
| >pdb|3UUC|A Chain A, Crystal Structure Of Hera-Lbd (Wt) In Complex With Bisphenol-C Length = 251 | Back alignment and structure |
| >pdb|3UUA|B Chain B, Crystal Structure Of Hera-Lbd (Y537s) In Complex With Bisphenol-Af Length = 251 | Back alignment and structure |
| >pdb|1YP0|A Chain A, Structure Of The Steroidogenic Factor-1 Ligand Binding Domain Bound To Phospholipid And A Shp Peptide Motif Length = 239 | Back alignment and structure |
| >pdb|3OS8|A Chain A, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|3DT3|A Chain A, Human Estrogen Receptor Alpha Lbd With Gw368 Length = 255 | Back alignment and structure |
| >pdb|2P15|A Chain A, Crystal Structure Of The Er Alpha Ligand Binding Domain With The Agonist Ortho-Trifluoromethylphenylvinyl Estradiol Length = 258 | Back alignment and structure |
| >pdb|2QXS|A Chain A, Crystal Structure Of Antagonizing Mutant 536s Of The Estrogen Receptor Alpha Ligand Binding Domain Complexed To Raloxifene Length = 258 | Back alignment and structure |
| >pdb|2QA8|A Chain A, Crystal Structure Of The Estrogen Receptor Alpha Ligand Binding Domain Mutant 537s Complexed With Genistein Length = 258 | Back alignment and structure |
| >pdb|2IOG|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Compound 11f Length = 246 | Back alignment and structure |
| >pdb|1ERE|A Chain A, Human Estrogen Receptor Ligand-Binding Domain In Complex With 17beta-Estradiol Length = 253 | Back alignment and structure |
| >pdb|3ERD|A Chain A, Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With Diethylstilbestrol And A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide Length = 261 | Back alignment and structure |
| >pdb|1G50|A Chain A, Crystal Structure Of A Wild Type Her Alpha Lbd At 2.9 Angstrom Resolution Length = 247 | Back alignment and structure |
| >pdb|1SJ0|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With The Antagonist Ligand 4-d Length = 248 | Back alignment and structure |
| >pdb|1GWQ|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With Raloxifene Core And Tif2 Nrbox2 Peptide Length = 248 | Back alignment and structure |
| >pdb|2IOK|A Chain A, Human Estrogen Receptor Alpha Ligand-binding Domain In Complex With Compound 1d Length = 254 | Back alignment and structure |
| >pdb|1A52|A Chain A, Estrogen Receptor Alpha Ligand-Binding Domain Complexed To Estradiol Length = 258 | Back alignment and structure |
| >pdb|1QKU|A Chain A, Wild Type Estrogen Nuclear Receptor Ligand Binding Domain Complexed With Estradiol Length = 250 | Back alignment and structure |
| >pdb|3L03|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Binding Domain In Complex With A Glucocorticoid Receptor Interacting Protein 1 Nr Box Ii Peptide And Estetrol (Estra-1,3,5(10)-Triene-3,15 Alpha, 16alpha,17beta-Tetrol) Length = 253 | Back alignment and structure |
| >pdb|4DMA|A Chain A, Crystal Structure Of Era Lbd In Complex With Ru100132 Length = 247 | Back alignment and structure |
| >pdb|3HLV|A Chain A, Crystal Structure Of Human Estrogen Receptor Alpha Ligand-Bi Domain In Complex With A Glucocorticoid Receptor Interactin 1 Nr Box Ii Peptide And 16-Alpha-Hydroxy-Estrone ((8s,9r,13 16r)-3,16-Dihydroxy-13-Methyl-7,8,9,11,12,14,15, 16-Octahyd Cyclopenta[a]phenanthren-17-One Length = 253 | Back alignment and structure |
| >pdb|1GWR|A Chain A, Human Oestrogen Receptor Alpha Ligand-Binding Domain In Complex With 17beta-Oestradiol And Tif2 Nrbox3 Peptide Length = 245 | Back alignment and structure |
| >pdb|1X7E|A Chain A, Crystal Structure Of Estrogen Receptor Alpha Complexed With Way-244 Length = 245 | Back alignment and structure |
| >pdb|3OS8|C Chain C, Estrogen Receptor Length = 258 | Back alignment and structure |
| >pdb|2PJL|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Alpha In Complex With A Synthetic Inverse Agonist Reveals Its Novel Molecular Mechanism Length = 247 | Back alignment and structure |
| >pdb|1VJB|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4- Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|1S9Q|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With 4-Hydroxytamoxifen Length = 251 | Back alignment and structure |
| >pdb|3F7D|A Chain A, Sf-1 Lbd Bound By Phosphatidylcholine Length = 244 | Back alignment and structure |
| >pdb|2E2R|A Chain A, Crystal Structure Of Human Estrogen-Related Receptor Gamma Ligand Binding Domain Complex With Bisphenol A Length = 244 | Back alignment and structure |
| >pdb|1S9P|A Chain A, Crystal Structure Of The Ligand-Binding Domain Of The Estrogen-Related Receptor Gamma In Complex With Diethylstilbestrol Length = 227 | Back alignment and structure |
| >pdb|2EWP|A Chain A, Crystal Structure Of Estrogen Related Receptor-3 (Err-Gamma) Ligand Binding Domaind With Tamoxifen Analog Gsk5182 Length = 226 | Back alignment and structure |
| >pdb|1KV6|A Chain A, X-Ray Structure Of The Orphan Nuclear Receptor Err3 Ligand- Binding Domain In The Constitutively Active Conformation Length = 230 | Back alignment and structure |
| >pdb|3LTX|A Chain A, Crystal Structure Of The Pacific Oyster Estrogen Receptor Ligand Binding Domain Length = 243 | Back alignment and structure |
| >pdb|1YOW|A Chain A, Human Steroidogenic Factor 1 Lbd With Bound Co-Factor Peptide Length = 242 | Back alignment and structure |
| >pdb|2FSZ|A Chain A, A Second Binding Site For Hydroxytamoxifen Within The Coactivator-Binding Groove Of Estrogen Receptor Beta Length = 246 | Back alignment and structure |
| >pdb|1L2J|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With (R, R)-5,11-Cis-Diethyl-5,6,11,12-Tetrahydrochrysene-2, 8-Diol Length = 271 | Back alignment and structure |
| >pdb|1YY4|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 1-Chloro-6-(4-Hydroxy-Phenyl)-Naphthalen-2-Ol Length = 268 | Back alignment and structure |
| >pdb|1ZDT|A Chain A, The Crystal Structure Of Human Steroidogenic Factor-1 Length = 241 | Back alignment and structure |
| >pdb|1I37|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|2Q7K|A Chain A, The Androgen Receptor Prostate Cancer Mutant H874y Ligand Binding Domain Bound With Testosterone And An Ar 20-30 Peptide Length = 257 | Back alignment and structure |
| >pdb|2AM9|A Chain A, Crystal Structure Of Human Androgen Receptor Ligand Binding Domain In Complex With Testosterone Length = 266 | Back alignment and structure |
| >pdb|1I38|A Chain A, Crystal Structure Of The Rat Androgen Receptor Ligand Binding Domain T877a Mutant Complex With Dihydrotestosterone Length = 260 | Back alignment and structure |
| >pdb|2AX9|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3 Length = 256 | Back alignment and structure |
| >pdb|1XJ7|A Chain A, Complex Androgen Receptor Lbd And Rac3 Peptide Length = 257 | Back alignment and structure |
| >pdb|1T73|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With A Fxxff Motif Length = 269 | Back alignment and structure |
| >pdb|1E3G|A Chain A, Human Androgen Receptor Ligand Binding In Complex With The Ligand Metribolone (R1881) Length = 263 | Back alignment and structure |
| >pdb|2AX6|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877a Mutant In Complex With Hydroxyflutamide Length = 256 | Back alignment and structure |
| >pdb|2Z4J|A Chain A, Crystal Structure Of Ar Lbd With Shp Peptide Nr Box 2 Length = 248 | Back alignment and structure |
| >pdb|1XOW|A Chain A, Crystal Structure Of The Human Androgen Receptor Ligand Binding Domain Bound With An Androgen Receptor Nh2- Terminal Peptide, Ar20-30, And R1881 Length = 249 | Back alignment and structure |
| >pdb|3L3X|A Chain A, Crystal Structure Of Dht-Bound Androgen Receptor In Complex With The First Motif Of Steroid Receptor Coactivator 3 Length = 250 | Back alignment and structure |
| >pdb|1T5Z|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain (Lbd) With Dht And A Peptide Derived From Its Physiological Coactivator Ara70 Length = 251 | Back alignment and structure |
| >pdb|1QKM|A Chain A, Human Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Partial Agonist Genistein Length = 255 | Back alignment and structure |
| >pdb|3RLJ|A Chain A, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With Sarm S-22 Length = 247 | Back alignment and structure |
| >pdb|2OZ7|A Chain A, Crystal Structure Of The Human Androgen Receptor T877a Mutant Ligand- Binding Domain With Cyproterone Acetate Length = 249 | Back alignment and structure |
| >pdb|2HVC|A Chain A, The Crystal Structure Of Ligand-Binding Domain (Lbd) Of Human Androgen Receptor In Complex With A Selective Modulator Lgd2226 Length = 250 | Back alignment and structure |
| >pdb|3RLL|A Chain A, Crystal Structure Of The T877a Androgen Receptor Ligand Binding Domain In Complex With (S)-N-(4-Cyano-3-(Trifluoromethyl)phenyl)-3-(4- Cyanonaphthalen-1-Yloxy)-2-Hydroxy-2-Methylpropanamide Length = 247 | Back alignment and structure |
| >pdb|2I0G|A Chain A, Benzopyrans Are Selective Estrogen Receptor Beta Agonists (Serbas) With Novel Activity In Models Of Benign Prostatic Hyperplasia Length = 257 | Back alignment and structure |
| >pdb|1GS4|A Chain A, Structural Basis For The Glucocorticoid Response In A Mutant Human Androgen Receptor (Arccr) Derived From An Androgen-Independent Prostate Cancer Length = 248 | Back alignment and structure |
| >pdb|1ZAF|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With 3-Bromo-6-Hydroxy-2-(4-Hydroxy-Phenyl)-Inden-1-One Length = 238 | Back alignment and structure |
| >pdb|1U9E|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-397 Length = 241 | Back alignment and structure |
| >pdb|2YLY|A Chain A, Sulfonamides As Selective Estrogen Receptor Beta Agonists. Length = 240 | Back alignment and structure |
| >pdb|2NV7|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-555 Length = 238 | Back alignment and structure |
| >pdb|1X76|A Chain A, Crystal Structure Of Estrogen Receptor Beta Complexed With Way-697 Length = 240 | Back alignment and structure |
| >pdb|2GIU|A Chain A, Human Estrogen Receptor Beta Ligand-Binding Domain In Complex With Compound 45 Length = 241 | Back alignment and structure |
| >pdb|3OLL|A Chain A, Crystal Structure Of Phosphorylated Estrogen Receptor Beta Ligand Binding Domain Length = 240 | Back alignment and structure |
| >pdb|1QKN|A Chain A, Rat Oestrogen Receptor Beta Ligand-Binding Domain In Complex With Antagonist Raloxifene Length = 255 | Back alignment and structure |
| >pdb|1NDE|A Chain A, Estrogen Receptor Beta With Selective Triazine Modulator Length = 255 | Back alignment and structure |
| >pdb|2J7X|A Chain A, Structure Of Estradiol-bound Estrogen Receptor Beta Lbd In Complex With Lxxll Motif From Ncoa5 Length = 255 | Back alignment and structure |
| >pdb|1SR7|A Chain A, Progesterone Receptor Hormone Binding Domain With Bound Mometasone Furoate Length = 259 | Back alignment and structure |
| >pdb|3G8O|A Chain A, Progesterone Receptor With Bound Pyrrolidine 1 Length = 263 | Back alignment and structure |
| >pdb|2W8Y|A Chain A, Ru486 Bound To The Progesterone Receptor In A Destabilized Agonistic Conformation Length = 260 | Back alignment and structure |
| >pdb|1E3K|A Chain A, Human Progesteron Receptor Ligand Binding Domain In Complex With The Ligand Metribolone (R1881) Length = 258 | Back alignment and structure |
| >pdb|1SQN|A Chain A, Progesterone Receptor Ligand Binding Domain With Bound Norethindrone Length = 261 | Back alignment and structure |
| >pdb|1A28|A Chain A, Hormone-Bound Human Progesterone Receptor Ligand-Binding Domain Length = 256 | Back alignment and structure |
| >pdb|3RY9|A Chain A, Crystal Structure Of The Resurrected Ancestral Glucocorticoid Receptor 1 In Complex With Doc Length = 250 | Back alignment and structure |
| >pdb|3KBA|A Chain A, Progesterone Receptor Bound To Sulfonamide Pyrrolidine Partial Agonist Length = 253 | Back alignment and structure |
| >pdb|2QW4|A Chain A, Human Nr4a1 Ligand-Binding Domain Length = 273 | Back alignment and structure |
| >pdb|1YJE|A Chain A, Crystal Structure Of The Rngfi-B Ligand-Binding Domain Length = 264 | Back alignment and structure |
| >pdb|3MNO|A Chain A, Crystal Structure Of The Agonist Form Of Mouse Glucocorticoid Receptor Stabilized By (A611v, F608s) Mutations At 1.55a Length = 261 | Back alignment and structure |
| >pdb|4FNE|A Chain A, X-Ray Crystal Structure Of The Ancestral 3-Keto Steroid Receptor - Doc Complex Length = 254 | Back alignment and structure |
| >pdb|1NHZ|A Chain A, Crystal Structure Of The Antagonist Form Of Glucocorticoid Receptor Length = 280 | Back alignment and structure |
| >pdb|3H52|A Chain A, Crystal Structure Of The Antagonist Form Of Human Glucocorticoid Receptor Length = 254 | Back alignment and structure |
| >pdb|3V3E|B Chain B, Crystal Structure Of The Human Nur77 Ligand-Binding Domain Length = 257 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 295 | |||
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 1e-49 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 4e-21 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 3e-48 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 1e-14 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 6e-47 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 3e-12 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 1e-46 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 3e-13 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 2e-46 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 1e-13 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 2e-46 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 1e-13 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 4e-45 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 2e-13 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 3e-44 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 3e-11 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 8e-44 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 3e-12 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 1e-43 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 6e-12 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 3e-43 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 5e-15 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 3e-43 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 7e-12 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 5e-43 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 3e-12 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 1e-42 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 8e-15 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 5e-42 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 5e-10 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 8e-42 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 1e-14 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 3e-41 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 1e-11 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 5e-41 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 2e-08 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 1e-40 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 2e-11 | |
| 1yje_A | 264 | Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga | 2e-40 | |
| 1yje_A | 264 | Orphan nuclear receptor NR4A1; NGFI-B, NUR77, liga | 1e-09 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 4e-40 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 4e-12 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 1e-39 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 7e-14 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 3e-39 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 3e-11 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 3e-39 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 1e-09 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 3e-39 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 2e-11 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 5e-39 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 4e-09 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 1e-38 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 1e-08 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 2e-38 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 9e-09 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 2e-37 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 2e-10 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 2e-37 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 1e-10 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 6e-36 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 6e-10 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 1e-35 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 9e-06 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 3e-35 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 3e-07 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 3e-35 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 3e-08 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 8e-35 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 3e-08 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 2e-34 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 5e-07 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 2e-34 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 1e-07 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 2e-34 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 1e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 7e-34 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 7e-08 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 9e-34 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 3e-08 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 1e-33 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 6e-06 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 2e-33 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 1e-04 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 2e-32 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 9e-08 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 3e-32 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 6e-05 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 1e-31 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 5e-06 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 1e-31 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 2e-04 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 3e-31 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 1e-04 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 1e-30 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 1e-05 | |
| 2p54_A | 267 | PPAR-alpha, peroxisome proliferator-activated rece | 8e-28 | |
| 2p54_A | 267 | PPAR-alpha, peroxisome proliferator-activated rece | 1e-06 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 5e-27 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 5e-04 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 2e-26 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 3e-04 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 8e-25 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 5e-24 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 1e-23 |
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
Score = 163 bits (415), Expect = 1e-49
Identities = 109/117 (93%), Positives = 116/117 (99%)
Query: 1 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 60
MGI+NICELAAR+LFSAVEWARNIPFFPDLQ+TDQVALLRL WSELFVLNA+QCSMPLHV
Sbjct: 37 MGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHV 96
Query: 61 APLLAAAGLHASPMAADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTT 117
APLLAAAGLHASPM+ADRVVAFMDHIR+FQEQVEKLKALHVDSAEYSCLKAIVLFT+
Sbjct: 97 APLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTS 153
|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... Length = 240 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 235 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... Length = 248 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* Length = 237 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A Length = 282 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A Length = 257 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* Length = 268 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} PDB: 1xb7_A 2pjl_A* 3d24_A Length = 248 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... Length = 240 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* Length = 246 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* Length = 244 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} Length = 243 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* Length = 264 | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* Length = 261 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >1yje_A Orphan nuclear receptor NR4A1; NGFI-B, NUR77, ligand-binding domain, novel coregulator interface, cell-specific; 2.40A {Rattus norvegicus} PDB: 2qw4_A Length = 264 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 Length = 271 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... Length = 269 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* Length = 261 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* Length = 260 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 244 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* Length = 302 | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* Length = 246 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} Length = 294 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* Length = 283 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 Length = 279 | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* Length = 292 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 Length = 303 | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* Length = 266 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... Length = 269 | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* Length = 236 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... Length = 254 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* Length = 316 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... Length = 267 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} Length = 310 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} Length = 268 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A Length = 199 | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... Length = 232 | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} Length = 248 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A Length = 419 | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* Length = 266 | Back alignment and structure |
|---|
| >2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 | Back alignment and structure |
|---|
| >2p54_A PPAR-alpha, peroxisome proliferator-activated receptor alpha; PPAR alpha GW735 SRC1 agonist HDLC, transcription; HET: 735; 1.79A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fei_A* 1i7g_A* 3kdu_A* 3kdt_A* 2rew_A* 1kkq_A* 3g8i_A* 3et1_A* 2znn_A* 3sp6_A* 1k7l_A* 2npa_A* 2xyj_A* 2xyw_A* 2xyx_A* 2q5g_A* 3gwx_A* 3dy6_A* 1gwx_A* 3peq_A* ... Length = 267 | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* Length = 244 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* Length = 244 | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* Length = 243 | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} PDB: 3b0w_A* 3kyt_A* 3l0j_A* Length = 248 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* Length = 270 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 100.0 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 100.0 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 100.0 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 100.0 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 100.0 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 100.0 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 100.0 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 99.98 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.98 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 99.98 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.98 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 99.97 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 99.97 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.97 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 99.97 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.97 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.97 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 99.97 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 99.97 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 99.97 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.97 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 99.97 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 99.97 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.97 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 99.97 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 99.97 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 99.97 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 99.97 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 99.97 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.97 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 99.97 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 99.97 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 99.97 | |
| 3cqv_A | 199 | Nuclear receptor subfamily 1 group D member 2; rev | 99.97 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 99.96 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 99.96 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.96 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 99.96 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 99.96 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 99.96 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.96 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.96 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.96 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 99.96 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 99.96 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 99.96 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.96 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 99.96 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 99.96 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 99.96 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 99.96 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.96 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.95 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 99.95 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 99.62 | |
| 1lbd_A | 282 | RXR_LBD, retinoid X receptor; transcription factor | 99.61 | |
| 3dzy_D | 419 | Peroxisome proliferator-activated receptor gamma; | 99.47 | |
| 3k6p_A | 248 | Steroid hormone receptor ERR1; estrogen related re | 99.19 | |
| 1xpc_A | 248 | Estrogen receptor; nuclear receptor, transcription | 99.18 | |
| 2e2r_A | 244 | Estrogen-related receptor gamma; ERR gamma, BPA, n | 99.15 | |
| 3ltx_A | 243 | Estrogen receptor; constitutive, nuclear receptor, | 99.13 | |
| 3mnp_A | 261 | Glucocorticoid receptor; protein-ligand complex, s | 99.11 | |
| 1t7r_A | 269 | Androgen receptor; nuclear receptor, transcription | 99.11 | |
| 3oll_A | 240 | Estrogen receptor beta; steroid binding, phosphory | 99.1 | |
| 3vhv_A | 260 | Mineralocorticoid receptor; nuclear receptor, tran | 99.07 | |
| 1sqn_A | 261 | PR, progesterone receptor; nuclear receptor, stero | 99.07 | |
| 1yye_A | 268 | ER-beta, estrogen receptor beta; ER-beta, nuclear | 99.07 | |
| 3cjw_A | 244 | COUP transcription factor 2; COUP-TFII, nuclear re | 99.04 | |
| 1xdk_B | 303 | RAR-beta, retinoic acid receptor, beta; nuclear re | 99.04 | |
| 3vhu_A | 294 | Mineralocorticoid receptor; nuclear receptor, tran | 99.01 | |
| 1l2j_A | 271 | Estrogen receptor beta; nuclear receptor, transcri | 99.01 | |
| 1ovl_A | 271 | Orphan nuclear receptor NURR1 (MSe 414, 496, 511); | 99.01 | |
| 2ocf_A | 298 | Estrogen receptor; estrogen receptor, LBD, monobod | 99.0 | |
| 1g2n_A | 264 | Ultraspiracle protein; antiparallel alpha-helical | 98.97 | |
| 3plz_A | 257 | FTZ-F1 related protein; alpha helical sandwhich, f | 98.92 | |
| 3v3e_B | 257 | Nuclear receptor subfamily 4 group A member 1; orp | 98.92 | |
| 2nxx_A | 235 | Ultraspiracle (USP, NR2B4); hormone receptor, APO | 98.91 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 98.85 | |
| 2p1t_A | 240 | Retinoic acid receptor RXR-alpha; protein-ligand c | 98.84 | |
| 1ymt_A | 246 | Steroidogenic factor 1; SF-1, ligand-binding domai | 98.76 | |
| 1fcy_A | 236 | RAR-gamma-1, retinoic acid receptor gamma-1; isoty | 98.69 | |
| 1pdu_A | 244 | DHR38, nuclear hormone receptor HR38; nuclear rece | 98.66 | |
| 1hg4_A | 279 | Ultraspiracle; nuclear hormone receptor, transcrip | 98.66 | |
| 3f5c_B | 268 | Nuclear receptor subfamily 0 group B member 1; tra | 98.65 | |
| 3p0u_A | 249 | Nuclear receptor subfamily 2 group C member 2; lig | 98.63 | |
| 3kmr_A | 266 | Retinoic acid receptor alpha; nuclear receptor tra | 98.63 | |
| 2iz2_A | 243 | FTZ-F1 alpha, nuclear hormone receptor FTZ-F1; nuc | 98.62 | |
| 1osh_A | 232 | BIle acid receptor; nuclear receptor, ligand bindi | 98.62 | |
| 3gyt_A | 244 | Nuclear hormone receptor of the steroid/thyroid ho | 98.57 | |
| 3l0l_A | 248 | Nuclear receptor ROR-gamma; nuclear receptor, rorg | 98.56 | |
| 2o4j_A | 292 | Vitamin D3 receptor; nuclear receptor-ligand compl | 98.52 | |
| 1n83_A | 270 | Nuclear receptor ROR-alpha; three-layered alpha he | 98.51 | |
| 2hc4_A | 302 | Vitamin D receptor; alpha helical sandwich, gene r | 98.51 | |
| 3vi8_A | 273 | Peroxisome proliferator-activated receptor alpha; | 98.5 | |
| 3up3_A | 243 | Acedaf-12; ligand binding domain, nematode, steroi | 98.49 | |
| 3b0t_A | 254 | Vitamin D3 receptor; nuclear receptor, transcripti | 98.49 | |
| 3n00_A | 245 | REV-ERBA-alpha; reverba ncorid1, anti-parallel B-s | 98.48 | |
| 1xvp_B | 246 | Orphan nuclear receptor NR1I3; CAR, RXR, citco, SR | 98.48 | |
| 2r40_D | 266 | Ecdysone receptor, 20-hydroxy-ecdysone receptor; n | 98.46 | |
| 1nq7_A | 244 | Nuclear receptor ROR-beta; ligand-binding domain, | 98.42 | |
| 3ipq_A | 283 | Oxysterols receptor LXR-alpha; LXR homodimer, LXR | 98.42 | |
| 1z5x_E | 310 | Ecdysone receptor ligand binding domain; ponastero | 98.4 | |
| 1nrl_A | 316 | Orphan nuclear receptor PXR; PXR, xenobiotic, SRC- | 98.38 | |
| 3ilz_A | 267 | Thyroid hormone receptor, alpha isoform 1 variant; | 98.36 | |
| 2nxx_E | 248 | Ecdysone receptor (ECR, NRH1); hormone receptor, A | 98.35 | |
| 1pzl_A | 237 | Hepatocyte nuclear factor 4-alpha; transcription; | 98.35 | |
| 3u9q_A | 269 | Peroxisome proliferator-activated receptor gamma; | 98.17 | |
| 1ynw_B | 99 | Retinoic acid receptor RXR-alpha, retinoid X recep | 97.96 | |
| 3cbb_A | 78 | HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DN | 97.89 | |
| 1dsz_B | 85 | RXR-alpha, retinoic acid receptor RXR-alpha; RAR, | 97.88 | |
| 1dsz_A | 86 | RAR-alpha, retinoic acid receptor alpha; RAR, nucl | 97.87 | |
| 2han_A | 93 | Protein ultraspiracle; transcription regulation, t | 97.8 | |
| 1cit_A | 89 | NGFI-B, protein (orphan nuclear receptor NGFI-B); | 97.8 | |
| 2lze_A | 87 | A primordial catalytic fold generated by in vitro | 97.8 | |
| 1hcq_A | 84 | Protein (estrogen receptor); protein-DNA complex, | 97.79 | |
| 2ebl_A | 89 | COUP transcription factor 1; DNA-binding, metal-bi | 97.79 | |
| 1a6y_A | 94 | Orphan nuclear receptor NR1D1; orphan receptor, DN | 97.79 | |
| 1lo1_A | 98 | Steroid hormone receptor ERR2; estrogen related re | 97.73 | |
| 4hn5_A | 117 | Glucocorticoid receptor; glucocorticoid receptor, | 97.69 | |
| 2a66_A | 113 | Orphan nuclear receptor NR5A2; protein-DNA complex | 97.66 | |
| 1r4i_A | 105 | Androgen receptor; AR, steroid receptor, protein-D | 97.64 | |
| 3g9m_A | 90 | Glucocorticoid receptor; glucocorticoid, DNA-bindi | 97.64 | |
| 1kb2_A | 110 | Vitamin D3 receptor; VDR, nuclear receptor, protei | 97.53 | |
| 2han_B | 119 | Ecdysone receptor; transcription regulation, trans | 97.52 | |
| 2nll_B | 103 | Protein (thyroid hormone receptor); complex (trans | 97.49 |
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-33 Score=241.96 Aligned_cols=179 Identities=23% Similarity=0.277 Sum_probs=153.1
Q ss_pred cHHHHHHHHHHHHHHHHhHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHHhhHhhcCCCCcceeecCCcccChhhHHHHHH
Q psy1615 2 GIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLLAAAGLHASPMAADRVVA 81 (295)
Q Consensus 2 ~~~~~~~~~~~~l~~~v~waK~lp~F~~L~~~Dq~~LLk~~~~e~~~L~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (295)
.++++|+++++.++.+|+|||++|+|.+|+.+||+.|||++|.|+++|+.||++++.+.+.+++.+|..+.+... ...+
T Consensus 37 ~~~~~~~~a~~~l~~~VewaK~ip~F~~L~~~DQ~~LLk~~~~el~~L~~a~~s~~~~~~~l~~~~g~~~~~~~~-~~~~ 115 (243)
T 3ltx_A 37 LLNSLVKLAERELVHLINWAKNVPGYTDLSLSDQVHLIECCWMELLLLNCAFRSIEHGGKSLAFAPDLVLDRSSW-STVE 115 (243)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTTSTTGGGSCHHHHHHHHHHHHHHHHHHHHHHHTTTTTTSEEEEETTEEEEHHHH-HHTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHcCcchhcCCHHHHHHHHHHHHHHHHHHHHHHHhccCCCCeEEecCCcccchhhh-cccC
Confidence 478999999999999999999999999999999999999999999999999999988877788888876554332 1223
Q ss_pred HHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHhccCCcccccccchhHHHHHHHHHHHHHH---Hhh--CCCCCCccccc
Q psy1615 82 FMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKRIFTGVLLKALHVDSAEYSCLKA---IVL--FTTGKRMFGKP 156 (295)
Q Consensus 82 ~~~~~~~l~~~~~~l~~L~ld~~E~~lLkai~L~~pd~~~l~~~l~~~~~i~~~q~~~l~~---l~~--~~~~~~Rf~~l 156 (295)
+.+.++.+.+++.+|++|++|++||+|||||+|||||++ |+++..+|+.+|+++..+ |+. ||++|.||++|
T Consensus 116 ~~~~~~~i~~~~~~l~~L~ld~~E~~lLkaivL~~pd~~----gL~~~~~v~~lq~~~~~aL~~y~~~~~p~~~~Rf~~L 191 (243)
T 3ltx_A 116 MTEIFEQVAAVSEQMMQNHLHKDELLLLQAMVLVNAEVR----RLASYNQIFNMQQSLLDAIVDTAQKYHPDNVRHVPAV 191 (243)
T ss_dssp CHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHTSCCS----CCTTHHHHHHHHHHHHHHHHHHHHHHSTTCSSHHHHH
T ss_pred HHHHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHhCCCCC----CCCCHHHHHHHHHHHHHHHHHHHHHhCCChhhHHHHH
Confidence 445566778999999999999999999999999999999 888999999999988554 443 89999999998
Q ss_pred ccccc-------------hhhhhhcCCCccchhhhhhhcCCC
Q psy1615 157 LPLNQ-------------HYTATISNVPLSSSLSTAVQRGRV 185 (295)
Q Consensus 157 Ll~~~-------------y~~r~~~~c~id~l~r~~~q~~r~ 185 (295)
|++++ ++.+..|..+++.++.+++...+.
T Consensus 192 L~~Lp~Lr~l~~~~~e~l~~~~~~g~~~~~~Ll~Eml~~~~~ 233 (243)
T 3ltx_A 192 LLLLTHIRQAGERGIAFFQRLKSEGVVTFCDLLKEMLDAQDF 233 (243)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHCSSCCCHHHHHHHHHC--
T ss_pred HHHHHHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHhCccc
Confidence 88763 345677999999999999987654
|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >3cqv_A Nuclear receptor subfamily 1 group D member 2; reverb beta, heme, NR1D2, DNA-binding, metal-binding, nucleus, repressor, transcription; HET: HEM; 1.90A {Homo sapiens} PDB: 2v7c_A 2v0v_A | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* | Back alignment and structure |
|---|
| >1lbd_A RXR_LBD, retinoid X receptor; transcription factor, nuclear receptor, structural proteomic europe, spine, structural genomics; 2.70A {Homo sapiens} SCOP: a.123.1.1 PDB: 1z5x_U* 2q60_A | Back alignment and structure |
|---|
| >3dzy_D Peroxisome proliferator-activated receptor gamma; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_D* 3e00_D* 2env_A | Back alignment and structure |
|---|
| >3k6p_A Steroid hormone receptor ERR1; estrogen related receptor alpha, DNA-binding, isopeptide BON binding, nucleus, phosphoprotein, transcription; HET: 5FB; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xb7_A 2pjl_A* 3d24_A | Back alignment and structure |
|---|
| >1xpc_A Estrogen receptor; nuclear receptor, transcription factor, ER-alpha, antagonist hormone-growth factor receptor complex; HET: AIT; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1sj0_A* 1xp1_A* 1xp9_A* 1xp6_A* 1yim_A* 1yin_A* 3ert_A* 1r5k_A* 3erd_A* 1l2i_A* 2iok_A* 1a52_A* 2ouz_A* 1ere_A* 1err_A* 2qxs_A* 3q95_A* 3q97_A* 2b1z_A* 1zky_A* ... | Back alignment and structure |
|---|
| >2e2r_A Estrogen-related receptor gamma; ERR gamma, BPA, nuclear receptor, transcription; HET: 2OH; 1.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 2zas_A* 2zbs_A 2zkc_A* 2p7g_A* 1vjb_A* 1tfc_A 2p7a_A* 2p7z_A* 2gpu_A* 1kv6_A 2gp7_A 2gpp_A* 2gpo_A* 2gpv_A* 1s9q_A* 1s9p_A* 2ewp_A* | Back alignment and structure |
|---|
| >3ltx_A Estrogen receptor; constitutive, nuclear receptor, DNA-binding, metal-binding, nucleus, transcription, transcription regulation, zinc-finger; 2.60A {Crassostrea gigas} | Back alignment and structure |
|---|
| >3mnp_A Glucocorticoid receptor; protein-ligand complex, steroid nuclear receptor, mouse GR, hormone receptor; HET: DEX; 1.50A {Mus musculus} SCOP: a.123.1.1 PDB: 3mno_A* 3mne_A* 1m2z_A* 3k22_A* 3cld_A* 3k23_A* 3e7c_A* 1nhz_A* 1p93_A* 3bqd_A* 3h52_A* 3gn8_A* 4e2j_A* | Back alignment and structure |
|---|
| >1t7r_A Androgen receptor; nuclear receptor, transcription factor, ligand binding domain, AF-2, androgen, testosterone, DHT, alpha-helical sandwich; HET: DHT; 1.40A {Pan troglodytes} SCOP: a.123.1.1 PDB: 1t73_A* 1t76_A* 1t74_A* 1t79_A* 1t7m_A* 1t7f_A* 1t7t_A* 2am9_A* 2ama_A* 2amb_A* 2pnu_A* 1e3g_A* 2q7i_A* 1xj7_A* 2q7j_A* 3g0w_A* 2ihq_A* 2nw4_A* 1i37_A* 2q7k_A* ... | Back alignment and structure |
|---|
| >3oll_A Estrogen receptor beta; steroid binding, phosphorylation, hormone receptor-activator; HET: PTR EST; 1.50A {Homo sapiens} SCOP: a.123.1.1 PDB: 1u3s_A* 1u3q_A* 1x78_A* 1x7b_A* 1x7j_A* 1x76_A* 2yjd_A* 3ols_A* 3omo_A* 3omp_A* 3omq_A* 1u3r_A* 1u9e_A* 1qkm_A* 2giu_A* 1nde_A* 2jj3_A* 2i0g_A* 2qtu_A* 2z4b_A* ... | Back alignment and structure |
|---|
| >3vhv_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, non-steroidal antagonist; HET: LD1 LD2; 1.35A {Homo sapiens} SCOP: a.123.1.1 PDB: 2aax_A* 2aa6_A* 2ab2_A* 2aa2_A* 2aa5_A* 2aa7_A* 2a3i_A* 1y9r_A* 1ya3_A* 2oax_A* 2abi_A* 2q1h_A* 2q1v_A* 2q3y_A* 3ry9_A* 4fne_A* 4fn9_A* | Back alignment and structure |
|---|
| >1sqn_A PR, progesterone receptor; nuclear receptor, steroid receptor, norethindrone, birth control, hormone/growth factor receptior complex; HET: NDR; 1.45A {Homo sapiens} SCOP: a.123.1.1 PDB: 3g8o_A* 3g8n_A* 3d90_A* 1e3k_A* 1sr7_A* 1zuc_B* 3zr7_A* 2w8y_A* 3zra_A* 3zrb_A* 4a2j_A* 4apu_A* 1a28_A* 2ovh_A* 2ovm_A* 3hq5_A* 3kba_A* | Back alignment and structure |
|---|
| >1yye_A ER-beta, estrogen receptor beta; ER-beta, nuclear receptor, transcription factor, agonist; HET: 196; 2.03A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yy4_A* | Back alignment and structure |
|---|
| >3cjw_A COUP transcription factor 2; COUP-TFII, nuclear receptor, ligand binding domain, orphan receptor, three-layered helical sandwich, DNA-binding; 1.48A {Homo sapiens} | Back alignment and structure |
|---|
| >1xdk_B RAR-beta, retinoic acid receptor, beta; nuclear receptor, coactivator, ligand, hormone/growth factor receptor complex; HET: REA; 2.90A {Mus musculus} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3vhu_A Mineralocorticoid receptor; nuclear receptor, transcription factor, activating mutation, hypertension, antagonist, spironolactone; HET: SNL; 2.11A {Homo sapiens} | Back alignment and structure |
|---|
| >1l2j_A Estrogen receptor beta; nuclear receptor, transcription factor, antagonist transcription receptor; HET: ETC; 2.95A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1ovl_A Orphan nuclear receptor NURR1 (MSe 414, 496, 511); NUUR1, LBD, transcription; 2.20A {Homo sapiens} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >2ocf_A Estrogen receptor; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1g2n_A Ultraspiracle protein; antiparallel alpha-helical sandwich, structural proteomics in europe, spine, structural genomics, gene regulation; HET: EPH; 1.65A {Heliothis virescens} SCOP: a.123.1.1 PDB: 2r40_A* 1r20_A* 1r1k_A* 3ixp_A* | Back alignment and structure |
|---|
| >3plz_A FTZ-F1 related protein; alpha helical sandwhich, family five, TRAN factor, transcription-receptor-agonist comple; HET: 470; 1.75A {Homo sapiens} SCOP: a.123.1.1 PDB: 1yok_A* 1yuc_A* 4dor_A* 1zdu_A* 4dos_A* 1zh7_A 1pk5_A 3f5c_A | Back alignment and structure |
|---|
| >3v3e_B Nuclear receptor subfamily 4 group A member 1; orphan nuclear receptor, transcription; 2.06A {Homo sapiens} PDB: 3v3q_A* 2qw4_A 1yje_A | Back alignment and structure |
|---|
| >2nxx_A Ultraspiracle (USP, NR2B4); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2p1t_A Retinoic acid receptor RXR-alpha; protein-ligand complex, hormone receptor; HET: 3TN; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 1mvc_A* 1mzn_A* 1mv9_A* 2p1u_A* 2p1v_A* 2zxz_A* 2zy0_A* 3fug_A* 3nsp_A 3nsq_A* 3r29_A 3r2a_A* 3r5m_A* 3e94_A* 3kwy_A* 1fby_A* 3uvv_B* 3fc6_A* 1rdt_A* 3fal_A* ... | Back alignment and structure |
|---|
| >1ymt_A Steroidogenic factor 1; SF-1, ligand-binding domain, ligand, phosphatidyl glycerol, CO-repressor peptide, transcription; HET: DR9; 1.20A {Mus musculus} PDB: 3f7d_A* 1yp0_A* 1yow_A* 1zdt_A* | Back alignment and structure |
|---|
| >1fcy_A RAR-gamma-1, retinoic acid receptor gamma-1; isotype selectivity, retinoid ligand complexes, drug design, antiparallel alpha-helical sandwich fold; HET: 564 LMU; 1.30A {Homo sapiens} SCOP: a.123.1.1 PDB: 1fcz_A* 1fcx_A* 1fd0_A* 1exa_A* 1exx_A* 1dkf_B* | Back alignment and structure |
|---|
| >1pdu_A DHR38, nuclear hormone receptor HR38; nuclear receptor, ligand-binding domain, hormone/growth factor receptor complex; 2.30A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >1hg4_A Ultraspiracle; nuclear hormone receptor, transcription factor, ligand binding; HET: LPP; 2.4A {Drosophila melanogaster} SCOP: a.123.1.1 | Back alignment and structure |
|---|
| >3f5c_B Nuclear receptor subfamily 0 group B member 1; transcriptional corepressor, regulatory complex, DNA-binding, lipid-binding, metal-binding; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3p0u_A Nuclear receptor subfamily 2 group C member 2; ligand binding domain, orphan nuclear receptor, testicular R 4, signaling protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmr_A Retinoic acid receptor alpha; nuclear receptor transcription factor ligand binding domain, binding, metal-binding, nucleus, phosphoprotein; HET: EQN; 1.80A {Homo sapiens} PDB: 3kmz_B* 3a9e_B* 4dm6_A* 1xap_A* 4dm8_A* 2lbd_A* 3lbd_A* 4lbd_A* | Back alignment and structure |
|---|
| >1osh_A BIle acid receptor; nuclear receptor, ligand binding domain, transcription; HET: FEX; 1.80A {Homo sapiens} SCOP: a.123.1.1 PDB: 3l1b_A* 3bej_A* 3fli_A* 3hc5_A* 3rvf_A* 3dct_A* 3dcu_A* 3ruu_A* 3rut_A* 3olf_A* 3okh_A* 3fxv_A* 3oki_A* 3omk_A* 3omm_A* 3oof_A* 3ook_A* 3hc6_A* 3p89_A* 3p88_A* ... | Back alignment and structure |
|---|
| >3gyt_A Nuclear hormone receptor of the steroid/thyroid hormone receptors superfamily; nuclear receptor, ligand binding domain, dafachronic acid, nematode, DNA-binding, metal-binding, nucleus, receptor; HET: DL4; 2.40A {Strongyloides stercoralis} PDB: 3gyu_A* | Back alignment and structure |
|---|
| >3l0l_A Nuclear receptor ROR-gamma; nuclear receptor, rorgamma, alternative splicing, DNA-bindin binding, nucleus, receptor, zinc-finger, acetylation, activator; HET: HC3; 1.74A {Homo sapiens} SCOP: a.123.1.0 PDB: 3b0w_A* 3kyt_A* 3l0j_A* | Back alignment and structure |
|---|
| >2o4j_A Vitamin D3 receptor; nuclear receptor-ligand complex, hormone/growth factor receptor complex; HET: VD4; 1.74A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1rk3_A* 1rjk_A* 1rkh_A* 1rkg_A* 2o4r_A* | Back alignment and structure |
|---|
| >1n83_A Nuclear receptor ROR-alpha; three-layered alpha helical sandwich, transcription regulation, nuclear protein, DNA binding, lipid binding protein; HET: CLR; 1.63A {Homo sapiens} SCOP: a.123.1.1 PDB: 1s0x_A* | Back alignment and structure |
|---|
| >2hc4_A Vitamin D receptor; alpha helical sandwich, gene regulation; HET: VDX; 2.20A {Danio rerio} PDB: 2hbh_A* 2hcd_A* 3dr1_A* 3o1d_A* 3o1e_A* | Back alignment and structure |
|---|
| >3vi8_A Peroxisome proliferator-activated receptor alpha; nuclear receptor, protein-ligand complex, PPAR, transcriptio; HET: 13M; 1.75A {Homo sapiens} PDB: 2znn_A* 3et1_A* 3kdu_A* 3kdt_A* 2rew_A* 1i7g_A* 3g8i_A* 1kkq_A* 1k7l_A* 3sp6_A* 2npa_A* 2p54_A* 3fei_A* 3tkm_A* 2znq_A* 2znp_A* 3sp9_A* 3gwx_A* 3dy6_A* 1gwx_A* ... | Back alignment and structure |
|---|
| >3up3_A Acedaf-12; ligand binding domain, nematode, steroid binding protein- transcription complex; HET: XCA; 1.25A {Ancylostoma ceylanicum} PDB: 3up0_A* | Back alignment and structure |
|---|
| >3b0t_A Vitamin D3 receptor; nuclear receptor, transcription, gene regulation; HET: MCZ; 1.30A {Homo sapiens} PDB: 3a40_X* 1s0z_A* 1s19_A* 2ham_A* 2har_A* 2has_A* 1txi_A* 2hb8_A* 2hb7_A* 3a3z_X* 3a78_A* 3auq_A* 3aur_A* 3ax8_A* 3cs4_A* 3cs6_A* 1ie9_A* 1db1_A* 1ie8_A* 3kpz_A* ... | Back alignment and structure |
|---|
| >3n00_A REV-ERBA-alpha; reverba ncorid1, anti-parallel B-sheet, transcription regula; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1xvp_B Orphan nuclear receptor NR1I3; CAR, RXR, citco, SRC1, DNA binding protein; HET: F15 CID; 2.60A {Homo sapiens} SCOP: a.123.1.1 PDB: 1xv9_B* 1xnx_A* 1xls_E* | Back alignment and structure |
|---|
| >2r40_D Ecdysone receptor, 20-hydroxy-ecdysone receptor; nuclear receptor ligand-binding domain, anti-parallel alpha- sandwich, ecdysone receptor, ECR, gene regulation; HET: FLC 20E EPH; 2.40A {Heliothis virescens} SCOP: a.123.1.1 PDB: 1r1k_D* 3ixp_D* 1r20_D* | Back alignment and structure |
|---|
| >1nq7_A Nuclear receptor ROR-beta; ligand-binding domain, retinoids, retinoic acid, synthetic ligand, antagonist, transcription; HET: ARL; 1.50A {Rattus norvegicus} SCOP: a.123.1.1 PDB: 1k4w_A* 1n4h_A* | Back alignment and structure |
|---|
| >3ipq_A Oxysterols receptor LXR-alpha; LXR homodimer, LXR signaling, alternative DNA-binding, metal-binding, nucleus, polymorphism, receptor transcription; HET: 965; 2.00A {Homo sapiens} PDB: 3ips_A* 3ipu_A* 3fc6_B* 3fal_B* 1uhl_B* 2acl_B* 1upv_A* 1upw_A* 1p8d_A* 1pq9_A* 1pq6_A* 1pqc_A* 3kfc_A* 4dk7_A* 4dk8_A* 3l0e_A* | Back alignment and structure |
|---|
| >1z5x_E Ecdysone receptor ligand binding domain; ponasterone A, nuclear receptor, ECR, USP, hormone/growth factor receptor complex; HET: P1A; 3.07A {Bemisia tabaci} | Back alignment and structure |
|---|
| >1nrl_A Orphan nuclear receptor PXR; PXR, xenobiotic, SRC-1, ligand binding domain, transcription; HET: SRL; 2.00A {Homo sapiens} SCOP: a.123.1.1 PDB: 1ilh_A* 1ilg_A* 1m13_A* 2qnv_A* 3r8d_A* 3ctb_A 3ctc_A 3hvl_A* 1skx_A* 2o9i_A* | Back alignment and structure |
|---|
| >3ilz_A Thyroid hormone receptor, alpha isoform 1 variant; nuclear receptor, signaling protein; HET: B72; 1.85A {Homo sapiens} SCOP: a.123.1.1 PDB: 3jzb_A* 3hzf_A* 2h79_A* 2h77_A* 1nav_A* 3uvv_A* 1xzx_X* 1y0x_X* 1nq1_A* 3jzc_A* 1nuo_A* 3imy_A* 1nq0_A* 1bsx_A* 1r6g_A* 1nq2_A* 3gws_X* 1n46_A* 2h6w_X* 2j4a_A* ... | Back alignment and structure |
|---|
| >2nxx_E Ecdysone receptor (ECR, NRH1); hormone receptor, APO and holo ligand binding pocket, hormone/growth factor complex; HET: P1A; 2.75A {Tribolium castaneum} | Back alignment and structure |
|---|
| >1pzl_A Hepatocyte nuclear factor 4-alpha; transcription; HET: MYR; 2.10A {Homo sapiens} SCOP: a.123.1.1 PDB: 3fs1_A* 1m7w_A* 1lv2_A* | Back alignment and structure |
|---|
| >3u9q_A Peroxisome proliferator-activated receptor gamma; nuclear receptor, adipogenesis, RXRA, nucleus, transcription; HET: DKA; 1.52A {Homo sapiens} SCOP: a.123.1.1 PDB: 1i7i_A* 3ty0_A* 1zeo_A* 2p4y_A* 3et3_A* 3et0_A* 2hwq_A* 2ath_A* 2f4b_A* 2g0g_A* 2g0h_A* 2gtk_A* 2fvj_A* 2hwr_A* 2prg_A* 2q8s_A* 3fej_A* 3g9e_A* 3gbk_A* 3ia6_A* ... | Back alignment and structure |
|---|
| >1ynw_B Retinoic acid receptor RXR-alpha, retinoid X receptor; VDR, nuclear receptor, protein-DNA complex, transcripti complex; 3.00A {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3cbb_A HNF-4-alpha, hepatocyte nuclear factor 4-alpha, DNA binding domain, nuclear; zinc finger; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1dsz_B RXR-alpha, retinoic acid receptor RXR-alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1by4_A* 1rxr_A 1r0n_A 1r0o_A 2nll_A* | Back alignment and structure |
|---|
| >1dsz_A RAR-alpha, retinoic acid receptor alpha; RAR, nuclear receptor, protein-DNA, transcription/DNA complex; HET: DNA; 1.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hra_A | Back alignment and structure |
|---|
| >2han_A Protein ultraspiracle; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >1cit_A NGFI-B, protein (orphan nuclear receptor NGFI-B); early immediate response gene product, transcription factor, monomeric protein-DNA complex; HET: DNA; 2.70A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >2lze_A A primordial catalytic fold generated by in vitro evolution; ligase, de novo protein; NMR {Synthetic construct} | Back alignment and structure |
|---|
| >1hcq_A Protein (estrogen receptor); protein-DNA complex, complexed with drug, transcription/DNA complex; HET: DNA; 2.40A {Homo sapiens} SCOP: g.39.1.2 PDB: 1hcp_A 4aa6_A | Back alignment and structure |
|---|
| >2ebl_A COUP transcription factor 1; DNA-binding, metal-binding, nuclear protein, receptor, transcription regulation, zinc, EAR3, erbal3 tfcoup1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a6y_A Orphan nuclear receptor NR1D1; orphan receptor, DNA-binding, reverb, REV- ERB, transcription regulation, transcription/DNA complex; HET: DNA 5IU; 2.30A {Homo sapiens} SCOP: g.39.1.2 PDB: 1ga5_A* 1hlz_A | Back alignment and structure |
|---|
| >1lo1_A Steroid hormone receptor ERR2; estrogen related receptor 2, DNA binding domain, HERR2, hormone nuclear receptor; NMR {Homo sapiens} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >4hn5_A Glucocorticoid receptor; glucocorticoid receptor, steroid receptors, NGRE, repre transcription; HET: DNA; 1.90A {Homo sapiens} PDB: 4hn6_A* | Back alignment and structure |
|---|
| >2a66_A Orphan nuclear receptor NR5A2; protein-DNA complex, zinc finger, DNA- binding domain, transcription factor, FTZ-F1, C-terminal extension; 2.20A {Homo sapiens} PDB: 2ff0_A | Back alignment and structure |
|---|
| >1r4i_A Androgen receptor; AR, steroid receptor, protein-DNA complex, transcription/DNA complex; 3.10A {Rattus norvegicus} SCOP: g.39.1.2 | Back alignment and structure |
|---|
| >3g9m_A Glucocorticoid receptor; glucocorticoid, DNA-binding, allostery, lever ARM, transcription, hormone; HET: DNA; 1.61A {Rattus norvegicus} SCOP: g.39.1.2 PDB: 3g6p_A* 3g6q_B* 3g6r_B* 3g6u_A* 3g8u_A* 3g8x_A* 3g97_B* 3g99_A* 3g9i_A* 3g9j_A* 3fyl_A* 3g9o_B* 3g9p_B* 3g6t_A* 1r4o_A 1r4r_A 1glu_A* 1gdc_A 2gda_A 1rgd_A ... | Back alignment and structure |
|---|
| >1kb2_A Vitamin D3 receptor; VDR, nuclear receptor, protein-DNA complex, transcription/DNA complex; 2.70A {Homo sapiens} SCOP: g.39.1.2 PDB: 1kb4_A 1kb6_A 1ynw_A | Back alignment and structure |
|---|
| >2han_B Ecdysone receptor; transcription regulation, transcription factor, DNA-binding, nuclear protein, nuclear receptor, zinc finger; 1.95A {Drosophila melanogaster} SCOP: g.39.1.2 PDB: 1r0o_B 1r0n_B | Back alignment and structure |
|---|
| >2nll_B Protein (thyroid hormone receptor); complex (transcription regulation/DNA), DNA-binding, nuclear protein, zinc- finger, multigene family; HET: DNA 5IU; 1.90A {Homo sapiens} SCOP: g.39.1.2 PDB: 3m9e_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 295 | ||||
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 5e-29 | |
| d1pzla_ | 233 | a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha { | 1e-11 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 3e-28 | |
| d1pk5a_ | 242 | a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH- | 2e-07 | |
| d2j7ya1 | 236 | a.123.1.1 (A:217-452) Estrogen receptor beta {Rat | 9e-28 | |
| d2j7ya1 | 236 | a.123.1.1 (A:217-452) Estrogen receptor beta {Rat | 2e-09 | |
| d1g2na_ | 256 | a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth | 8e-27 | |
| d1g2na_ | 256 | a.123.1.1 (A:) Ultraspiracle protein, usp {Helioth | 2e-07 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 9e-27 | |
| d1hg4a_ | 265 | a.123.1.1 (A:) Ultraspiracle protein, usp {Drosoph | 1e-07 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 9e-27 | |
| d1nhza_ | 247 | a.123.1.1 (A:) Glucocorticoid receptor {Human (Hom | 1e-08 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 9e-27 | |
| d1xpca_ | 245 | a.123.1.1 (A:) Estrogen receptor alpha {Human (Hom | 4e-07 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 1e-26 | |
| d3d24a1 | 227 | a.123.1.1 (A:194-420) Steroid hormone receptor ERR | 2e-10 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 3e-26 | |
| d2e2ra1 | 223 | a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 | 2e-09 | |
| d1t7ra_ | 250 | a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan | 4e-26 | |
| d1t7ra_ | 250 | a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan | 1e-07 | |
| d1fcya_ | 236 | a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g | 5e-26 | |
| d1fcya_ | 236 | a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-g | 2e-05 | |
| d2p1ta1 | 230 | a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R | 1e-25 | |
| d2p1ta1 | 230 | a.123.1.1 (A:229-458) Retinoid-X receptor alpha (R | 1e-07 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 1e-25 | |
| d1sqna_ | 251 | a.123.1.1 (A:) Progesterone receptor {Human (Homo | 1e-08 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 2e-24 | |
| d1ovla_ | 236 | a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Huma | 1e-06 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 3e-23 | |
| d1pdua_ | 230 | a.123.1.1 (A:) Nuclear hormone receptor HR38 {Frui | 3e-04 | |
| d1pq9a_ | 239 | a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human | 9e-23 | |
| d1pq9a_ | 239 | a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human | 5e-04 | |
| d2qw4a1 | 233 | a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 | 9e-23 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 9e-22 | |
| d1osha_ | 231 | a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo | 4e-04 | |
| d2b50b1 | 265 | a.123.1.1 (B:211-475) Peroxisome proliferator-acti | 1e-21 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 1e-21 | |
| d1nrla_ | 292 | a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Ho | 8e-04 | |
| d2fvja1 | 271 | a.123.1.1 (A:207-477) Peroxisome proliferator acti | 5e-21 | |
| d1n46a_ | 251 | a.123.1.1 (A:) Thyroid hormone receptor beta (TR-b | 1e-20 | |
| d1xvpb_ | 246 | a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) | 4e-20 | |
| d2r40d1 | 243 | a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid m | 9e-20 | |
| d2p54a1 | 267 | a.123.1.1 (A:202-468) Peroxisome proliferator acti | 1e-19 | |
| d1ie9a_ | 255 | a.123.1.1 (A:) Vitamin D nuclear receptor {Human ( | 5e-19 | |
| d1xnxa_ | 232 | a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) | 2e-18 | |
| d1nq7a_ | 244 | a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {R | 3e-17 | |
| d1n83a_ | 251 | a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha { | 6e-17 |
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Hepatocyte nuclear factor 4-alpha species: Human (Homo sapiens) [TaxId: 9606]
Score = 108 bits (271), Expect = 5e-29
Identities = 39/117 (33%), Positives = 53/117 (45%), Gaps = 1/117 (0%)
Query: 1 MGIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHV 60
I ++CE L VEWA+ IP F +L + DQVALLR E +L A++ SM
Sbjct: 37 ASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFKD 96
Query: 61 APLLAAAGLHASPMAADRVVAFMDHIRVFQEQVEKLKALHVDSAEYSCLKAIVLFTT 117
LL + IR+ E V + L +D EY+ LKAI+ F
Sbjct: 97 VLLL-GNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDP 152
|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} Length = 256 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} Length = 265 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 247 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 227 | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} Length = 250 | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} Length = 230 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 236 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 230 | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} Length = 239 | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} Length = 233 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} Length = 231 | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} Length = 265 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} Length = 246 | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} Length = 243 | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 267 | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 255 | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} Length = 232 | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 244 | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 251 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 295 | |||
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 100.0 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 100.0 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 100.0 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 100.0 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 100.0 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.97 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.97 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 99.97 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 99.97 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.97 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 99.97 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 99.97 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 99.97 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 99.97 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 99.97 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 99.97 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.96 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 99.96 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 99.96 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 99.96 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.96 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 99.96 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.96 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 99.96 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 99.96 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 99.95 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 99.95 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 99.95 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 99.95 | |
| d2e2ra1 | 223 | Orphan nuclear receptor ERR3 {Human (Homo sapiens) | 99.2 | |
| d3d24a1 | 227 | Steroid hormone receptor ERR1 {Human (Homo sapiens | 99.19 | |
| d1t7ra_ | 250 | Androgen receptor {Chimpanzee (Pan troglodytes) [T | 99.16 | |
| d1xpca_ | 245 | Estrogen receptor alpha {Human (Homo sapiens) [Tax | 99.15 | |
| d1sqna_ | 251 | Progesterone receptor {Human (Homo sapiens) [TaxId | 99.14 | |
| d1nhza_ | 247 | Glucocorticoid receptor {Human (Homo sapiens) [Tax | 99.08 | |
| d2j7ya1 | 236 | Estrogen receptor beta {Rat (Rattus norvegicus) [T | 99.05 | |
| d1pk5a_ | 242 | Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus | 98.94 | |
| d1g2na_ | 256 | Ultraspiracle protein, usp {Heliothis virescens [T | 98.91 | |
| d2p1ta1 | 230 | Retinoid-X receptor alpha (RXR-alpha) {Human (Homo | 98.88 | |
| d1hg4a_ | 265 | Ultraspiracle protein, usp {Drosophila melanogaste | 98.88 | |
| d1pzla_ | 233 | Hepatocyte nuclear factor 4-alpha {Human (Homo sap | 98.88 | |
| d2qw4a1 | 233 | Orphan nuclear receptor NR4A1 {Human (Homo sapiens | 98.85 | |
| d1fcya_ | 236 | Retinoic acid receptor gamma (RAR-gamma) {Human (H | 98.8 | |
| d1pdua_ | 230 | Nuclear hormone receptor HR38 {Fruit fly (Drosophi | 98.8 | |
| d1ovla_ | 236 | Orphan nuclear receptor NURR1 {Human (Homo sapiens | 98.79 | |
| d1osha_ | 231 | Bile acid receptor FXR {Human (Homo sapiens) [TaxI | 98.74 | |
| d1n46a_ | 251 | Thyroid hormone receptor beta (TR-beta) {Human (Ho | 98.71 | |
| d1pq9a_ | 239 | Oxysterols receptor LXR-beta {Human (Homo sapiens) | 98.67 | |
| d1ie9a_ | 255 | Vitamin D nuclear receptor {Human (Homo sapiens) [ | 98.65 | |
| d1xvpb_ | 246 | Orphan nuclear receptor NR1I3 (CAR) {Human (Homo s | 98.58 | |
| d2r40d1 | 243 | Ecdysone receptor {Noctuid moth (Heliothis viresce | 98.57 | |
| d1xnxa_ | 232 | Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus mu | 98.5 | |
| d2fvja1 | 271 | Peroxisome proliferator activated receptor gamma, | 98.4 | |
| d1n83a_ | 251 | Orphan nuclear receptor ROR-alpha {Human (Homo sap | 98.35 | |
| d1nrla_ | 292 | Pregnane x receptor, PXR {Human (Homo sapiens) [Ta | 98.29 | |
| d2b50b1 | 265 | Peroxisome proliferator-activated receptor delta, | 98.24 | |
| d1nq7a_ | 244 | Orphan nuclear receptor ROR-beta {Rat (Rattus norv | 98.24 | |
| d2p54a1 | 267 | Peroxisome proliferator activated receptor alpha, | 98.23 | |
| d1dszb_ | 84 | Retinoid X receptor (RXR-alpha) DNA-binding domain | 97.5 | |
| d1lo1a_ | 90 | Steroid hormone receptor Err2 DNA-binding domain { | 97.5 | |
| d1dsza_ | 75 | Retinoic acid receptor DNA-binding domain {Human ( | 97.41 | |
| d2hanb1 | 83 | Ecdysone receptor DNA-binding domain {Fruit fly (D | 97.39 | |
| d1kb2a_ | 89 | Vitamin D3 receptor, VDR, DNA-binding domain {Huma | 97.39 | |
| d1a6ya_ | 78 | Orphan nuclear receptor reverb DNA-binding domain | 97.34 | |
| d1cita_ | 89 | Orphan nuclear receptor NGFI-B DNA-binding domain | 97.3 | |
| d1r4ia_ | 74 | Androgen receptor {Rat (Rattus norvegicus) [TaxId: | 97.29 | |
| d1lata_ | 71 | Glucocorticoid receptor DNA-binding domain {Rat (R | 97.14 | |
| d1hcqa_ | 74 | Estrogen receptor DNA-binding domain {Human and ch | 97.04 | |
| d2nllb_ | 103 | Thyroid hormone receptor (TR-beta) DNA-binding dom | 96.81 |
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Nuclear receptor ligand-binding domain superfamily: Nuclear receptor ligand-binding domain family: Nuclear receptor ligand-binding domain domain: Ultraspiracle protein, usp species: Heliothis virescens [TaxId: 7102]
Probab=100.00 E-value=6.4e-34 Score=244.40 Aligned_cols=176 Identities=22% Similarity=0.359 Sum_probs=143.4
Q ss_pred cHHHHHHHHHHHHHHHHhHhhcCCCCCCCCHHHHHHHHHHHHHHHHHHHhhHhhcCCCCccee-----------------
Q psy1615 2 GIDNICELAARLLFSAVEWARNIPFFPDLQVTDQVALLRLVWSELFVLNASQCSMPLHVAPLL----------------- 64 (295)
Q Consensus 2 ~~~~~~~~~~~~l~~~v~waK~lp~F~~L~~~Dq~~LLk~~~~e~~~L~~a~~~~~~~~~~~~----------------- 64 (295)
.++++|+++++.++.+|+|||++|+|..|+.+||+.|||++|.|+++|+.||++++.......
T Consensus 43 ~~~~lc~~~~~~L~~~VewAK~lP~F~~L~~~DQi~LLk~~w~el~iL~~a~rs~~~~~~~~~~~~~~~~~~~~~~~~~~ 122 (256)
T d1g2na_ 43 PVSSLCQIGNKQIAALVVWARDIPHFSQLEMEDQILLIKGSWNELLLFAIAWRSMEFLTEERDGVDGTGNRTTSPPQLMC 122 (256)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHSTTGGGSCHHHHHHHHHHHHHHHHHHHHHHHHGGGSCCC----------CCCCCCEEE
T ss_pred HHHHHHHHHHHHHHHHHHHHhcCCChhhCCHHHHHHHHHHHHHHHHHHHHHHHHhhhccccccccccccccccCcchhhc
Confidence 368999999999999999999999999999999999999999999999999999876544322
Q ss_pred ecCCcccChhhHHHHHHHHHHH-HHHHHHHHHHHHcCCCHHHHHHHHHHHhccCCcccccccchhHHHHHHHHHHHHHH-
Q psy1615 65 AAAGLHASPMAADRVVAFMDHI-RVFQEQVEKLKALHVDSAEYSCLKAIVLFTTGKRIFTGVLLKALHVDSAEYSCLKA- 142 (295)
Q Consensus 65 ~~~~~~~~~~~~~~~~~~~~~~-~~l~~~~~~l~~L~ld~~E~~lLkai~L~~pd~~~l~~~l~~~~~i~~~q~~~l~~- 142 (295)
+.+|....... ....++.+.+ +.+.+++.+|++|++|++||+|||||+|||||++ |+++...|+.+|++++.+
T Consensus 123 ~~~~~~~~~~~-~~~~~~~~~~~~~l~~l~~~~~~L~ld~~E~~~LkaIvLfnpd~~----gL~~~~~Ie~lqe~~~~aL 197 (256)
T d1g2na_ 123 LMPGMTLHRNS-ALQAGVGQIFDRVLSELSLKMRTLRVDQAEYVALKAIILLNPDVK----GLKNRQEVEVLREKMFLCL 197 (256)
T ss_dssp EETTEEEEHHH-HHHHTCHHHHHHHHHHTHHHHHHTTCCHHHHHHHHHHHHSCTTCT----TCSCHHHHHHHHHHHHHHH
T ss_pred cCCCcccCHHH-HHhcchHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhcCccC----CcccHHHHHHHHHHHHHHH
Confidence 22222222211 1122233322 5678999999999999999999999999999999 888999999999998544
Q ss_pred --Hhh--CCCCCCccccccccc-------------chhhhhhcCCCccchhhhhhhc
Q psy1615 143 --IVL--FTTGKRMFGKPLPLN-------------QHYTATISNVPLSSSLSTAVQR 182 (295)
Q Consensus 143 --l~~--~~~~~~Rf~~lLl~~-------------~y~~r~~~~c~id~l~r~~~q~ 182 (295)
|++ ||++|.|||+||+++ +++.+.+|+.+|+.++.+++.+
T Consensus 198 ~~y~~~~~p~~~~Rf~~LLl~Lp~LR~l~~~~~e~lff~~l~g~~~i~~ll~eml~~ 254 (256)
T d1g2na_ 198 DEYCRRSRSSEEGRFAALLLRLPALRSISLKSFEHLFFFHLVADTSIAGYIRDALRN 254 (256)
T ss_dssp HHHHHHHSTTCTTHHHHHHTHHHHHHHHHHHHHHHHHHTTCBCTTTHHHHHHHHHTC
T ss_pred HHHHHhcCCChhhHHHHHHHHHHHHHHHHHHHHHHHhcccccCCCChHHHHHHHHhc
Confidence 554 899999999988877 4667889999999999998864
|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2e2ra1 a.123.1.1 (A:234-456) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d24a1 a.123.1.1 (A:194-420) Steroid hormone receptor ERR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t7ra_ a.123.1.1 (A:) Androgen receptor {Chimpanzee (Pan troglodytes) [TaxId: 9598]} | Back information, alignment and structure |
|---|
| >d1xpca_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqna_ a.123.1.1 (A:) Progesterone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhza_ a.123.1.1 (A:) Glucocorticoid receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ya1 a.123.1.1 (A:217-452) Estrogen receptor beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pk5a_ a.123.1.1 (A:) Orphan nuclear receptor NR5a2 (LRH-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g2na_ a.123.1.1 (A:) Ultraspiracle protein, usp {Heliothis virescens [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d2p1ta1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hg4a_ a.123.1.1 (A:) Ultraspiracle protein, usp {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pzla_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qw4a1 a.123.1.1 (A:32-264) Orphan nuclear receptor NR4A1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcya_ a.123.1.1 (A:) Retinoic acid receptor gamma (RAR-gamma) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pdua_ a.123.1.1 (A:) Nuclear hormone receptor HR38 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ovla_ a.123.1.1 (A:) Orphan nuclear receptor NURR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osha_ a.123.1.1 (A:) Bile acid receptor FXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n46a_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pq9a_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ie9a_ a.123.1.1 (A:) Vitamin D nuclear receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xvpb_ a.123.1.1 (B:) Orphan nuclear receptor NR1I3 (CAR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r40d1 a.123.1.1 (D:287-529) Ecdysone receptor {Noctuid moth (Heliothis virescens) [TaxId: 7102]} | Back information, alignment and structure |
|---|
| >d1xnxa_ a.123.1.1 (A:) Orphan nuclear receptor NR1I3 (CAR) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fvja1 a.123.1.1 (A:207-477) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n83a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrla_ a.123.1.1 (A:) Pregnane x receptor, PXR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b50b1 a.123.1.1 (B:211-475) Peroxisome proliferator-activated receptor delta, PPAR-DELTA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nq7a_ a.123.1.1 (A:) Orphan nuclear receptor ROR-beta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2p54a1 a.123.1.1 (A:202-468) Peroxisome proliferator activated receptor alpha, PPAR-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dszb_ g.39.1.2 (B:) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lo1a_ g.39.1.2 (A:) Steroid hormone receptor Err2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dsza_ g.39.1.2 (A:) Retinoic acid receptor DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hanb1 g.39.1.2 (B:5-87) Ecdysone receptor DNA-binding domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1kb2a_ g.39.1.2 (A:) Vitamin D3 receptor, VDR, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a6ya_ g.39.1.2 (A:) Orphan nuclear receptor reverb DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cita_ g.39.1.2 (A:) Orphan nuclear receptor NGFI-B DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r4ia_ g.39.1.2 (A:) Androgen receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lata_ g.39.1.2 (A:) Glucocorticoid receptor DNA-binding domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hcqa_ g.39.1.2 (A:) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nllb_ g.39.1.2 (B:) Thyroid hormone receptor (TR-beta) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|