Psyllid ID: psy16179

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MVGRVKLNTMLCWPRPESITTPATTLSLELPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSEH
cccEEEEcEEEEccccccccccccccccccHHHHHHHHHHHHHccEEEEEEEEEEEHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccEEEEEccccHHHHHHccccEEEEEEEEccccHHHHHcccccc
cccEEEEccEccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHEHccccEcHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHcEEEEEEcccccHHHHHcccc
mvgrvklntmlcwprpesittpattlslelpvDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLskmqcpnsvWVLSCVYRKSEIEYYAMLAKTGVhhytgnnielgtACGKYFRVCTLsitdagdsdiirsmpseh
mvgrvklntmlcwprpesittpattlsleLPVDVWTSiarisnkvlVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSItdagdsdiirsmpseh
MVGRVKLNTMLCWPRPESITTPATTLSLELPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSEH
*****************************LPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAG************
****VKLNTMLCWPRPESITTPATTLSLELPVDVWTS*********VLKTIITLSKLFRN*****HLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDI*RSM****
MVGRVKLNTMLCWPRPESITTPATTLSLELPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSEH
*VGRVKLNTMLCWPRPESITTPATTLSLELPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRS*P***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGRVKLNTMLCWPRPESITTPATTLSLELPVDVWTSIARISNKVLVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVLSCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query145 2.2.26 [Sep-21-2011]
P58374114 60S ribosomal protein L30 N/A N/A 0.386 0.491 0.928 8e-27
P67884115 60S ribosomal protein L30 N/A N/A 0.386 0.486 0.875 4e-25
P67883115 60S ribosomal protein L30 yes N/A 0.386 0.486 0.875 4e-25
P62890115 60S ribosomal protein L30 yes N/A 0.386 0.486 0.875 4e-25
P62889115 60S ribosomal protein L30 yes N/A 0.386 0.486 0.875 4e-25
Q76KA2115 60S ribosomal protein L30 N/A N/A 0.386 0.486 0.875 4e-25
P62888115 60S ribosomal protein L30 yes N/A 0.386 0.486 0.875 4e-25
Q3T0D5115 60S ribosomal protein L30 yes N/A 0.386 0.486 0.875 4e-25
P58372116 60S ribosomal protein L30 N/A N/A 0.393 0.491 0.842 6e-25
Q9M5M6112 60S ribosomal protein L30 N/A N/A 0.393 0.508 0.824 4e-24
>sp|P58374|RL30_BRABE 60S ribosomal protein L30 OS=Branchiostoma belcheri GN=RPL30 PE=3 SV=1 Back     alignment and function desciption
 Score =  119 bits (297), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 52/56 (92%), Positives = 55/56 (98%)

Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSE 144
           RKSEIEYYAMLAKTGVHHY+GNNIELGTACGKYFRVCTL+ITD GDSDIIRSMP+E
Sbjct: 53  RKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYFRVCTLAITDPGDSDIIRSMPAE 108

Branchiostoma belcheri (taxid: 7741)
>sp|P67884|RL30_OPHHA 60S ribosomal protein L30 OS=Ophiophagus hannah GN=RPL30 PE=3 SV=2 Back     alignment and function description
>sp|P67883|RL30_CHICK 60S ribosomal protein L30 OS=Gallus gallus GN=RPL30 PE=3 SV=2 Back     alignment and function description
>sp|P62890|RL30_RAT 60S ribosomal protein L30 OS=Rattus norvegicus GN=Rpl30 PE=3 SV=2 Back     alignment and function description
>sp|P62889|RL30_MOUSE 60S ribosomal protein L30 OS=Mus musculus GN=Rpl30 PE=2 SV=2 Back     alignment and function description
>sp|Q76KA2|RL30_MACFA 60S ribosomal protein L30 OS=Macaca fascicularis GN=RPL30 PE=3 SV=3 Back     alignment and function description
>sp|P62888|RL30_HUMAN 60S ribosomal protein L30 OS=Homo sapiens GN=RPL30 PE=1 SV=2 Back     alignment and function description
>sp|Q3T0D5|RL30_BOVIN 60S ribosomal protein L30 OS=Bos taurus GN=RPL30 PE=3 SV=3 Back     alignment and function description
>sp|P58372|RL30_ICTPU 60S ribosomal protein L30 OS=Ictalurus punctatus GN=rpl30 PE=3 SV=2 Back     alignment and function description
>sp|Q9M5M6|RL30_EUPES 60S ribosomal protein L30 OS=Euphorbia esula GN=RPL30 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
291225003114 PREDICTED: ribosomal protein L30-like [S 0.393 0.5 0.964 5e-26
22758848114 ribosomal protein L30 [Argopecten irradi 0.393 0.5 0.947 9e-26
170586642112 60S ribosomal protein L30 [Brugia malayi 0.393 0.508 0.947 3e-25
312077659112 60S ribosomal protein L30 [Loa loa] gi|3 0.386 0.5 0.964 4e-25
260815307114 hypothetical protein BRAFLDRAFT_259607 [ 0.386 0.491 0.928 5e-25
17368245114 RecName: Full=60S ribosomal protein L30 0.386 0.491 0.928 5e-25
197210409113 60S ribosomal protein L30 [Haplopelma sc 0.393 0.504 0.894 6e-25
156398719118 predicted protein [Nematostella vectensi 0.393 0.483 0.929 6e-25
40597216694 60S ribosomal protein L30 [Crassostrea g 0.379 0.585 0.981 7e-25
321453211118 hypothetical protein DAPPUDRAFT_304893 [ 0.379 0.466 0.945 8e-25
>gi|291225003|ref|XP_002732487.1| PREDICTED: ribosomal protein L30-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 55/57 (96%), Positives = 55/57 (96%)

Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSEH 145
           RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITD GDSDIIRSMPSE 
Sbjct: 56  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDPGDSDIIRSMPSEQ 112

Source: Saccoglossus kowalevskii

Species: Saccoglossus kowalevskii

Genus: Saccoglossus

Family: Harrimaniidae

Order:

Class: Enteropneusta

Phylum: Hemichordata

Superkingdom: Eukaryota
>gi|22758848|gb|AAN05584.1| ribosomal protein L30 [Argopecten irradians] Back     alignment and taxonomy information
>gi|170586642|ref|XP_001898088.1| 60S ribosomal protein L30 [Brugia malayi] gi|158594483|gb|EDP33067.1| 60S ribosomal protein L30, putative [Brugia malayi] Back     alignment and taxonomy information
>gi|312077659|ref|XP_003141401.1| 60S ribosomal protein L30 [Loa loa] gi|307763431|gb|EFO22665.1| 60S ribosomal protein L30 [Loa loa] Back     alignment and taxonomy information
>gi|260815307|ref|XP_002602415.1| hypothetical protein BRAFLDRAFT_259607 [Branchiostoma floridae] gi|229287724|gb|EEN58427.1| hypothetical protein BRAFLDRAFT_259607 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|17368245|sp|P58374.1|RL30_BRABE RecName: Full=60S ribosomal protein L30 gi|15825505|gb|AAL09707.1|AF420432_1 ribosomal protein L30 [Branchiostoma belcheri] gi|28200299|gb|AAO31781.1| ribosomal protein L30 [Branchiostoma belcheri tsingtauense] Back     alignment and taxonomy information
>gi|197210409|gb|ACH48212.1| 60S ribosomal protein L30 [Haplopelma schmidti] Back     alignment and taxonomy information
>gi|156398719|ref|XP_001638335.1| predicted protein [Nematostella vectensis] gi|156225455|gb|EDO46272.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|405972166|gb|EKC36952.1| 60S ribosomal protein L30 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|321453211|gb|EFX64469.1| hypothetical protein DAPPUDRAFT_304893 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query145
UNIPROTKB|G1K316108 RPL30 "60S ribosomal protein L 0.386 0.518 0.875 2.9e-23
UNIPROTKB|P67883115 RPL30 "60S ribosomal protein L 0.386 0.486 0.875 2.9e-23
UNIPROTKB|Q3T0D5115 RPL30 "60S ribosomal protein L 0.386 0.486 0.875 2.9e-23
UNIPROTKB|E5RI99114 RPL30 "60S ribosomal protein L 0.386 0.491 0.875 2.9e-23
UNIPROTKB|P62888115 RPL30 "60S ribosomal protein L 0.386 0.486 0.875 2.9e-23
UNIPROTKB|F2Z554115 RPL30 "Uncharacterized protein 0.386 0.486 0.875 2.9e-23
MGI|MGI:98037115 Rpl30 "ribosomal protein L30" 0.386 0.486 0.875 2.9e-23
RGD|621201115 Rpl30 "ribosomal protein L30" 0.386 0.486 0.875 2.9e-23
ZFIN|ZDB-GENE-030131-8657117 rpl30 "ribosomal protein L30" 0.386 0.478 0.875 2.9e-23
UNIPROTKB|E1B8L7115 E1B8L7 "Uncharacterized protei 0.386 0.486 0.875 4.8e-23
UNIPROTKB|G1K316 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 268 (99.4 bits), Expect = 2.9e-23, P = 2.9e-23
 Identities = 49/56 (87%), Positives = 53/56 (94%)

Query:    89 RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSE 144
             RKSEIEYYAMLAKTGVHHY+GNNIELGTACGKY+RVCTL+I D GDSDIIRSMP +
Sbjct:    49 RKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQ 104
GO:0003735 "structural constituent of ribosome" evidence=IEA
GO:0006412 "translation" evidence=IEA
GO:0022625 "cytosolic large ribosomal subunit" evidence=IEA
UNIPROTKB|P67883 RPL30 "60S ribosomal protein L30" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0D5 RPL30 "60S ribosomal protein L30" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E5RI99 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P62888 RPL30 "60S ribosomal protein L30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z554 RPL30 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98037 Rpl30 "ribosomal protein L30" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621201 Rpl30 "ribosomal protein L30" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8657 rpl30 "ribosomal protein L30" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1B8L7 E1B8L7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P67883RL30_CHICKNo assigned EC number0.8750.38620.4869yesN/A
Q2FPJ8RL30E_METHJNo assigned EC number0.51210.26890.4105yesN/A
P62890RL30_RATNo assigned EC number0.8750.38620.4869yesN/A
P52808RL30A_SCHPONo assigned EC number0.760.34480.4587yesN/A
Q6FXZ0RL30_CANGANo assigned EC number0.60710.38620.5333yesN/A
Q3T0D5RL30_BOVINNo assigned EC number0.8750.38620.4869yesN/A
Q8VZ19RL302_ARATHNo assigned EC number0.75430.39310.5089yesN/A
P14120RL30_YEASTNo assigned EC number0.60710.38620.5333yesN/A
Q55BS9RL30_DICDINo assigned EC number0.6250.38620.5yesN/A
Q6C4U7RL30_YARLINo assigned EC number0.70.34480.4587yesN/A
Q752U5RL30_ASHGONo assigned EC number0.58920.38620.5333yesN/A
P58374RL30_BRABENo assigned EC number0.92850.38620.4912N/AN/A
P62888RL30_HUMANNo assigned EC number0.8750.38620.4869yesN/A
P62889RL30_MOUSENo assigned EC number0.8750.38620.4869yesN/A
P39095RL30_LEIMANo assigned EC number0.65300.33790.4711yesN/A
P38664RL30_KLULANo assigned EC number0.60710.38620.5333yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
PTZ00106108 PTZ00106, PTZ00106, 60S ribosomal protein L30; Pro 9e-33
COG1911100 COG1911, RPL30, Ribosomal protein L30E [Translatio 1e-21
PRK0101899 PRK01018, PRK01018, 50S ribosomal protein L30e; Re 7e-14
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 1e-09
>gnl|CDD|185450 PTZ00106, PTZ00106, 60S ribosomal protein L30; Provisional Back     alignment and domain information 
 Score =  111 bits (279), Expect = 9e-33
 Identities = 40/52 (76%), Positives = 48/52 (92%)

Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRS 140
           R+SEIEYYAML+KTGVHHY GNN +LGTACG++FRV  +SITDAGDSDI+R+
Sbjct: 55  RRSEIEYYAMLSKTGVHHYAGNNNDLGTACGRHFRVSVMSITDAGDSDILRA 106

Length = 108
>gnl|CDD|224823 COG1911, RPL30, Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179205 PRK01018, PRK01018, 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 145
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.98
PTZ00106108 60S ribosomal protein L30; Provisional 99.95
PRK0101899 50S ribosomal protein L30e; Reviewed 99.94
KOG2988|consensus112 99.93
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.89
PRK07714100 hypothetical protein; Provisional 99.88
PRK0728398 hypothetical protein; Provisional 99.88
PRK0668382 hypothetical protein; Provisional 99.85
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.84
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.82
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.81
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.75
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.67
PRK09190220 hypothetical protein; Provisional 99.66
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.58
PTZ00222263 60S ribosomal protein L7a; Provisional 99.14
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 98.78
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 98.7
KOG3406|consensus134 97.36
KOG3167|consensus153 94.41
KOG3387|consensus131 91.94
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=99.98  E-value=7.3e-33  Score=205.30  Aligned_cols=86  Identities=36%  Similarity=0.579  Sum_probs=83.0

Q ss_pred             hhHHHHhhCceeechhhhHhhHHHHHhhhcCCCeEEEE----eccchhHHHHHHHHhhCCcEEEEccCcchhhhhhCCCc
Q psy16179         47 VLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVL----SCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYF  122 (145)
Q Consensus        47 ~~k~a~~aGk~~~G~~~~i~~~~~VlkaiK~gkAkLVI----aP~ntKkkIEyyAkL~kVPV~~y~Gtn~ELG~AcGK~F  122 (145)
                      -||+|+++|||+.|++       +++|++|.|++||||    ||++.|++|||||+|+++|||+|+|||+|||.+|||||
T Consensus        10 ~L~~avkTGkvilG~k-------~tiK~lk~gkaKliiiAsN~P~~~k~~ieyYAkLs~ipV~~y~Gt~~eLG~~cgkpf   82 (100)
T COG1911          10 ELKLAVKTGKVILGSK-------RTIKSLKLGKAKLIIIASNCPKELKEDIEYYAKLSDIPVYVYEGTSVELGTVCGKPF   82 (100)
T ss_pred             HHHHHHhcCCEEEehH-------HHHHHHHcCCCcEEEEecCCCHHHHHHHHHHHHHcCCcEEEecCCceeHHhhhCCCc
Confidence            4899999999999999       578889999999999    99999999999999999999999999999999999999


Q ss_pred             ceEEEEEecCCchHHHh
Q psy16179        123 RVCTLSITDAGDSDIIR  139 (145)
Q Consensus       123 RVSvLAItD~G~SdIL~  139 (145)
                      ||+++||+|+|+|+||.
T Consensus        83 ~v~~laIiD~G~S~Il~   99 (100)
T COG1911          83 RVAALAIIDEGDSDILA   99 (100)
T ss_pred             eEEEEEEecCchhhhhc
Confidence            99999999999999985

>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>KOG2988|consensus Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>KOG3406|consensus Back     alignment and domain information
>KOG3167|consensus Back     alignment and domain information
>KOG3387|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
2zkr_6115 Structure Of A Mammalian Ribosomal 60s Subunit With 4e-26
3vi6_A125 Crystal Structure Of Human L30e Length = 125 5e-26
1ysh_C104 Localization And Dynamic Behavior Of Ribosomal Prot 2e-19
3zf7_g105 High-resolution Cryo-electron Microscopy Structure 6e-18
4a18_G104 T.Thermophila 60s Ribosomal Subunit In Complex With 9e-17
3izr_f112 Localization Of The Large Subunit Ribosomal Protein 2e-15
1t0k_B105 Joint X-ray And Nmr Refinement Of Yeast L30e-mrna C 5e-15
1ck2_A104 Yeast (Saccharomyces Cerevisiae) Ribosomal Protein 5e-15
3jyw_298 Structure Of The 60s Proteins For Eukaryotic Riboso 6e-15
2bo1_A101 Crystal Structure Of A Hybrid Ribosomal Protein L30 1e-08
3j21_Z99 Promiscuous Behavior Of Proteins In Archaeal Riboso 1e-06
1w3e_X101 Ribosomal L30e Of Thermococcus Celer, P59a Mutant L 1e-05
3n4z_A101 Crystal Structure Of Quintuple Arg-To-Lys Variant O 1e-05
3n4y_A101 Crystal Structure Of Wild-Type T. Celer L30e In Low 2e-05
1w40_A101 T. Celer L30e K9a Variant Length = 101 2e-05
1w42_A101 T. Celer L30e R92a Variant Length = 101 2e-05
3ra5_A101 Crystal Structure Of T. Celer L30e E6aR92A VARIANT 2e-05
1h7m_A102 Ribosomal Protein L30e From Thermococcus Celer Leng 3e-05
1w41_A101 T.Celer L30e E90a Variant Length = 101 6e-05
3lfo_A101 Crystal Structure Of T. Celer L30e E90aR92A VARIANT 6e-05
3ra6_A101 Crystal Structure Of T. Celer L30e E62aK46A VARIANT 1e-04
3cpq_A110 Crystal Structure Of L30e A Ribosomal Protein From 8e-04
>pdb|2ZKR|6 Chain 6, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 115 Back     alignment and structure 
Iteration: 1

 Score =  113 bits (282), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 53/56 (94%)
Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSE 144
           RKSEIEYYAMLAKTGVHHY+GNNIELGTACGKY+RVCTL+I D GDSDIIRSMP +
Sbjct: 56  RKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQ 111
>pdb|3VI6|A Chain A, Crystal Structure Of Human L30e Length = 125 Back     alignment and structure
>pdb|1YSH|C Chain C, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 104 Back     alignment and structure
>pdb|3ZF7|GG Chain g, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 105 Back     alignment and structure
>pdb|4A18|G Chain G, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 26s Rrna And Proteins Of Molecule 1 Length = 104 Back     alignment and structure
>pdb|3IZR|FF Chain f, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 112 Back     alignment and structure
>pdb|1T0K|B Chain B, Joint X-ray And Nmr Refinement Of Yeast L30e-mrna Complex Length = 105 Back     alignment and structure
>pdb|1CK2|A Chain A, Yeast (Saccharomyces Cerevisiae) Ribosomal Protein L30 Length = 104 Back     alignment and structure
>pdb|3JYW|2 Chain 2, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 98 Back     alignment and structure
>pdb|2BO1|A Chain A, Crystal Structure Of A Hybrid Ribosomal Protein L30e With Surface Residues From T. Celer, And Core Residues From Yeast Length = 101 Back     alignment and structure
>pdb|3J21|Z Chain Z, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 99 Back     alignment and structure
>pdb|1W3E|X Chain X, Ribosomal L30e Of Thermococcus Celer, P59a Mutant Length = 101 Back     alignment and structure
>pdb|3N4Z|A Chain A, Crystal Structure Of Quintuple Arg-To-Lys Variant Of T. Celer L30e Length = 101 Back     alignment and structure
>pdb|3N4Y|A Chain A, Crystal Structure Of Wild-Type T. Celer L30e In Low Ionic Strength Condition Without Precipitant Length = 101 Back     alignment and structure
>pdb|1W40|A Chain A, T. Celer L30e K9a Variant Length = 101 Back     alignment and structure
>pdb|1W42|A Chain A, T. Celer L30e R92a Variant Length = 101 Back     alignment and structure
>pdb|3RA5|A Chain A, Crystal Structure Of T. Celer L30e E6aR92A VARIANT Length = 101 Back     alignment and structure
>pdb|1H7M|A Chain A, Ribosomal Protein L30e From Thermococcus Celer Length = 102 Back     alignment and structure
>pdb|1W41|A Chain A, T.Celer L30e E90a Variant Length = 101 Back     alignment and structure
>pdb|3LFO|A Chain A, Crystal Structure Of T. Celer L30e E90aR92A VARIANT Length = 101 Back     alignment and structure
>pdb|3RA6|A Chain A, Crystal Structure Of T. Celer L30e E62aK46A VARIANT Length = 101 Back     alignment and structure
>pdb|3CPQ|A Chain A, Crystal Structure Of L30e A Ribosomal Protein From Methanocaldococcus Jannaschii Dsm2661 (Mj1044) Length = 110 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query145
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 2e-28
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 2e-28
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 6e-28
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 7e-28
1w41_A101 50S ribosomal protein L30E; electrostatic interact 1e-27
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 2e-25
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 1e-13
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 3e-12
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 2e-08
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 5e-07
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
 Score =  100 bits (251), Expect = 2e-28
 Identities = 49/56 (87%), Positives = 53/56 (94%)

Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSMPSE 144
           RKSEIEYYAMLAKTGVHHY+GNNIELGTACGKY+RVCTL+I D GDSDIIRSMP +
Sbjct: 57  RKSEIEYYAMLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQ 112
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.96
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.94
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.93
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.93
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.92
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.91
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.91
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.9
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.9
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.83
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.83
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.82
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.82
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 99.82
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 99.81
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.81
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 99.8
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.8
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.78
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.75
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.57
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.45
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.36
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.29
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 98.82
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 98.75
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 97.73
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 97.35
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 97.21
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 145
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 1e-21
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 1e-19
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 7e-19
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 3e-13
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 3e-08
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 4e-08
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 9e-08
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 1e-06
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-05
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 80.6 bits (199), Expect = 1e-21
 Identities = 33/53 (62%), Positives = 43/53 (81%)

Query: 89  RKSEIEYYAMLAKTGVHHYTGNNIELGTACGKYFRVCTLSITDAGDSDIIRSM 141
           RKSE+EYYAML+KT V+++ G N ELGTA GK FRV  +SI +AGDSDI+ ++
Sbjct: 44  RKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSILEAGDSDILTTL 96
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query145
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.95
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.95
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.94
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.78
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.78
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.75
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.75
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.75
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 99.59
d2alea1126 Small nuclear ribonucleoprotein-associated protein 99.58
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 89.99
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Eukaryotic ribosomal protein L30 (L30e)
species: Archaeon Thermococcus celer [TaxId: 2264]

Probab=99.95  E-value=3.6e-29  Score=178.16  Aligned_cols=89  Identities=25%  Similarity=0.384  Sum_probs=85.5

Q ss_pred             hhhHHHHhhCceeechhhhHhhHHHHHhhhcCCCeEEEE----eccchhHHHHHHHHhhCCcEEEEccCcchhhhhhCCC
Q psy16179         46 LVLKTIITLSKLFRNQEMEIHLCLSFLSKMQCPNSVWVL----SCVYRKSEIEYYAMLAKTGVHHYTGNNIELGTACGKY  121 (145)
Q Consensus        46 ~~~k~a~~aGk~~~G~~~~i~~~~~VlkaiK~gkAkLVI----aP~ntKkkIEyyAkL~kVPV~~y~Gtn~ELG~AcGK~  121 (145)
                      .-||+|+|+||++.|++       +|++++++|+++|||    ||++++++|++||+.++||++.|.|++.|||++|||+
T Consensus         5 ~~L~~a~kaGklv~G~~-------~v~kal~~gkaklVilA~D~~~~~~~~i~~~c~~~~Ip~~~~~~t~~eLG~a~Gk~   77 (98)
T d1w3ex1           5 FELRKAQDTGKIVMGAR-------KSIQYAKMGGAKLIIVARNARPDIKEDIEYYARLSGIAVYEFEGTSVELGTLLGRP   77 (98)
T ss_dssp             HHHHHHHHHSEEEESHH-------HHHHHHHHTCCSEEEEETTSCHHHHHHHHHHHHHHTCEEEEESSCHHHHHHHTTCS
T ss_pred             HHHHHHHHhCCEEEcHH-------HHHHHHHcCCccEEEEECCCCHHHHHHHHHHHHhcCCCeEEECCCHHHHHHHhCCC
Confidence            35899999999999999       699999999999999    9999999999999999999999999999999999999


Q ss_pred             cceEEEEEecCCchHHHhcC
Q psy16179        122 FRVCTLSITDAGDSDIIRSM  141 (145)
Q Consensus       122 FRVSvLAItD~G~SdIL~~l  141 (145)
                      |++|+++|+|+||||||...
T Consensus        78 ~~vs~vaI~d~G~s~i~~l~   97 (98)
T d1w3ex1          78 HTVSALAVVDPGESRILALG   97 (98)
T ss_dssp             SCCCEEEEEECTTCCGGGGC
T ss_pred             CCEEEEEEeccCHHHHHHhc
Confidence            99999999999999999764
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure