Psyllid ID: psy16189


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MSLGQVSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccEEEEccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccEEEEEcccEccHHHHHHHHHHHHHHcccccccccccccEEEEEcc
mslgqvsgnEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKetltcpsckvkrkdavltkcfHVFCWDCLRTRYetrqrkcpkcnaafgandyhrlyles
mslgqvsgNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKtssleaeayktkRLQEEIAqlrrktermkkieqagtldevMMEEIREYketltcpsckvkrkdavltkcFHVFCWDCLRTRyetrqrkcpkcnaafgandyhrlyles
MSLGQVSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
*******************************************************************DILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHL**********************************************************************************VMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYL**
************************************************************************************************************************************************************************************RMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
*********EEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
*S***VSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLGQVSGNEEEALLNEMEVTGQAxxxxxxxxxxxxxxxxxxxxxNFKLMTERIKSNQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHLRNQAMDLNKRKAIESAQSxxxxxxxxxxxxxxxxxxxxxVTEKTSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHRLYLES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query262 2.2.26 [Sep-21-2011]
Q9VRP91044 E3 ubiquitin-protein liga yes N/A 0.977 0.245 0.809 1e-121
Q5RAU71001 E3 ubiquitin-protein liga yes N/A 0.958 0.250 0.645 2e-92
O751501001 E3 ubiquitin-protein liga no N/A 0.958 0.250 0.645 2e-92
Q4R7K71001 E3 ubiquitin-protein liga N/A N/A 0.958 0.250 0.645 3e-92
Q8CJB91002 E3 ubiquitin-protein liga yes N/A 0.958 0.250 0.645 5e-92
Q3U3191001 E3 ubiquitin-protein liga yes N/A 0.958 0.250 0.645 5e-92
A2VDP1975 E3 ubiquitin-protein liga no N/A 0.958 0.257 0.617 2e-83
Q5VTR2975 E3 ubiquitin-protein liga no N/A 0.958 0.257 0.617 2e-83
Q5DTM8973 E3 ubiquitin-protein liga no N/A 0.958 0.257 0.617 3e-83
Q5ZLS3984 E3 ubiquitin-protein liga yes N/A 0.958 0.255 0.613 7e-83
>sp|Q9VRP9|BRE1_DROME E3 ubiquitin-protein ligase Bre1 OS=Drosophila melanogaster GN=Bre1 PE=1 SV=2 Back     alignment and function desciption
 Score =  432 bits (1112), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/257 (80%), Positives = 233/257 (90%), Gaps = 1/257 (0%)

Query: 6    VSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLARE 65
            V  +EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLM+ERIK+NQLHKL RE
Sbjct: 788  VGSHEEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMSERIKANQLHKLLRE 847

Query: 66   EKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIE 125
            EK +L +Q+     QI+AMH  +RKLEEKER LQ  + ++EKEL LR QAM+++KRKAIE
Sbjct: 848  EKTVLEDQMATATTQIEAMHIVLRKLEEKERSLQATVASIEKELMLRQQAMEMHKRKAIE 907

Query: 126  SAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKI 185
            SAQSAADLKLHLEKYHAQ+KEAQQVV EKTSSLEAEAYKTKRLQEE+AQ +RK ERMKK+
Sbjct: 908  SAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELAQFKRKAERMKKM 967

Query: 186  EQAG-TLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCP 244
            E +G T+DEVM+EEIREYKETLTCPSCKVKRKDAVL+KCFHVFC+DCLRTRYETRQRKCP
Sbjct: 968  EMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQRKCP 1027

Query: 245  KCNAAFGANDYHRLYLE 261
            KCN AFGANDYHRLYL+
Sbjct: 1028 KCNCAFGANDYHRLYLQ 1044




E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-117' of histone H2B. H2B 'Lys-117' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It thereby plays a central role in histone code and gene regulation. Required for the expression of Notch target genes in development by affecting the levels of Su(H) in imaginal disk cells and stimulating the Su(H)-mediated transcription of Notch-specific genes.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5RAU7|BRE1B_PONAB E3 ubiquitin-protein ligase BRE1B OS=Pongo abelii GN=RNF40 PE=2 SV=1 Back     alignment and function description
>sp|O75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4 Back     alignment and function description
>sp|Q4R7K7|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1 Back     alignment and function description
>sp|Q8CJB9|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1 Back     alignment and function description
>sp|Q3U319|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2 Back     alignment and function description
>sp|A2VDP1|BRE1A_BOVIN E3 ubiquitin-protein ligase BRE1A OS=Bos taurus GN=RNF20 PE=2 SV=1 Back     alignment and function description
>sp|Q5VTR2|BRE1A_HUMAN E3 ubiquitin-protein ligase BRE1A OS=Homo sapiens GN=RNF20 PE=1 SV=2 Back     alignment and function description
>sp|Q5DTM8|BRE1A_MOUSE E3 ubiquitin-protein ligase BRE1A OS=Mus musculus GN=Rnf20 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZLS3|BRE1A_CHICK E3 ubiquitin-protein ligase BRE1A OS=Gallus gallus GN=RNF20 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
350402387 957 PREDICTED: E3 ubiquitin-protein ligase B 0.965 0.264 0.861 1e-124
340711825 957 PREDICTED: e3 ubiquitin-protein ligase B 0.965 0.264 0.861 1e-124
383857052 957 PREDICTED: E3 ubiquitin-protein ligase B 0.965 0.264 0.861 1e-124
380030127 953 PREDICTED: E3 ubiquitin-protein ligase B 0.965 0.265 0.861 1e-124
328778821 930 PREDICTED: e3 ubiquitin-protein ligase B 0.965 0.272 0.861 1e-124
332020263 676 E3 ubiquitin-protein ligase Bre1 [Acromy 0.965 0.374 0.861 1e-124
307199111 957 E3 ubiquitin-protein ligase Bre1 [Harpeg 0.965 0.264 0.857 1e-124
307180966 964 E3 ubiquitin-protein ligase Bre1 [Campon 0.965 0.262 0.857 1e-123
345483701 955 PREDICTED: E3 ubiquitin-protein ligase B 0.965 0.264 0.857 1e-123
193678945 953 PREDICTED: e3 ubiquitin-protein ligase B 0.965 0.265 0.845 1e-122
>gi|350402387|ref|XP_003486466.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Bombus impatiens] Back     alignment and taxonomy information
 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 218/253 (86%), Positives = 232/253 (91%)

Query: 10  EEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDI 69
           EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLMTERIKSNQLHKLAREEKD+
Sbjct: 705 EEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMTERIKSNQLHKLAREEKDV 764

Query: 70  LHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQS 129
           L EQV+ L  Q++A +  +RKLEEKER LQ  L  VEKEL LR QAM+++KRKAIESAQS
Sbjct: 765 LKEQVSTLTTQVEAANVVVRKLEEKERLLQNSLATVEKELALRQQAMEMHKRKAIESAQS 824

Query: 130 AADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAG 189
           AADLKLHLEKYH+Q+KEAQQVV EKTSSLEAEAYKTKRLQEEIAQLRRK ERMKKIE A 
Sbjct: 825 AADLKLHLEKYHSQMKEAQQVVAEKTSSLEAEAYKTKRLQEEIAQLRRKVERMKKIELAE 884

Query: 190 TLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAA 249
           TLDEVM EE+REYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCN A
Sbjct: 885 TLDEVMAEELREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNCA 944

Query: 250 FGANDYHRLYLES 262
           FGANDYHRLYL +
Sbjct: 945 FGANDYHRLYLST 957




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340711825|ref|XP_003394469.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383857052|ref|XP_003704020.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380030127|ref|XP_003698707.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Apis florea] Back     alignment and taxonomy information
>gi|328778821|ref|XP_625025.3| PREDICTED: e3 ubiquitin-protein ligase Bre1, partial [Apis mellifera] Back     alignment and taxonomy information
>gi|332020263|gb|EGI60697.1| E3 ubiquitin-protein ligase Bre1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307199111|gb|EFN79821.1| E3 ubiquitin-protein ligase Bre1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307180966|gb|EFN68754.1| E3 ubiquitin-protein ligase Bre1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345483701|ref|XP_001601663.2| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193678945|ref|XP_001949533.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query262
FB|FBgn00866941044 Bre1 "Bre1" [Drosophila melano 0.977 0.245 0.809 4.8e-110
UNIPROTKB|F8W8Z4693 RNF40 "E3 ubiquitin-protein li 0.958 0.362 0.645 2.4e-85
UNIPROTKB|H3BP71961 RNF40 "E3 ubiquitin-protein li 0.958 0.261 0.645 2.4e-85
UNIPROTKB|O751501001 RNF40 "E3 ubiquitin-protein li 0.958 0.250 0.645 2.4e-85
UNIPROTKB|Q4R7K71001 RNF40 "E3 ubiquitin-protein li 0.958 0.250 0.645 2.4e-85
UNIPROTKB|Q5RAU71001 RNF40 "E3 ubiquitin-protein li 0.958 0.250 0.645 2.4e-85
UNIPROTKB|E1BCI21001 RNF40 "Uncharacterized protein 0.958 0.250 0.645 3e-85
UNIPROTKB|E2R1L51001 RNF40 "Uncharacterized protein 0.958 0.250 0.645 3e-85
MGI|MGI:21420481001 Rnf40 "ring finger protein 40" 0.958 0.250 0.645 3e-85
RGD|6286381002 Rnf40 "ring finger protein 40, 0.958 0.250 0.645 3e-85
FB|FBgn0086694 Bre1 "Bre1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1087 (387.7 bits), Expect = 4.8e-110, P = 4.8e-110
 Identities = 208/257 (80%), Positives = 233/257 (90%)

Query:     6 VSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLARE 65
             V  +EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLM+ERIK+NQLHKL RE
Sbjct:   788 VGSHEEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMSERIKANQLHKLLRE 847

Query:    66 EKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIE 125
             EK +L +Q+     QI+AMH  +RKLEEKER LQ  + ++EKEL LR QAM+++KRKAIE
Sbjct:   848 EKTVLEDQMATATTQIEAMHIVLRKLEEKERSLQATVASIEKELMLRQQAMEMHKRKAIE 907

Query:   126 SAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKI 185
             SAQSAADLKLHLEKYHAQ+KEAQQVV EKTSSLEAEAYKTKRLQEE+AQ +RK ERMKK+
Sbjct:   908 SAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELAQFKRKAERMKKM 967

Query:   186 EQAGT-LDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCP 244
             E +GT +DEVM+EEIREYKETLTCPSCKVKRKDAVL+KCFHVFC+DCLRTRYETRQRKCP
Sbjct:   968 EMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQRKCP 1027

Query:   245 KCNAAFGANDYHRLYLE 261
             KCN AFGANDYHRLYL+
Sbjct:  1028 KCNCAFGANDYHRLYLQ 1044




GO:0008270 "zinc ion binding" evidence=IEA
GO:0016570 "histone modification" evidence=IMP
GO:0007422 "peripheral nervous system development" evidence=NAS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
UNIPROTKB|F8W8Z4 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7K7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCI2 RNF40 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1L5 RNF40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|628638 Rnf40 "ring finger protein 40, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZLS3BRE1A_CHICK6, ., 3, ., 2, ., -0.61350.95800.2550yesN/A
Q3U319BRE1B_MOUSE6, ., 3, ., 2, ., -0.64540.95800.2507yesN/A
Q9VRP9BRE1_DROME6, ., 3, ., 2, ., -0.80930.97700.2452yesN/A
Q8CJB9BRE1B_RAT6, ., 3, ., 2, ., -0.64540.95800.2504yesN/A
Q5RAU7BRE1B_PONAB6, ., 3, ., 2, ., -0.64540.95800.2507yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-09
smart0018440 smart00184, RING, Ring finger 2e-08
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 6e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-05
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 8e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 8e-04
COG4372 499 COG4372, COG4372, Uncharacterized protein conserve 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 0.002
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
 Score = 50.5 bits (121), Expect = 5e-09
 Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 207 TCPSCK-VKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAF 250
            CP C    R+  VL  C HVFC  C+    ++ +  CP C    
Sbjct: 1   ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45


Length = 45

>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 262
KOG0978|consensus698 100.0
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 99.61
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.46
KOG0320|consensus187 99.44
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.39
KOG0823|consensus 230 99.36
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.32
KOG0317|consensus293 99.32
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.28
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.26
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.25
KOG0287|consensus 442 99.2
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.16
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.15
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.14
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 99.14
KOG2164|consensus 513 99.13
PHA02929238 N1R/p28-like protein; Provisional 99.12
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.11
PHA02926242 zinc finger-like protein; Provisional 99.1
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.08
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.06
PF1463444 zf-RING_5: zinc-RING finger domain 99.05
KOG0978|consensus698 99.01
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 99.0
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 98.98
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.97
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.9
KOG2177|consensus 386 98.68
KOG4172|consensus62 98.66
KOG0824|consensus 324 98.55
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.53
COG5152259 Uncharacterized conserved protein, contains RING a 98.5
PRK02224 880 chromosome segregation protein; Provisional 98.48
KOG0311|consensus 381 98.46
PRK02224 880 chromosome segregation protein; Provisional 98.46
KOG2879|consensus298 98.44
KOG4628|consensus348 98.4
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.36
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 98.35
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.35
KOG0802|consensus 543 98.33
KOG4265|consensus349 98.28
KOG1813|consensus313 98.24
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.17
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.15
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.15
KOG1785|consensus 563 98.13
PF04641260 Rtf2: Rtf2 RING-finger 98.1
KOG4159|consensus 398 98.08
KOG4275|consensus350 98.04
PRK03918 880 chromosome segregation protein; Provisional 98.03
KOG2660|consensus 331 98.02
KOG2817|consensus394 97.97
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.94
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.89
KOG4185|consensus 296 97.87
PRK11637 428 AmiB activator; Provisional 97.87
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.86
KOG0297|consensus 391 97.86
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.85
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.84
COG5222427 Uncharacterized conserved protein, contains RING Z 97.83
PRK03918 880 chromosome segregation protein; Provisional 97.72
KOG1571|consensus355 97.72
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.72
KOG0161|consensus 1930 97.72
KOG3039|consensus303 97.71
KOG0161|consensus 1930 97.66
KOG1039|consensus 344 97.66
KOG1002|consensus 791 97.65
KOG0825|consensus 1134 97.64
KOG0828|consensus636 97.64
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 97.63
KOG1645|consensus 463 97.63
KOG0250|consensus 1074 97.62
KOG0250|consensus 1074 97.61
KOG0827|consensus 465 97.59
KOG0826|consensus357 97.57
PF05701522 WEMBL: Weak chloroplast movement under blue light; 97.56
KOG0804|consensus 493 97.55
KOG0999|consensus 772 97.51
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.5
KOG0971|consensus 1243 97.49
KOG4674|consensus 1822 97.48
PRK09039343 hypothetical protein; Validated 97.48
PRK09039343 hypothetical protein; Validated 97.45
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.45
KOG4367|consensus 699 97.43
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.42
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.38
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.37
PHA02562562 46 endonuclease subunit; Provisional 97.36
KOG4692|consensus489 97.33
KOG3002|consensus 299 97.3
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.27
PRK11637 428 AmiB activator; Provisional 97.24
PRK01156 895 chromosome segregation protein; Provisional 97.22
KOG3800|consensus 300 97.21
KOG0995|consensus 581 97.2
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.2
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.16
KOG1029|consensus 1118 97.14
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 97.12
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 97.08
KOG4674|consensus 1822 97.08
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.06
KOG0996|consensus 1293 97.06
KOG0996|consensus 1293 97.04
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.03
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.0
KOG2114|consensus933 97.0
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.0
KOG0933|consensus 1174 96.99
KOG1001|consensus 674 96.99
KOG0933|consensus 1174 96.95
KOG0971|consensus 1243 96.94
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.92
PRK01156 895 chromosome segregation protein; Provisional 96.86
KOG4643|consensus 1195 96.83
COG5109396 Uncharacterized conserved protein, contains RING Z 96.8
PRK04778569 septation ring formation regulator EzrA; Provision 96.8
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.77
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.77
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 96.76
KOG0977|consensus 546 96.75
KOG1100|consensus207 96.67
KOG1493|consensus84 96.63
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.63
PRK04778569 septation ring formation regulator EzrA; Provision 96.63
KOG2034|consensus911 96.63
PF13870177 DUF4201: Domain of unknown function (DUF4201) 96.6
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.59
KOG1814|consensus 445 96.52
PF00038312 Filament: Intermediate filament protein; InterPro: 96.49
PRK04863 1486 mukB cell division protein MukB; Provisional 96.46
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 96.41
KOG4673|consensus 961 96.41
KOG1734|consensus328 96.41
COG4372 499 Uncharacterized protein conserved in bacteria with 96.39
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 96.34
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.3
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.29
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.29
COG52191525 Uncharacterized conserved protein, contains RING Z 96.28
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 96.27
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.24
KOG4809|consensus 654 96.24
KOG0977|consensus 546 96.15
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.15
KOG1941|consensus518 96.15
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.12
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.11
KOG3161|consensus 861 96.11
PRK04863 1486 mukB cell division protein MukB; Provisional 96.07
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.04
KOG0980|consensus 980 96.01
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 95.98
PF00038312 Filament: Intermediate filament protein; InterPro: 95.9
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.89
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 95.88
KOG3113|consensus 293 95.86
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.81
KOG4643|consensus 1195 95.77
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.66
PF13870177 DUF4201: Domain of unknown function (DUF4201) 95.65
KOG0980|consensus 980 95.62
KOG2930|consensus114 95.61
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.61
KOG0999|consensus 772 95.58
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 95.55
KOG3970|consensus 299 95.55
KOG0964|consensus 1200 95.52
COG4942 420 Membrane-bound metallopeptidase [Cell division and 95.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.44
KOG4362|consensus 684 95.36
KOG4185|consensus296 95.27
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.25
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 95.23
KOG4360|consensus 596 95.21
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 95.18
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 95.14
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.95
PHA03096284 p28-like protein; Provisional 94.86
PF15294278 Leu_zip: Leucine zipper 94.82
KOG1029|consensus 1118 94.81
COG4026290 Uncharacterized protein containing TOPRIM domain, 94.8
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 94.74
KOG2932|consensus 389 94.73
KOG3579|consensus352 94.73
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.61
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.57
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 94.56
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 94.53
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 94.5
COG381384 Uncharacterized protein conserved in bacteria [Fun 94.48
KOG0994|consensus1758 94.2
KOG4739|consensus 233 94.06
KOG4360|consensus 596 94.02
KOG0946|consensus970 93.97
KOG3899|consensus381 93.94
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.91
PF14992280 TMCO5: TMCO5 family 93.91
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 93.8
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 93.78
KOG0995|consensus 581 93.77
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 93.76
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 93.73
KOG0298|consensus 1394 93.71
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 93.66
KOG3799|consensus169 93.64
KOG0964|consensus 1200 93.59
KOG1853|consensus333 93.57
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.45
KOG0243|consensus 1041 93.44
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 93.4
KOG3039|consensus 303 93.21
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 93.19
PF15066527 CAGE1: Cancer-associated gene protein 1 family 93.13
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.08
PF05010207 TACC: Transforming acidic coiled-coil-containing p 93.06
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 93.06
KOG4445|consensus 368 93.05
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 92.97
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 92.92
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 92.92
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 92.84
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 92.84
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 92.8
COG5185 622 HEC1 Protein involved in chromosome segregation, i 92.79
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 92.74
COG4372 499 Uncharacterized protein conserved in bacteria with 92.67
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 92.55
KOG1812|consensus 384 92.53
KOG0993|consensus542 92.4
PF07800 162 DUF1644: Protein of unknown function (DUF1644); In 92.29
COG4477570 EzrA Negative regulator of septation ring formatio 92.29
KOG3842|consensus429 92.21
KOG0963|consensus 629 92.17
COG2433652 Uncharacterized conserved protein [Function unknow 92.09
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 91.98
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 91.97
PF05911769 DUF869: Plant protein of unknown function (DUF869) 91.87
KOG0249|consensus 916 91.86
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 91.86
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 91.84
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 91.82
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 91.79
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 91.74
KOG0804|consensus493 91.64
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 91.63
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.59
PRK04023 1121 DNA polymerase II large subunit; Validated 91.59
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 91.59
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.55
KOG1940|consensus276 91.55
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 91.51
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 91.4
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 91.39
KOG0994|consensus1758 91.36
KOG0827|consensus 465 91.31
PF1324826 zf-ribbon_3: zinc-ribbon domain 91.15
KOG1815|consensus 444 91.12
PF10234267 Cluap1: Clusterin-associated protein-1; InterPro: 91.07
PF1324023 zinc_ribbon_2: zinc-ribbon domain 91.05
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 91.01
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 90.92
KOG1899|consensus 861 90.77
COG4647165 AcxC Acetone carboxylase, gamma subunit [Secondary 90.65
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 90.51
COG4942 420 Membrane-bound metallopeptidase [Cell division and 90.27
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 90.25
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.16
PF10186302 Atg14: UV radiation resistance protein and autopha 90.14
KOG2462|consensus279 90.08
KOG0612|consensus 1317 90.03
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 89.98
KOG0288|consensus 459 89.96
PF1232974 TMF_DNA_bd: TATA element modulatory factor 1 DNA b 89.9
PF13863126 DUF4200: Domain of unknown function (DUF4200) 89.85
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 89.75
KOG1962|consensus216 89.71
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 89.69
KOG4673|consensus 961 89.21
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 89.18
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 89.16
PRK10246 1047 exonuclease subunit SbcC; Provisional 89.07
KOG0018|consensus 1141 88.91
KOG3564|consensus 604 88.89
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 88.86
PF1266099 zf-TFIIIC: Putative zinc-finger of transcription f 88.83
PF14353128 CpXC: CpXC protein 88.8
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 88.78
PHA02825162 LAP/PHD finger-like protein; Provisional 88.76
PF14319111 Zn_Tnp_IS91: Transposase zinc-binding domain 88.68
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 88.45
KOG0982|consensus502 88.07
KOG2979|consensus262 88.04
COG5185 622 HEC1 Protein involved in chromosome segregation, i 88.03
KOG1428|consensus 3738 87.86
PF07058 351 Myosin_HC-like: Myosin II heavy chain-like; InterP 87.77
KOG3268|consensus234 87.7
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 87.53
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 87.42
KOG1952|consensus 950 87.27
PHA02862156 5L protein; Provisional 87.07
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 86.85
PRK13169110 DNA replication intiation control protein YabA; Re 86.84
PF07889126 DUF1664: Protein of unknown function (DUF1664); In 86.57
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 86.49
KOG0979|consensus 1072 86.46
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 86.42
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 86.41
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.38
KOG1812|consensus384 86.37
PRK14714 1337 DNA polymerase II large subunit; Provisional 86.21
PF15290305 Syntaphilin: Golgi-localised syntaxin-1-binding cl 86.1
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 86.01
KOG1850|consensus391 85.92
KOG0612|consensus 1317 85.91
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 85.16
KOG0976|consensus 1265 85.02
COG3883265 Uncharacterized protein conserved in bacteria [Fun 84.62
KOG2113|consensus394 84.43
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 84.43
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 84.35
PF15616131 TerY-C: TerY-C metal binding domain 84.14
PLN02939 977 transferase, transferring glycosyl groups 84.12
KOG0825|consensus 1134 84.06
PF0750335 zf-HYPF: HypF finger; InterPro: IPR011125 Zinc fin 83.81
KOG0243|consensus 1041 83.74
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 83.69
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 83.62
KOG0963|consensus 629 83.27
COG2433652 Uncharacterized conserved protein [Function unknow 83.24
KOG0979|consensus 1072 83.18
COG0068 750 HypF Hydrogenase maturation factor [Posttranslatio 83.17
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.14
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 83.14
PF1277350 DZR: Double zinc ribbon 82.74
PF1004699 BLOC1_2: Biogenesis of lysosome-related organelles 82.52
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 82.5
smart0006468 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 82.44
PF10083158 DUF2321: Uncharacterized protein conserved in bact 82.26
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 82.2
PLN02189 1040 cellulose synthase 82.16
KOG2129|consensus 552 82.1
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 81.95
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 81.75
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 81.71
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 81.71
KOG4460|consensus741 81.63
PLN02436 1094 cellulose synthase A 81.6
COG4357105 Zinc finger domain containing protein (CHY type) [ 81.47
KOG1937|consensus521 81.41
KOG4593|consensus 716 81.23
KOG2068|consensus327 81.2
KOG1962|consensus216 81.18
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 81.16
PF13166 712 AAA_13: AAA domain 81.07
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 81.01
PF15397258 DUF4618: Domain of unknown function (DUF4618) 80.92
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 80.92
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 80.88
PRK0084677 hypothetical protein; Provisional 80.37
PF13942179 Lipoprotein_20: YfhG lipoprotein 80.27
>KOG0978|consensus Back     alignment and domain information
Probab=100.00  E-value=9.5e-48  Score=357.45  Aligned_cols=257  Identities=55%  Similarity=0.807  Sum_probs=250.4

Q ss_pred             cccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16189          4 GQVSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDA   83 (262)
Q Consensus         4 ~~~~~~~~~~l~~Eie~~~~a~e~~q~q~~~~~~~l~e~e~~~~kl~~e~~ka~q~~~~~~~~k~~l~~e~~~l~~~~~~   83 (262)
                      |+..-++..+|.+||+++|+||++||++|++|++++.+.|++|++||+++++++|.|+.++.++..++.++..+..+++.
T Consensus       442 Lqk~~~~~k~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~~~  521 (698)
T KOG0978|consen  442 LQKKEKNFKCLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASVDK  521 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45566777899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHH
Q psy16189         84 MHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAY  163 (262)
Q Consensus        84 ~~~~i~~l~e~e~~l~~~i~~lekel~~~~~~~~~~k~k~~e~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~le~~~~  163 (262)
                      +...|.+++++++.++.....+.+++..+.+.++.++++..+..+...+|+..++...+.+.+++..+.+....++.+++
T Consensus       522 ~~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~~~  601 (698)
T KOG0978|consen  522 LELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIEKF  601 (698)
T ss_pred             HHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhCCchHHHHHHHHhccccCcccccccccccceeccccccccHHHHHHHhccCCCCc
Q psy16189        164 KTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKC  243 (262)
Q Consensus       164 ~~~~~e~e~~~l~~~~~~~~~~~~~~~~~~~l~~e~~~~~~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~C  243 (262)
                      +.+++++++..+++++++.++.......+..|.+++..++..++||+|..+|++.|+++|||.||..|+.+++..|+++|
T Consensus       602 k~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKC  681 (698)
T KOG0978|consen  602 KRKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKC  681 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCC
Confidence            99999999999999999999887777789999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcccCCCCcccccc
Q psy16189        244 PKCNAAFGANDYHRLYL  260 (262)
Q Consensus       244 P~Cr~~~~~~d~~~iy~  260 (262)
                      |.|+++||++||++||+
T Consensus       682 P~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  682 PKCNAAFGANDVHRIHL  698 (698)
T ss_pred             CCCCCCCCcccccccCC
Confidence            99999999999999997



>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4809|consensus Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG4360|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF14992 TMCO5: TMCO5 family Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG3799|consensus Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG0993|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3842|consensus Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG0249|consensus Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>KOG1899|consensus Back     alignment and domain information
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures Back     alignment and domain information
>PF13863 DUF4200: Domain of unknown function (DUF4200) Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK10246 exonuclease subunit SbcC; Provisional Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>KOG3564|consensus Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>KOG0982|consensus Back     alignment and domain information
>KOG2979|consensus Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>PRK14714 DNA polymerase II large subunit; Provisional Back     alignment and domain information
>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1850|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF07503 zf-HYPF: HypF finger; InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>KOG2129|consensus Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PLN02436 cellulose synthase A Back     alignment and domain information
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] Back     alignment and domain information
>KOG1937|consensus Back     alignment and domain information
>KOG4593|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF13166 AAA_13: AAA domain Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF13942 Lipoprotein_20: YfhG lipoprotein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query262
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-13
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-11
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-10
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 6e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 4e-09
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 1e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-08
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 8e-08
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 9e-08
2ysl_A73 Tripartite motif-containing protein 31; ring-type 1e-07
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 1e-07
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-07
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-07
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-07
2ysj_A63 Tripartite motif-containing protein 31; ring-type 2e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-07
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-07
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-07
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 6e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 7e-06
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 8e-06
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 9e-06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-05
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-04
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 7e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 4e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-04
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 5e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 6e-04
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 6e-04
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 7e-04
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
 Score = 64.4 bits (157), Expect = 4e-14
 Identities = 19/64 (29%), Positives = 25/64 (39%), Gaps = 8/64 (12%)

Query: 204 ETLTCPSC-------KVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYH 256
             ++CP C           +  V T+C HVFC  CLR         CP C        YH
Sbjct: 2   AMVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLR-DSLKNANTCPTCRKKINHKRYH 60

Query: 257 RLYL 260
            +Y+
Sbjct: 61  PIYI 64


>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.64
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.58
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.58
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.58
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.57
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.56
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.56
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.54
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.53
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.53
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.51
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.5
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.49
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.49
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.49
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.49
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.49
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.48
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.48
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.48
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.47
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.47
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.45
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.44
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.43
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.43
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.43
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.43
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.42
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.41
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.41
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.41
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.39
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.39
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.38
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.38
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.37
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.37
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.35
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.34
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.33
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.32
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.31
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.3
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.3
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.3
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.29
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.28
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.27
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.27
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.25
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.23
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.21
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.21
2ea5_A68 Cell growth regulator with ring finger domain prot 99.2
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.18
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 99.14
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.11
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.1
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.97
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.93
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.89
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.76
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.67
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.58
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.45
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.31
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.16
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.11
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.9
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.77
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.74
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.72
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.62
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 97.18
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 97.01
3nw0_A238 Non-structural maintenance of chromosomes element 96.95
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.95
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.94
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.69
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.61
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.55
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.51
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 96.5
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 96.36
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.02
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.9
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 95.83
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.62
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 95.56
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 95.55
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.53
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.39
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.06
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.73
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.68
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 94.67
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 94.67
1z60_A59 TFIIH basal transcription factor complex P44 subun 94.44
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 94.35
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 94.21
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.11
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 93.86
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 93.78
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 93.42
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 93.13
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 92.98
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 92.92
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 92.89
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 92.69
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 92.54
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 92.25
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 91.5
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 91.17
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 90.7
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 90.57
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.07
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 90.02
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 89.98
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 89.69
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 89.54
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 89.52
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 89.39
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 89.09
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 89.05
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 88.97
2v4h_A110 NF-kappa-B essential modulator; transcription, met 88.73
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 88.62
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 88.57
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 88.02
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 87.58
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 87.47
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 87.29
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 86.85
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 86.71
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 86.48
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 86.07
3t7l_A90 Zinc finger FYVE domain-containing protein 16; str 85.24
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 85.01
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 84.82
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 84.82
1vd4_A62 Transcription initiation factor IIE, alpha subunit 84.67
2i1j_A575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 84.46
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 84.32
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 84.16
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 84.13
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 84.05
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 84.01
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 83.91
2v4h_A110 NF-kappa-B essential modulator; transcription, met 83.25
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 82.81
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 82.38
1wfk_A88 Zinc finger, FYVE domain containing 19; riken stru 82.33
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 82.19
1x4u_A84 Zinc finger, FYVE domain containing 27 isoform B; 81.92
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 81.09
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 80.98
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 80.87
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 80.64
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 80.34
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 80.09
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=99.64  E-value=3.5e-16  Score=121.11  Aligned_cols=51  Identities=27%  Similarity=0.638  Sum_probs=45.0

Q ss_pred             ccccCcccccccccccceeccccccccHHHHHHHhccCCCCccCCCcccCCC
Q psy16189        202 YKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGAN  253 (262)
Q Consensus       202 ~~~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~  253 (262)
                      +...+.|+||...|.+|+++||||+||..|+..|+. +...||.||.++...
T Consensus        50 ~~~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~-~~~~CP~Cr~~~~~~  100 (138)
T 4ayc_A           50 LENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMK-RKIECPICRKDIKSK  100 (138)
T ss_dssp             HHHHSBCTTTCSBCSSEEEETTSCEEEHHHHHHHTT-TCSBCTTTCCBCCCE
T ss_pred             ccccCCCcccCcccCCceECCCCCCccHHHHHHHHH-cCCcCCCCCCcCCCC
Confidence            334588999999999999999999999999999987 567899999999654



>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 262
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-13
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-09
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-08
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-07
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-04
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-04
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 2e-04
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 4e-04
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.001
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.002
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 63.0 bits (153), Expect = 1e-13
 Identities = 14/54 (25%), Positives = 23/54 (42%)

Query: 201 EYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGAND 254
            + ++++C  C+    D V T C H+FC  C+    +     CP C       D
Sbjct: 19  HFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTD 72


>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query262
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.65
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.62
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.53
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.53
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.53
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.52
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.48
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.41
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.4
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.36
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.29
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.26
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.07
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.02
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.86
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.47
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 96.34
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 95.7
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 94.89
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 93.59
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 93.46
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 90.18
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 87.52
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.44
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 87.07
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.02
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 85.8
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 85.67
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 85.57
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 85.12
d1vfya_67 vps27p protein {Baker's yeast (Saccharomyces cerev 84.77
d1lkoa244 Rubrerythrin, C-terminal domain {Desulfovibrio vul 84.38
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 84.0
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 82.8
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 82.25
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 80.96
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.65  E-value=1.9e-17  Score=115.27  Aligned_cols=54  Identities=26%  Similarity=0.584  Sum_probs=49.1

Q ss_pred             ccCcccccccccccceeccccccccHHHHHHHhccCCCCccCCCcccCCCCccc
Q psy16189        204 ETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHR  257 (262)
Q Consensus       204 ~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~d~~~  257 (262)
                      ..+.|+||.+.+.+|++++|||+||..|+..|+..+.++||.||.++...|+.+
T Consensus        22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~   75 (86)
T d1rmda2          22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLES   75 (86)
T ss_dssp             HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBC
T ss_pred             cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccC
Confidence            348899999999999999999999999999999888889999999998777653



>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure