Psyllid ID: psy16189
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| 350402387 | 957 | PREDICTED: E3 ubiquitin-protein ligase B | 0.965 | 0.264 | 0.861 | 1e-124 | |
| 340711825 | 957 | PREDICTED: e3 ubiquitin-protein ligase B | 0.965 | 0.264 | 0.861 | 1e-124 | |
| 383857052 | 957 | PREDICTED: E3 ubiquitin-protein ligase B | 0.965 | 0.264 | 0.861 | 1e-124 | |
| 380030127 | 953 | PREDICTED: E3 ubiquitin-protein ligase B | 0.965 | 0.265 | 0.861 | 1e-124 | |
| 328778821 | 930 | PREDICTED: e3 ubiquitin-protein ligase B | 0.965 | 0.272 | 0.861 | 1e-124 | |
| 332020263 | 676 | E3 ubiquitin-protein ligase Bre1 [Acromy | 0.965 | 0.374 | 0.861 | 1e-124 | |
| 307199111 | 957 | E3 ubiquitin-protein ligase Bre1 [Harpeg | 0.965 | 0.264 | 0.857 | 1e-124 | |
| 307180966 | 964 | E3 ubiquitin-protein ligase Bre1 [Campon | 0.965 | 0.262 | 0.857 | 1e-123 | |
| 345483701 | 955 | PREDICTED: E3 ubiquitin-protein ligase B | 0.965 | 0.264 | 0.857 | 1e-123 | |
| 193678945 | 953 | PREDICTED: e3 ubiquitin-protein ligase B | 0.965 | 0.265 | 0.845 | 1e-122 |
| >gi|350402387|ref|XP_003486466.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 449 bits (1156), Expect = e-124, Method: Compositional matrix adjust.
Identities = 218/253 (86%), Positives = 232/253 (91%)
Query: 10 EEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDI 69
EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLMTERIKSNQLHKLAREEKD+
Sbjct: 705 EEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMTERIKSNQLHKLAREEKDV 764
Query: 70 LHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQS 129
L EQV+ L Q++A + +RKLEEKER LQ L VEKEL LR QAM+++KRKAIESAQS
Sbjct: 765 LKEQVSTLTTQVEAANVVVRKLEEKERLLQNSLATVEKELALRQQAMEMHKRKAIESAQS 824
Query: 130 AADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKIEQAG 189
AADLKLHLEKYH+Q+KEAQQVV EKTSSLEAEAYKTKRLQEEIAQLRRK ERMKKIE A
Sbjct: 825 AADLKLHLEKYHSQMKEAQQVVAEKTSSLEAEAYKTKRLQEEIAQLRRKVERMKKIELAE 884
Query: 190 TLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAA 249
TLDEVM EE+REYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCN A
Sbjct: 885 TLDEVMAEELREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNCA 944
Query: 250 FGANDYHRLYLES 262
FGANDYHRLYL +
Sbjct: 945 FGANDYHRLYLST 957
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|340711825|ref|XP_003394469.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383857052|ref|XP_003704020.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380030127|ref|XP_003698707.1| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328778821|ref|XP_625025.3| PREDICTED: e3 ubiquitin-protein ligase Bre1, partial [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|332020263|gb|EGI60697.1| E3 ubiquitin-protein ligase Bre1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307199111|gb|EFN79821.1| E3 ubiquitin-protein ligase Bre1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307180966|gb|EFN68754.1| E3 ubiquitin-protein ligase Bre1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345483701|ref|XP_001601663.2| PREDICTED: E3 ubiquitin-protein ligase Bre1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|193678945|ref|XP_001949533.1| PREDICTED: e3 ubiquitin-protein ligase Bre1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 262 | ||||||
| FB|FBgn0086694 | 1044 | Bre1 "Bre1" [Drosophila melano | 0.977 | 0.245 | 0.809 | 4.8e-110 | |
| UNIPROTKB|F8W8Z4 | 693 | RNF40 "E3 ubiquitin-protein li | 0.958 | 0.362 | 0.645 | 2.4e-85 | |
| UNIPROTKB|H3BP71 | 961 | RNF40 "E3 ubiquitin-protein li | 0.958 | 0.261 | 0.645 | 2.4e-85 | |
| UNIPROTKB|O75150 | 1001 | RNF40 "E3 ubiquitin-protein li | 0.958 | 0.250 | 0.645 | 2.4e-85 | |
| UNIPROTKB|Q4R7K7 | 1001 | RNF40 "E3 ubiquitin-protein li | 0.958 | 0.250 | 0.645 | 2.4e-85 | |
| UNIPROTKB|Q5RAU7 | 1001 | RNF40 "E3 ubiquitin-protein li | 0.958 | 0.250 | 0.645 | 2.4e-85 | |
| UNIPROTKB|E1BCI2 | 1001 | RNF40 "Uncharacterized protein | 0.958 | 0.250 | 0.645 | 3e-85 | |
| UNIPROTKB|E2R1L5 | 1001 | RNF40 "Uncharacterized protein | 0.958 | 0.250 | 0.645 | 3e-85 | |
| MGI|MGI:2142048 | 1001 | Rnf40 "ring finger protein 40" | 0.958 | 0.250 | 0.645 | 3e-85 | |
| RGD|628638 | 1002 | Rnf40 "ring finger protein 40, | 0.958 | 0.250 | 0.645 | 3e-85 |
| FB|FBgn0086694 Bre1 "Bre1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1087 (387.7 bits), Expect = 4.8e-110, P = 4.8e-110
Identities = 208/257 (80%), Positives = 233/257 (90%)
Query: 6 VSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLARE 65
V +EEEALLNEMEVTGQAFEDMQEQNSRL+QQLREKDDANFKLM+ERIK+NQLHKL RE
Sbjct: 788 VGSHEEEALLNEMEVTGQAFEDMQEQNSRLIQQLREKDDANFKLMSERIKANQLHKLLRE 847
Query: 66 EKDILHEQVNALKLQIDAMHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIE 125
EK +L +Q+ QI+AMH +RKLEEKER LQ + ++EKEL LR QAM+++KRKAIE
Sbjct: 848 EKTVLEDQMATATTQIEAMHIVLRKLEEKERSLQATVASIEKELMLRQQAMEMHKRKAIE 907
Query: 126 SAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAYKTKRLQEEIAQLRRKTERMKKI 185
SAQSAADLKLHLEKYHAQ+KEAQQVV EKTSSLEAEAYKTKRLQEE+AQ +RK ERMKK+
Sbjct: 908 SAQSAADLKLHLEKYHAQMKEAQQVVAEKTSSLEAEAYKTKRLQEELAQFKRKAERMKKM 967
Query: 186 EQAGT-LDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCP 244
E +GT +DEVM+EEIREYKETLTCPSCKVKRKDAVL+KCFHVFC+DCLRTRYETRQRKCP
Sbjct: 968 EMSGTTIDEVMIEEIREYKETLTCPSCKVKRKDAVLSKCFHVFCYDCLRTRYETRQRKCP 1027
Query: 245 KCNAAFGANDYHRLYLE 261
KCN AFGANDYHRLYL+
Sbjct: 1028 KCNCAFGANDYHRLYLQ 1044
|
|
| UNIPROTKB|F8W8Z4 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R7K7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BCI2 RNF40 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R1L5 RNF40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|628638 Rnf40 "ring finger protein 40, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-09 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-08 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 6e-08 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 2e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 5e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| pfam12861 | 85 | pfam12861, zf-Apc11, Anaphase-promoting complex su | 8e-04 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 8e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 0.002 | |
| TIGR00599 | 397 | TIGR00599, rad18, DNA repair protein rad18 | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Score = 50.5 bits (121), Expect = 5e-09
Identities = 15/45 (33%), Positives = 20/45 (44%), Gaps = 1/45 (2%)
Query: 207 TCPSCK-VKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAF 250
CP C R+ VL C HVFC C+ ++ + CP C
Sbjct: 1 ECPICLEEFREPVVLLPCGHVFCRSCIDKWLKSGKNTCPLCRTPI 45
|
Length = 45 |
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| KOG0978|consensus | 698 | 100.0 | ||
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 99.61 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 99.46 | |
| KOG0320|consensus | 187 | 99.44 | ||
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.39 | |
| KOG0823|consensus | 230 | 99.36 | ||
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 99.32 | |
| KOG0317|consensus | 293 | 99.32 | ||
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 99.28 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 99.26 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.25 | |
| KOG0287|consensus | 442 | 99.2 | ||
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 99.16 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 99.15 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 99.14 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 99.14 | |
| KOG2164|consensus | 513 | 99.13 | ||
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.12 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.11 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 99.1 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 99.08 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 99.06 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 99.05 | |
| KOG0978|consensus | 698 | 99.01 | ||
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 99.0 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 98.98 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 98.97 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.9 | |
| KOG2177|consensus | 386 | 98.68 | ||
| KOG4172|consensus | 62 | 98.66 | ||
| KOG0824|consensus | 324 | 98.55 | ||
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 98.53 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 98.5 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.48 | |
| KOG0311|consensus | 381 | 98.46 | ||
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.46 | |
| KOG2879|consensus | 298 | 98.44 | ||
| KOG4628|consensus | 348 | 98.4 | ||
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.36 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 98.35 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 98.35 | |
| KOG0802|consensus | 543 | 98.33 | ||
| KOG4265|consensus | 349 | 98.28 | ||
| KOG1813|consensus | 313 | 98.24 | ||
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.17 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.15 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.15 | |
| KOG1785|consensus | 563 | 98.13 | ||
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 98.1 | |
| KOG4159|consensus | 398 | 98.08 | ||
| KOG4275|consensus | 350 | 98.04 | ||
| PRK03918 | 880 | chromosome segregation protein; Provisional | 98.03 | |
| KOG2660|consensus | 331 | 98.02 | ||
| KOG2817|consensus | 394 | 97.97 | ||
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.94 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.89 | |
| KOG4185|consensus | 296 | 97.87 | ||
| PRK11637 | 428 | AmiB activator; Provisional | 97.87 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.86 | |
| KOG0297|consensus | 391 | 97.86 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.85 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.84 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.83 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.72 | |
| KOG1571|consensus | 355 | 97.72 | ||
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.72 | |
| KOG0161|consensus | 1930 | 97.72 | ||
| KOG3039|consensus | 303 | 97.71 | ||
| KOG0161|consensus | 1930 | 97.66 | ||
| KOG1039|consensus | 344 | 97.66 | ||
| KOG1002|consensus | 791 | 97.65 | ||
| KOG0825|consensus | 1134 | 97.64 | ||
| KOG0828|consensus | 636 | 97.64 | ||
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 97.63 | |
| KOG1645|consensus | 463 | 97.63 | ||
| KOG0250|consensus | 1074 | 97.62 | ||
| KOG0250|consensus | 1074 | 97.61 | ||
| KOG0827|consensus | 465 | 97.59 | ||
| KOG0826|consensus | 357 | 97.57 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 97.56 | |
| KOG0804|consensus | 493 | 97.55 | ||
| KOG0999|consensus | 772 | 97.51 | ||
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.5 | |
| KOG0971|consensus | 1243 | 97.49 | ||
| KOG4674|consensus | 1822 | 97.48 | ||
| PRK09039 | 343 | hypothetical protein; Validated | 97.48 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.45 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.45 | |
| KOG4367|consensus | 699 | 97.43 | ||
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 97.42 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.38 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.37 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.36 | |
| KOG4692|consensus | 489 | 97.33 | ||
| KOG3002|consensus | 299 | 97.3 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.27 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.24 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 97.22 | |
| KOG3800|consensus | 300 | 97.21 | ||
| KOG0995|consensus | 581 | 97.2 | ||
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.2 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 97.16 | |
| KOG1029|consensus | 1118 | 97.14 | ||
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 97.12 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.08 | |
| KOG4674|consensus | 1822 | 97.08 | ||
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 97.06 | |
| KOG0996|consensus | 1293 | 97.06 | ||
| KOG0996|consensus | 1293 | 97.04 | ||
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 97.03 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.0 | |
| KOG2114|consensus | 933 | 97.0 | ||
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 97.0 | |
| KOG0933|consensus | 1174 | 96.99 | ||
| KOG1001|consensus | 674 | 96.99 | ||
| KOG0933|consensus | 1174 | 96.95 | ||
| KOG0971|consensus | 1243 | 96.94 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.92 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.86 | |
| KOG4643|consensus | 1195 | 96.83 | ||
| COG5109 | 396 | Uncharacterized conserved protein, contains RING Z | 96.8 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.8 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.77 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.77 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.76 | |
| KOG0977|consensus | 546 | 96.75 | ||
| KOG1100|consensus | 207 | 96.67 | ||
| KOG1493|consensus | 84 | 96.63 | ||
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 96.63 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 96.63 | |
| KOG2034|consensus | 911 | 96.63 | ||
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.6 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.59 | |
| KOG1814|consensus | 445 | 96.52 | ||
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.49 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.46 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 96.41 | |
| KOG4673|consensus | 961 | 96.41 | ||
| KOG1734|consensus | 328 | 96.41 | ||
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.39 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 96.34 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 96.3 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 96.29 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.29 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 96.28 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.27 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 96.24 | |
| KOG4809|consensus | 654 | 96.24 | ||
| KOG0977|consensus | 546 | 96.15 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.15 | |
| KOG1941|consensus | 518 | 96.15 | ||
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 96.12 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.11 | |
| KOG3161|consensus | 861 | 96.11 | ||
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.07 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.04 | |
| KOG0980|consensus | 980 | 96.01 | ||
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 95.98 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.9 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.89 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 95.88 | |
| KOG3113|consensus | 293 | 95.86 | ||
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.81 | |
| KOG4643|consensus | 1195 | 95.77 | ||
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 95.66 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 95.65 | |
| KOG0980|consensus | 980 | 95.62 | ||
| KOG2930|consensus | 114 | 95.61 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.61 | |
| KOG0999|consensus | 772 | 95.58 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.55 | |
| KOG3970|consensus | 299 | 95.55 | ||
| KOG0964|consensus | 1200 | 95.52 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 95.48 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 95.44 | |
| KOG4362|consensus | 684 | 95.36 | ||
| KOG4185|consensus | 296 | 95.27 | ||
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.25 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.23 | |
| KOG4360|consensus | 596 | 95.21 | ||
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 95.18 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.14 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 94.95 | |
| PHA03096 | 284 | p28-like protein; Provisional | 94.86 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 94.82 | |
| KOG1029|consensus | 1118 | 94.81 | ||
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 94.8 | |
| PF03854 | 50 | zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc | 94.74 | |
| KOG2932|consensus | 389 | 94.73 | ||
| KOG3579|consensus | 352 | 94.73 | ||
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.61 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.57 | |
| PF02318 | 118 | FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 | 94.56 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 94.53 | |
| PF06906 | 57 | DUF1272: Protein of unknown function (DUF1272); In | 94.5 | |
| COG3813 | 84 | Uncharacterized protein conserved in bacteria [Fun | 94.48 | |
| KOG0994|consensus | 1758 | 94.2 | ||
| KOG4739|consensus | 233 | 94.06 | ||
| KOG4360|consensus | 596 | 94.02 | ||
| KOG0946|consensus | 970 | 93.97 | ||
| KOG3899|consensus | 381 | 93.94 | ||
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.91 | |
| PF14992 | 280 | TMCO5: TMCO5 family | 93.91 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 93.8 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 93.78 | |
| KOG0995|consensus | 581 | 93.77 | ||
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 93.76 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 93.73 | |
| KOG0298|consensus | 1394 | 93.71 | ||
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.66 | |
| KOG3799|consensus | 169 | 93.64 | ||
| KOG0964|consensus | 1200 | 93.59 | ||
| KOG1853|consensus | 333 | 93.57 | ||
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 93.45 | |
| KOG0243|consensus | 1041 | 93.44 | ||
| PF07975 | 51 | C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al | 93.4 | |
| KOG3039|consensus | 303 | 93.21 | ||
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 93.19 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 93.13 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 93.08 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 93.06 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 93.06 | |
| KOG4445|consensus | 368 | 93.05 | ||
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 92.97 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 92.92 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 92.92 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 92.84 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 92.84 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 92.8 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 92.79 | |
| PF14569 | 80 | zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. | 92.74 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 92.67 | |
| PF09986 | 214 | DUF2225: Uncharacterized protein conserved in bact | 92.55 | |
| KOG1812|consensus | 384 | 92.53 | ||
| KOG0993|consensus | 542 | 92.4 | ||
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 92.29 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 92.29 | |
| KOG3842|consensus | 429 | 92.21 | ||
| KOG0963|consensus | 629 | 92.17 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 92.09 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 91.98 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 91.97 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 91.87 | |
| KOG0249|consensus | 916 | 91.86 | ||
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 91.86 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 91.84 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 91.82 | |
| cd00065 | 57 | FYVE FYVE domain; Zinc-binding domain; targets pro | 91.79 | |
| PF04216 | 290 | FdhE: Protein involved in formate dehydrogenase fo | 91.74 | |
| KOG0804|consensus | 493 | 91.64 | ||
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 91.63 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 91.59 | |
| PRK04023 | 1121 | DNA polymerase II large subunit; Validated | 91.59 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 91.59 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 91.55 | |
| KOG1940|consensus | 276 | 91.55 | ||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 91.51 | |
| TIGR01562 | 305 | FdhE formate dehydrogenase accessory protein FdhE. | 91.4 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 91.39 | |
| KOG0994|consensus | 1758 | 91.36 | ||
| KOG0827|consensus | 465 | 91.31 | ||
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 91.15 | |
| KOG1815|consensus | 444 | 91.12 | ||
| PF10234 | 267 | Cluap1: Clusterin-associated protein-1; InterPro: | 91.07 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 91.05 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 91.01 | |
| PF04710 | 416 | Pellino: Pellino; InterPro: IPR006800 Pellino is i | 90.92 | |
| KOG1899|consensus | 861 | 90.77 | ||
| COG4647 | 165 | AcxC Acetone carboxylase, gamma subunit [Secondary | 90.65 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 90.51 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 90.27 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 90.25 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 90.16 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.14 | |
| KOG2462|consensus | 279 | 90.08 | ||
| KOG0612|consensus | 1317 | 90.03 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 89.98 | |
| KOG0288|consensus | 459 | 89.96 | ||
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 89.9 | |
| PF13863 | 126 | DUF4200: Domain of unknown function (DUF4200) | 89.85 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 89.75 | |
| KOG1962|consensus | 216 | 89.71 | ||
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 89.69 | |
| KOG4673|consensus | 961 | 89.21 | ||
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 89.18 | |
| PF01363 | 69 | FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f | 89.16 | |
| PRK10246 | 1047 | exonuclease subunit SbcC; Provisional | 89.07 | |
| KOG0018|consensus | 1141 | 88.91 | ||
| KOG3564|consensus | 604 | 88.89 | ||
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 88.86 | |
| PF12660 | 99 | zf-TFIIIC: Putative zinc-finger of transcription f | 88.83 | |
| PF14353 | 128 | CpXC: CpXC protein | 88.8 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 88.78 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 88.76 | |
| PF14319 | 111 | Zn_Tnp_IS91: Transposase zinc-binding domain | 88.68 | |
| PRK03564 | 309 | formate dehydrogenase accessory protein FdhE; Prov | 88.45 | |
| KOG0982|consensus | 502 | 88.07 | ||
| KOG2979|consensus | 262 | 88.04 | ||
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 88.03 | |
| KOG1428|consensus | 3738 | 87.86 | ||
| PF07058 | 351 | Myosin_HC-like: Myosin II heavy chain-like; InterP | 87.77 | |
| KOG3268|consensus | 234 | 87.7 | ||
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 87.53 | |
| PF10235 | 90 | Cript: Microtubule-associated protein CRIPT; Inter | 87.42 | |
| KOG1952|consensus | 950 | 87.27 | ||
| PHA02862 | 156 | 5L protein; Provisional | 87.07 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 86.85 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 86.84 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 86.57 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 86.49 | |
| KOG0979|consensus | 1072 | 86.46 | ||
| PF08581 | 79 | Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t | 86.42 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 86.41 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 86.38 | |
| KOG1812|consensus | 384 | 86.37 | ||
| PRK14714 | 1337 | DNA polymerase II large subunit; Provisional | 86.21 | |
| PF15290 | 305 | Syntaphilin: Golgi-localised syntaxin-1-binding cl | 86.1 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 86.01 | |
| KOG1850|consensus | 391 | 85.92 | ||
| KOG0612|consensus | 1317 | 85.91 | ||
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 85.16 | |
| KOG0976|consensus | 1265 | 85.02 | ||
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 84.62 | |
| KOG2113|consensus | 394 | 84.43 | ||
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 84.43 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 84.35 | |
| PF15616 | 131 | TerY-C: TerY-C metal binding domain | 84.14 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 84.12 | |
| KOG0825|consensus | 1134 | 84.06 | ||
| PF07503 | 35 | zf-HYPF: HypF finger; InterPro: IPR011125 Zinc fin | 83.81 | |
| KOG0243|consensus | 1041 | 83.74 | ||
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 83.69 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 83.62 | |
| KOG0963|consensus | 629 | 83.27 | ||
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 83.24 | |
| KOG0979|consensus | 1072 | 83.18 | ||
| COG0068 | 750 | HypF Hydrogenase maturation factor [Posttranslatio | 83.17 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 83.14 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 83.14 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 82.74 | |
| PF10046 | 99 | BLOC1_2: Biogenesis of lysosome-related organelles | 82.52 | |
| PF14205 | 55 | Cys_rich_KTR: Cysteine-rich KTR | 82.5 | |
| smart00064 | 68 | FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | 82.44 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 82.26 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 82.2 | |
| PLN02189 | 1040 | cellulose synthase | 82.16 | |
| KOG2129|consensus | 552 | 82.1 | ||
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 81.95 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 81.75 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 81.71 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 81.71 | |
| KOG4460|consensus | 741 | 81.63 | ||
| PLN02436 | 1094 | cellulose synthase A | 81.6 | |
| COG4357 | 105 | Zinc finger domain containing protein (CHY type) [ | 81.47 | |
| KOG1937|consensus | 521 | 81.41 | ||
| KOG4593|consensus | 716 | 81.23 | ||
| KOG2068|consensus | 327 | 81.2 | ||
| KOG1962|consensus | 216 | 81.18 | ||
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 81.16 | |
| PF13166 | 712 | AAA_13: AAA domain | 81.07 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 81.01 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 80.92 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 80.92 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 80.88 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 80.37 | |
| PF13942 | 179 | Lipoprotein_20: YfhG lipoprotein | 80.27 |
| >KOG0978|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.5e-48 Score=357.45 Aligned_cols=257 Identities=55% Similarity=0.807 Sum_probs=250.4
Q ss_pred cccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16189 4 GQVSGNEEEALLNEMEVTGQAFEDMQEQNSRLLQQLREKDDANFKLMTERIKSNQLHKLAREEKDILHEQVNALKLQIDA 83 (262)
Q Consensus 4 ~~~~~~~~~~l~~Eie~~~~a~e~~q~q~~~~~~~l~e~e~~~~kl~~e~~ka~q~~~~~~~~k~~l~~e~~~l~~~~~~ 83 (262)
|+..-++..+|.+||+++|+||++||++|++|++++.+.|++|++||+++++++|.|+.++.++..++.++..+..+++.
T Consensus 442 Lqk~~~~~k~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~~~ 521 (698)
T KOG0978|consen 442 LQKKEKNFKCLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASVDK 521 (698)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45566777899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHH
Q psy16189 84 MHTAIRKLEEKERYLQTVLTNVEKELHLRNQAMDLNKRKAIESAQSAADLKLHLEKYHAQLKEAQQVVTEKTSSLEAEAY 163 (262)
Q Consensus 84 ~~~~i~~l~e~e~~l~~~i~~lekel~~~~~~~~~~k~k~~e~~~~~~~l~~~l~~l~~~~~~~~~~~~~~~~~le~~~~ 163 (262)
+...|.+++++++.++.....+.+++..+.+.++.++++..+..+...+|+..++...+.+.+++..+.+....++.+++
T Consensus 522 ~~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~~~ 601 (698)
T KOG0978|consen 522 LELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIEKF 601 (698)
T ss_pred HHHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHhhCCchHHHHHHHHhccccCcccccccccccceeccccccccHHHHHHHhccCCCCc
Q psy16189 164 KTKRLQEEIAQLRRKTERMKKIEQAGTLDEVMMEEIREYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKC 243 (262)
Q Consensus 164 ~~~~~e~e~~~l~~~~~~~~~~~~~~~~~~~l~~e~~~~~~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~C 243 (262)
+.+++++++..+++++++.++.......+..|.+++..++..++||+|..+|++.|+++|||.||..|+.+++..|+++|
T Consensus 602 k~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKC 681 (698)
T KOG0978|consen 602 KRKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKC 681 (698)
T ss_pred HHHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCC
Confidence 99999999999999999999887777789999999999999999999999999999999999999999999999999999
Q ss_pred cCCCcccCCCCcccccc
Q psy16189 244 PKCNAAFGANDYHRLYL 260 (262)
Q Consensus 244 P~Cr~~~~~~d~~~iy~ 260 (262)
|.|+++||++||++||+
T Consensus 682 P~Cn~aFganDv~~I~l 698 (698)
T KOG0978|consen 682 PKCNAAFGANDVHRIHL 698 (698)
T ss_pred CCCCCCCCcccccccCC
Confidence 99999999999999997
|
|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0320|consensus | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >KOG0823|consensus | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0317|consensus | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0287|consensus | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2164|consensus | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >KOG0978|consensus | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177|consensus | Back alignment and domain information |
|---|
| >KOG4172|consensus | Back alignment and domain information |
|---|
| >KOG0824|consensus | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG0311|consensus | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2879|consensus | Back alignment and domain information |
|---|
| >KOG4628|consensus | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802|consensus | Back alignment and domain information |
|---|
| >KOG4265|consensus | Back alignment and domain information |
|---|
| >KOG1813|consensus | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG4159|consensus | Back alignment and domain information |
|---|
| >KOG4275|consensus | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG2660|consensus | Back alignment and domain information |
|---|
| >KOG2817|consensus | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0297|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1571|consensus | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >KOG1039|consensus | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG0828|consensus | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >KOG0826|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4692|consensus | Back alignment and domain information |
|---|
| >KOG3002|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3800|consensus | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG2114|consensus | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >KOG0933|consensus | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >KOG1100|consensus | Back alignment and domain information |
|---|
| >KOG1493|consensus | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG2034|consensus | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG1814|consensus | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >KOG1734|consensus | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG4809|consensus | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1941|consensus | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG3161|consensus | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG3113|consensus | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG2930|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0999|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG3970|consensus | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4362|consensus | Back alignment and domain information |
|---|
| >KOG4185|consensus | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2932|consensus | Back alignment and domain information |
|---|
| >KOG3579|consensus | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length | Back alignment and domain information |
|---|
| >COG3813 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG4739|consensus | Back alignment and domain information |
|---|
| >KOG4360|consensus | Back alignment and domain information |
|---|
| >KOG0946|consensus | Back alignment and domain information |
|---|
| >KOG3899|consensus | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF14992 TMCO5: TMCO5 family | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3799|consensus | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG1853|consensus | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair | Back alignment and domain information |
|---|
| >KOG3039|consensus | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >KOG4445|consensus | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >KOG0993|consensus | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3842|consensus | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0249|consensus | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; | Back alignment and domain information |
|---|
| >PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] | Back alignment and domain information |
|---|
| >KOG0804|consensus | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >PRK04023 DNA polymerase II large subunit; Validated | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG1940|consensus | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >TIGR01562 FdhE formate dehydrogenase accessory protein FdhE | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG0827|consensus | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG1815|consensus | Back alignment and domain information |
|---|
| >PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] | Back alignment and domain information |
|---|
| >KOG1899|consensus | Back alignment and domain information |
|---|
| >COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF13863 DUF4200: Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >KOG4673|consensus | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK10246 exonuclease subunit SbcC; Provisional | Back alignment and domain information |
|---|
| >KOG0018|consensus | Back alignment and domain information |
|---|
| >KOG3564|consensus | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins | Back alignment and domain information |
|---|
| >PF14353 CpXC: CpXC protein | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14319 Zn_Tnp_IS91: Transposase zinc-binding domain | Back alignment and domain information |
|---|
| >PRK03564 formate dehydrogenase accessory protein FdhE; Provisional | Back alignment and domain information |
|---|
| >KOG0982|consensus | Back alignment and domain information |
|---|
| >KOG2979|consensus | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PF07058 Myosin_HC-like: Myosin II heavy chain-like; InterPro: IPR009768 This family represents a conserved region within a number of myosin II heavy chain-like proteins that seem to be specific to Arabidopsis thaliana | Back alignment and domain information |
|---|
| >KOG3268|consensus | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production | Back alignment and domain information |
|---|
| >KOG1952|consensus | Back alignment and domain information |
|---|
| >PHA02862 5L protein; Provisional | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG1812|consensus | Back alignment and domain information |
|---|
| >PRK14714 DNA polymerase II large subunit; Provisional | Back alignment and domain information |
|---|
| >PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >KOG1850|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2113|consensus | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF15616 TerY-C: TerY-C metal binding domain | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >PF07503 zf-HYPF: HypF finger; InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0243|consensus | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >KOG0963|consensus | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0979|consensus | Back alignment and domain information |
|---|
| >COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PF10046 BLOC1_2: Biogenesis of lysosome-related organelles complex-1 subunit 2 ; InterPro: IPR019269 This entry represents a family of proteins that play a role in cellular proliferation, as well as in the biogenesis of specialised organelles of the endosomal-lysosomal system [] | Back alignment and domain information |
|---|
| >PF14205 Cys_rich_KTR: Cysteine-rich KTR | Back alignment and domain information |
|---|
| >smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1 | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PLN02189 cellulose synthase | Back alignment and domain information |
|---|
| >KOG2129|consensus | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >KOG4460|consensus | Back alignment and domain information |
|---|
| >PLN02436 cellulose synthase A | Back alignment and domain information |
|---|
| >COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] | Back alignment and domain information |
|---|
| >KOG1937|consensus | Back alignment and domain information |
|---|
| >KOG4593|consensus | Back alignment and domain information |
|---|
| >KOG2068|consensus | Back alignment and domain information |
|---|
| >KOG1962|consensus | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF13166 AAA_13: AAA domain | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13942 Lipoprotein_20: YfhG lipoprotein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 262 | |||
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 4e-14 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 1e-13 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 2e-11 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 1e-10 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 2e-10 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 6e-10 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 4e-09 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 1e-08 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 2e-08 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 2e-08 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-04 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 8e-08 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 9e-08 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 1e-07 | |
| 4epo_C | 149 | E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 | 1e-07 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 1e-07 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 1e-07 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 2e-07 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 2e-07 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 2e-07 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 2e-07 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 2e-07 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 2e-07 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 3e-07 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 6e-07 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 1e-05 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 2e-06 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 6e-06 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 6e-06 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 7e-06 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 8e-06 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 9e-06 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 2e-05 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 2e-05 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 2e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-04 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 7e-05 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 4e-04 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 5e-04 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 5e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 6e-04 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 6e-04 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 7e-04 |
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
Score = 64.4 bits (157), Expect = 4e-14
Identities = 19/64 (29%), Positives = 25/64 (39%), Gaps = 8/64 (12%)
Query: 204 ETLTCPSC-------KVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYH 256
++CP C + V T+C HVFC CLR CP C YH
Sbjct: 2 AMVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLR-DSLKNANTCPTCRKKINHKRYH 60
Query: 257 RLYL 260
+Y+
Sbjct: 61 PIYI 64
|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.64 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.58 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.58 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.58 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.57 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.56 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 99.56 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.54 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.53 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.53 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.51 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.5 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.49 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.49 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.49 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.49 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.49 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.48 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.48 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.48 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.47 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.47 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.45 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 99.44 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.43 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.43 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.43 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.43 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.42 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 99.41 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.41 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 99.41 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.4 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.39 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 99.39 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.38 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.38 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.37 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 99.37 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.35 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.34 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.33 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.32 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 99.32 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 99.31 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 99.3 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.3 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.3 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.3 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.29 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 99.28 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.27 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 99.27 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 99.26 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.25 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.23 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.21 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.21 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 99.2 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 99.18 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 99.14 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.11 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 99.1 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.97 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.93 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.89 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 98.76 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 98.67 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 98.58 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.45 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.31 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.16 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.11 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 97.9 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.77 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 97.74 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.72 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.62 | |
| 1joc_A | 125 | EEA1, early endosomal autoantigen 1; FYVE domain, | 97.18 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 97.01 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 96.95 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.95 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.94 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.69 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.61 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 96.55 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.51 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 96.5 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 96.36 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.02 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.9 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 95.83 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.62 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 95.56 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.55 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.53 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 95.39 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.06 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.73 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.68 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 94.67 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 94.67 | |
| 1z60_A | 59 | TFIIH basal transcription factor complex P44 subun | 94.44 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 94.35 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 94.21 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.11 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.86 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 93.78 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 93.42 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 93.13 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.98 | |
| 1weo_A | 93 | Cellulose synthase, catalytic subunit (IRX3); stru | 92.92 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 92.89 | |
| 2zet_C | 153 | Melanophilin; complex, GTP-binding protein, GTPase | 92.69 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 92.54 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 92.25 | |
| 1y02_A | 120 | CARP2, FYVE-ring finger protein sakura; zinc-bindi | 91.5 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 91.17 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 90.7 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 90.57 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.07 | |
| 2fiy_A | 309 | Protein FDHE homolog; FDHE protein, structural gen | 90.02 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 89.98 | |
| 1zbd_B | 134 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 89.69 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 89.54 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 89.52 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 89.39 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 89.09 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 89.05 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 88.97 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 88.73 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 88.62 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 88.57 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 88.02 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 87.58 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 87.47 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 87.29 | |
| 2gmg_A | 105 | Hypothetical protein PF0610; winged-helix like pro | 86.85 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 86.71 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 86.48 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 86.07 | |
| 3t7l_A | 90 | Zinc finger FYVE domain-containing protein 16; str | 85.24 | |
| 2yw8_A | 82 | RUN and FYVE domain-containing protein 1; structur | 85.01 | |
| 1vfy_A | 73 | Phosphatidylinositol-3-phosphate binding FYVE doma | 84.82 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 84.82 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 84.67 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 84.46 | |
| 1z2q_A | 84 | LM5-1; membrane protein, FYVE domain, zinc-finger; | 84.32 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 84.16 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 84.13 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 84.05 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 84.01 | |
| 1dvp_A | 220 | HRS, hepatocyte growth factor-regulated tyrosine k | 83.91 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 83.25 | |
| 1yuz_A | 202 | Nigerythrin; rubrythrin, rubredoxin, hemerythrin, | 82.81 | |
| 3zyq_A | 226 | Hepatocyte growth factor-regulated tyrosine kinas | 82.38 | |
| 1wfk_A | 88 | Zinc finger, FYVE domain containing 19; riken stru | 82.33 | |
| 3pwf_A | 170 | Rubrerythrin; non heme iron peroxidases, oxidative | 82.19 | |
| 1x4u_A | 84 | Zinc finger, FYVE domain containing 27 isoform B; | 81.92 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 81.09 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 80.98 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 80.87 | |
| 2jne_A | 101 | Hypothetical protein YFGJ; zinc fingers, two zinc, | 80.64 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 80.34 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 80.09 |
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
Probab=99.64 E-value=3.5e-16 Score=121.11 Aligned_cols=51 Identities=27% Similarity=0.638 Sum_probs=45.0
Q ss_pred ccccCcccccccccccceeccccccccHHHHHHHhccCCCCccCCCcccCCC
Q psy16189 202 YKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGAN 253 (262)
Q Consensus 202 ~~~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~ 253 (262)
+...+.|+||...|.+|+++||||+||..|+..|+. +...||.||.++...
T Consensus 50 ~~~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~-~~~~CP~Cr~~~~~~ 100 (138)
T 4ayc_A 50 LENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMK-RKIECPICRKDIKSK 100 (138)
T ss_dssp HHHHSBCTTTCSBCSSEEEETTSCEEEHHHHHHHTT-TCSBCTTTCCBCCCE
T ss_pred ccccCCCcccCcccCCceECCCCCCccHHHHHHHHH-cCCcCCCCCCcCCCC
Confidence 334588999999999999999999999999999987 567899999999654
|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3t7l_A Zinc finger FYVE domain-containing protein 16; structural genomics consortium, SGC, lipid BIND protein, transport protein; 1.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A | Back alignment and structure |
|---|
| >1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A | Back alignment and structure |
|---|
| >3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* | Back alignment and structure |
|---|
| >1wfk_A Zinc finger, FYVE domain containing 19; riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Mus musculus} SCOP: g.50.1.1 | Back alignment and structure |
|---|
| >3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A | Back alignment and structure |
|---|
| >1x4u_A Zinc finger, FYVE domain containing 27 isoform B; phosphoinositide binding, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 262 | ||||
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 1e-13 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 3e-09 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 4e-08 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 1e-07 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-07 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 5e-05 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 1e-04 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 1e-04 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 2e-04 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 4e-04 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 0.001 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 0.002 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 63.0 bits (153), Expect = 1e-13
Identities = 14/54 (25%), Positives = 23/54 (42%)
Query: 201 EYKETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGAND 254
+ ++++C C+ D V T C H+FC C+ + CP C D
Sbjct: 19 HFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTD 72
|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 262 | |||
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.65 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.62 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.57 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.53 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.53 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.53 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.52 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.48 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 99.41 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.4 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.36 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.29 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.26 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.07 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.02 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.86 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.47 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 96.34 | |
| d1z60a1 | 59 | TFIIH p44 subunit cysteine-rich domain {Human (Hom | 95.7 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 94.89 | |
| d1weoa_ | 93 | Cellulose synthase A catalytic subunit 7, IRX3 {Th | 93.59 | |
| d1y02a2 | 51 | Rififylin (FYVE-RING finger protein Sakura) {Human | 93.46 | |
| d2jnea1 | 71 | Hypothetical protein YfgJ {Escherichia coli [TaxId | 90.18 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 87.52 | |
| d1nnqa2 | 37 | Rubrerythrin, C-terminal domain {Archaeon Pyrococc | 87.44 | |
| d2fiya1 | 290 | FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId | 87.07 | |
| d1yuza2 | 36 | Nigerythrin, C-terminal domain {Desulfovibrio vulg | 87.02 | |
| d1wfpa_ | 74 | Zinc finger A20 and AN1 domains containing protein | 85.8 | |
| d1joca1 | 64 | Eea1 {Human (Homo sapiens) [TaxId: 9606]} | 85.67 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 85.57 | |
| d1dvpa2 | 72 | Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 | 85.12 | |
| d1vfya_ | 67 | vps27p protein {Baker's yeast (Saccharomyces cerev | 84.77 | |
| d1lkoa2 | 44 | Rubrerythrin, C-terminal domain {Desulfovibrio vul | 84.38 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 84.0 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 82.8 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 82.25 | |
| d1wfla_ | 74 | Zinc finger A20 domain containing protein 2 {Mouse | 80.96 |
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.65 E-value=1.9e-17 Score=115.27 Aligned_cols=54 Identities=26% Similarity=0.584 Sum_probs=49.1
Q ss_pred ccCcccccccccccceeccccccccHHHHHHHhccCCCCccCCCcccCCCCccc
Q psy16189 204 ETLTCPSCKVKRKDAVLTKCFHVFCWDCLRTRYETRQRKCPKCNAAFGANDYHR 257 (262)
Q Consensus 204 ~~~~C~iC~~~~~~~v~l~CgH~fC~~Ci~~~~~~~~~~CP~Cr~~~~~~d~~~ 257 (262)
..+.|+||.+.+.+|++++|||+||..|+..|+..+.++||.||.++...|+.+
T Consensus 22 ~~l~C~IC~~~~~~pv~~~CgH~FC~~Ci~~~~~~~~~~CP~Cr~p~~~~~l~~ 75 (86)
T d1rmda2 22 KSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLES 75 (86)
T ss_dssp HHTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHTCSBCTTTCCBCCGGGCBC
T ss_pred cCcCCccCCcchhcceecCCCChhhHHHHHHHHhhCCCcCcccCCCCChhhccC
Confidence 348899999999999999999999999999999888889999999998777653
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vfya_ g.50.1.1 (A:) vps27p protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lkoa2 g.41.5.1 (A:148-191) Rubrerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|