Psyllid ID: psy16206


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV
cEEEEEEccccHHHHHHHHHHHHHHHHccccccccEEEEEEEEEEccccHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHccccccEEEEcccccccccccccccEEEEEccHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHcccccccccccccEEEEEEcccccccHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccEEEEEEcccccccccEEEEEEEEEccccEEEEEEEcccccccccccccccccccccccccEEEEEEccccEEEEEEEcccEEEEccccccEEEEHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHHccccEEEEEEEEEccccccEEcccccEEccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccHHHHccccccccccccccccccccHHHHHcccccEEEEEEcccccccccccccEEEEccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHccccccccccHHHHHHcccEEEEEEccccccccccc
ccEEEEEccccHHHHHHHHHHHHHHHccccccccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHccccccEEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEcccEEEcccccccccHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHHHHccccEEEEEEEEccccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHccEccccEEEEEccccccEcccEEEEEEEcccccEEEEEEcccccEEEccccccccccccccccccEEEEEEcccccEEEEEEcccEEEEEccccccccHHHHHHHHHHHHHcccEEEEEccccccccEccccccEcHHHHHHHcccccEEccccEccHHHHccEEEccccEEEcEEEEEEccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHcccHHHHHHHHHHHHccccccEccHHHHHHHHHHccccEEEEEEHHHHHHcccccccEEEEccccccEEEccEEEccccHccccEEEEEccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccEEEEEcccccHHHccc
mkivgifgpneeEVATAFEIAVRRINKdfkalppdiilepIVQHVENYDSLHTAKLMCNATsegiaaifgpqsieNRNIIESMCQmfdiphveafwdpnkyfiptngvhgvnvypeshliSKGISVIINDMDWDTFTIIYETHDNLVYLQQVLEnahdddkeirpgrpsvtirqlppdtddyrPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINahtvdfqdfqpgyanittvrminptnphirsimngwiyeenergrslnvrAETVKIEAALMYDAVYLFAAALQslgerkplptplscenpsswqhglgignlMKSItidgmtgrinldsqtgrrnsFSLEFVEYVSDQWKVLGTWntafglnhsrTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLfqgepymmknpetgelyGYSVDLIKMIANELNFTYKFVLERentygtlnpqtgkwnGLIGELQEQRADLAicdltitserraavdftmPFMTLGISILyrkpakkqpdlfsfleplsFDVWVYMATAYLGVSLLLFFLARISsgsrlrysaknSNVSLYQRMHSamessrpsvfvksnkegVERVVKEKGKYAFFMESTGieyevekncdlmqvgglldskgygiamptSKFLAKFSFGFAKLRVLfqgepymmknpetgelyGYSVDLIKMIANELNFTYKFVLERentygtlnpqtgkwngLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTntrmnppiknVEDLAKAGRIKYgcvemgstrnffkv
mkivgifgpneeevATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAhdddkeirpgrpsvtirqlppdtddYRPLLKEIknsseshilldCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAfglnhsrtveqmdkekkekienrtltvtsktfakLRVLfqgepymmknpETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSerraavdftMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSamessrpsvfvksnkegvervvkekgkYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGcvemgstrnffkv
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDtfilffiysilffiytfVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV
***VGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLE*****************************************HILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLG***************SWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNH******************TLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRL***********************************ERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMG********
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLG****************WQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRT***********IENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILY*******PDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVL*****YMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNP**********ELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRM*************KSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGST******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query821 2.2.26 [Sep-21-2011]
B1AS29919 Glutamate receptor ionotr yes N/A 0.644 0.575 0.336 5e-89
Q38PU2919 Glutamate receptor ionotr N/A N/A 0.644 0.575 0.336 1e-88
Q13003919 Glutamate receptor ionotr yes N/A 0.649 0.579 0.338 2e-88
Q13002908 Glutamate receptor ionotr no N/A 0.652 0.590 0.332 2e-88
P42260908 Glutamate receptor ionotr no N/A 0.652 0.590 0.332 4e-88
P39087908 Glutamate receptor ionotr no N/A 0.652 0.590 0.331 1e-87
Q60934836 Glutamate receptor ionotr no N/A 0.649 0.637 0.335 1e-87
Q38PU3908 Glutamate receptor ionotr N/A N/A 0.652 0.590 0.331 2e-87
P42264919 Glutamate receptor ionotr yes N/A 0.646 0.577 0.327 2e-87
P39086918 Glutamate receptor ionotr no N/A 0.649 0.580 0.329 1e-86
>sp|B1AS29|GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus GN=Grik3 PE=2 SV=1 Back     alignment and function desciption
 Score =  329 bits (844), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 197/586 (33%), Positives = 312/586 (53%), Gaps = 57/586 (9%)

Query: 1   MKIVGIF----GPNEEEVAT---AFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHT 53
           ++I GIF    GPN + +     AF  +   IN++ + L P+  L   +Q +  +DS   
Sbjct: 36  IRIGGIFEYADGPNAQVMNAEEHAFRFSANIINRN-RTLLPNTTLTYDIQRIHFHDSFEA 94

Query: 54  AKLMCNATSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNV 113
            K  C+  + G+ AIFGP      N ++S+C   ++PH++  W    + +       VN+
Sbjct: 95  TKKACDQLALGVVAIFGPSQGSCTNAVQSICNALEVPHIQLRW--KHHPLDNKDTFYVNL 152

Query: 114 YPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSV--T 171
           YP+   +S  I  ++  + W + T++Y+    L+ LQ+++         + P R ++   
Sbjct: 153 YPDYASLSHAILDLVQSLKWRSATVVYDDSTGLIRLQELI---------MAPSRYNIRLK 203

Query: 172 IRQLPPDTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTS 231
           IRQLP D+DD RPLLKE+K   E  I+ DCS      ILKQA  + +M +Y ++I +   
Sbjct: 204 IRQLPIDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQILKQAMAMGMMTEYYHFIFTT-- 261

Query: 232 YWINAHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAET--- 288
             ++ + +D + ++    N+T  R++N  NPH+ +I+  W  E  +       RAE+   
Sbjct: 262 --LDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWAMERLQAAP----RAESGLL 315

Query: 289 ---VKIEAALMYDAVYLFAAALQSLGERKPLPT--PLSCENPSSWQHGLGIGNLMKSITI 343
              +  +AAL+YDAV++ +   Q    R P  T   L C    +W+ G    N +K    
Sbjct: 316 DGVMMTDAALLYDAVHIVSVCYQ----RAPQMTVNSLQCHRHKAWRFGGRFMNFIKEAQW 371

Query: 344 DGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKI 403
           +G+TGRI  +  +G R  F L+ +    D  + +G W+ A GLN +   +       + +
Sbjct: 372 EGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEVAKGRGPNVTDSL 431

Query: 404 ENRTLTVTSKTFAKLRVLFQGEPYMMKNPETGELYG------YSVDLIKMIANELNFTYK 457
            NR+L VT+       VL   EP++M       LYG      Y +DL+K +A+ L F+Y+
Sbjct: 432 TNRSLIVTT-------VL--EEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFSYE 482

Query: 458 FVLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGIS 517
             L  +  YG  + + G+WNG++ EL + +ADLA+  LTIT  R  A+DF+ PFMTLG+S
Sbjct: 483 IRLVEDGKYGAQDDK-GQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVS 541

Query: 518 ILYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARIS 563
           ILYRKP    P +FSFL PLS D+W+Y+  AYLGVS +LF +AR S
Sbjct: 542 ILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFS 587




Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. This receptor binds domoate > kainate >> L-glutamate = quisqualate >> AMPA = NMDA.
Mus musculus (taxid: 10090)
>sp|Q38PU2|GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis GN=GRIK3 PE=2 SV=1 Back     alignment and function description
>sp|Q13003|GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens GN=GRIK3 PE=2 SV=3 Back     alignment and function description
>sp|Q13002|GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens GN=GRIK2 PE=1 SV=1 Back     alignment and function description
>sp|P42260|GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus GN=Grik2 PE=1 SV=2 Back     alignment and function description
>sp|P39087|GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus GN=Grik2 PE=1 SV=4 Back     alignment and function description
>sp|Q60934|GRIK1_MOUSE Glutamate receptor ionotropic, kainate 1 OS=Mus musculus GN=Grik1 PE=2 SV=2 Back     alignment and function description
>sp|Q38PU3|GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis GN=GRIK2 PE=2 SV=1 Back     alignment and function description
>sp|P42264|GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus GN=Grik3 PE=1 SV=1 Back     alignment and function description
>sp|P39086|GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens GN=GRIK1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
170068371 968 glutamate receptor [Culex quinquefasciat 0.791 0.671 0.381 1e-135
242011433904 predicted protein [Pediculus humanus cor 0.649 0.589 0.431 1e-128
357615315 945 hypothetical protein KGM_08876 [Danaus p 0.652 0.567 0.419 1e-125
195390963858 GJ24267 [Drosophila virilis] gi|19415222 0.647 0.620 0.440 1e-122
195055169858 GH17276 [Drosophila grimshawi] gi|193892 0.647 0.620 0.438 1e-122
195113113859 GI22149 [Drosophila mojavensis] gi|19391 0.647 0.619 0.438 1e-122
194742810853 GF17009 [Drosophila ananassae] gi|190626 0.647 0.623 0.437 1e-121
195449615858 GK22690 [Drosophila willistoni] gi|19416 0.647 0.620 0.437 1e-121
198452081858 GA17711 [Drosophila pseudoobscura pseudo 0.647 0.620 0.437 1e-121
194899644853 GG15059 [Drosophila erecta] gi|190651072 0.647 0.623 0.438 1e-121
>gi|170068371|ref|XP_001868841.1| glutamate receptor [Culex quinquefasciatus] gi|167864409|gb|EDS27792.1| glutamate receptor [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  490 bits (1261), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 291/762 (38%), Positives = 430/762 (56%), Gaps = 112/762 (14%)

Query: 5   GIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEG 64
            IF  +  E   AF  A+ R+N   K       + PI+++V   DS  T K +C   SEG
Sbjct: 101 AIFHEDNYEAEVAFRYAIERVNMHEKHFE----MTPIIKYVSPDDSFKTEKKVCELASEG 156

Query: 65  IAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVH------GVNVYPESH 118
           + AIFGP S+    I+ S+C+  +IPH+   WDP     P  G+        +N+YPE+ 
Sbjct: 157 VTAIFGPSSMLTSGIVSSICKTIEIPHIITHWDPE----PLGGIDPELQAMTINLYPEAD 212

Query: 119 LISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPD 178
           ++S+ +  +I D  W +FTIIY++ + L+ L+ VL+    +D  I       T+RQ+  D
Sbjct: 213 VLSRALRDLIVDYSWKSFTIIYDSDEGLMRLKDVLQIHGPNDNPI-------TVRQID-D 264

Query: 179 TDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHT 238
             DYRPLLK+I +S ESHI+L+   DK + IL+QAKEV ++ +YQ+YI++     ++AHT
Sbjct: 265 DPDYRPLLKDIASSGESHIILEVHPDKILEILRQAKEVKMLEEYQSYIITS----LDAHT 320

Query: 239 VDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYD 298
           +DF++ +   +NITT+R+++  +  I++ ++ W   E    R   V  E V+ E+AL  D
Sbjct: 321 LDFEELKYSRSNITTLRLMDTKSFDIKNAVHDWEQGEARMKRVFRVSPEHVRTESALYND 380

Query: 299 AVYLFAAALQSLGERKPL-PTPLSC--ENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQ 355
           AV ++A A++ L   + + P+ LSC  +N   W  GL I N MK  T  G+TG I  D  
Sbjct: 381 AVKIYATAIRELDATEEITPSRLSCGSKNLRQWPFGLRIVNYMKVKTEYGITGPIIFD-D 439

Query: 356 TGRRNSFSLEFVE-YVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKT 414
            GRR  F L+ +E +  + +K +  W+   G+N++R+++++  +  E ++N+T  V S+ 
Sbjct: 440 NGRRTHFQLDIIELHQQEGFKKIAIWDPRGGVNYTRSIDEVHLQIVESLQNKTFIVASRI 499

Query: 415 FAKLRVLFQGEPYMM-KNPETGE-------LYGYSVDLIKMIANELNFTYKFVLERENTY 466
                    G P++  K  + GE         GYS++LI  I+  L F Y+  +  +  Y
Sbjct: 500 ---------GAPFLTWKEKKEGEYLEGNNRFEGYSLELIDGISKILGFQYRMEIVPDGKY 550

Query: 467 GTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKK 526
           G+ N  T KW+GL+  L +++ADLAICDLTIT ERR AVDFTMPFMTLGISILY KP  +
Sbjct: 551 GSYNKATKKWDGLVKYLLDRKADLAICDLTITYERRTAVDFTMPFMTLGISILYAKPVPQ 610

Query: 527 QPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSG--------------------- 565
             DLFSFL PLS DVW+YMATAYLGVS+LLF L+R++                       
Sbjct: 611 PKDLFSFLSPLSLDVWIYMATAYLGVSVLLFVLSRMAPADWENPHPCKQDEVEEVENIWN 670

Query: 566 --------------------------------SRLRYSA----------KNSNVSLYQRM 583
                                           S+++Y A          ++SN S YQRM
Sbjct: 671 MLNALWLTMGSIMGQGCDILPNIESAEDLAKQSKIKYGAVLGGSTLSFFRSSNFSTYQRM 730

Query: 584 HSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKNCDLMQVGGLLDSKG 643
            +AMES+RPSVF KSN EG +RV+K +G YAF MEST +EY  E+ C+L Q+GGLLDSKG
Sbjct: 731 WAAMESTRPSVFTKSNDEGRDRVLKGRGLYAFLMESTSLEYITERYCELTQIGGLLDSKG 790

Query: 644 YGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYG 685
           YGIAMP +    + +   A L++  +G+ + +K     E++G
Sbjct: 791 YGIAMPVNSPY-RTAISGAVLKMQEEGKLHQLKTRWWKEMHG 831




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242011433|ref|XP_002426455.1| predicted protein [Pediculus humanus corporis] gi|212510560|gb|EEB13717.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357615315|gb|EHJ69593.1| hypothetical protein KGM_08876 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195390963|ref|XP_002054136.1| GJ24267 [Drosophila virilis] gi|194152222|gb|EDW67656.1| GJ24267 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195055169|ref|XP_001994492.1| GH17276 [Drosophila grimshawi] gi|193892255|gb|EDV91121.1| GH17276 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195113113|ref|XP_002001113.1| GI22149 [Drosophila mojavensis] gi|193917707|gb|EDW16574.1| GI22149 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194742810|ref|XP_001953893.1| GF17009 [Drosophila ananassae] gi|190626930|gb|EDV42454.1| GF17009 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195449615|ref|XP_002072149.1| GK22690 [Drosophila willistoni] gi|194168234|gb|EDW83135.1| GK22690 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198452081|ref|XP_001358619.2| GA17711 [Drosophila pseudoobscura pseudoobscura] gi|198131779|gb|EAL27760.2| GA17711 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194899644|ref|XP_001979369.1| GG15059 [Drosophila erecta] gi|190651072|gb|EDV48327.1| GG15059 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query821
FB|FBgn0026255 1002 clumsy "clumsy" [Drosophila me 0.650 0.532 0.390 1.7e-126
FB|FBgn0038837853 CG3822 [Drosophila melanogaste 0.456 0.439 0.476 8.7e-115
UNIPROTKB|Q13002908 GRIK2 "Glutamate receptor iono 0.662 0.599 0.330 1.4e-103
RGD|2733908 Grik2 "glutamate receptor, ion 0.662 0.599 0.330 1.7e-103
UNIPROTKB|P42260908 Grik2 "Glutamate receptor iono 0.662 0.599 0.330 1.7e-103
UNIPROTKB|F1LP48870 Grik2 "Glutamate receptor iono 0.657 0.620 0.332 2.2e-103
UNIPROTKB|F1MG21908 GRIK2 "Uncharacterized protein 0.662 0.599 0.328 3.6e-103
MGI|MGI:95815908 Grik2 "glutamate receptor, ion 0.662 0.599 0.328 3.6e-103
UNIPROTKB|F1P7K6891 GRIK2 "Uncharacterized protein 0.657 0.606 0.330 4.6e-103
UNIPROTKB|F1RYR0872 GRIK5 "Uncharacterized protein 0.657 0.619 0.330 4.6e-103
FB|FBgn0026255 clumsy "clumsy" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 993 (354.6 bits), Expect = 1.7e-126, Sum P(2) = 1.7e-126
 Identities = 224/573 (39%), Positives = 338/573 (58%)

Query:     3 IVG-IFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNAT 61
             +VG IF  +++E   AF  AV R N     L  ++ L PIV +    DS    K++CN  
Sbjct:    26 MVGSIFTSDKDESEIAFRTAVDRAN----ILERNVELVPIVVYANTDDSFIMEKMVCNLI 81

Query:    62 SEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPT--NGVHGVNVYPESHL 119
             S+G+ AIFGP +  + +II S+C   DIPH+   W PN+  IP   +    +NV+P++ L
Sbjct:    82 SQGVIAIFGPSTGSSSDIIASICDTLDIPHIVYDWIPNES-IPDREHSTMTLNVHPDNLL 140

Query:   120 ISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDT 179
             +S+G++ I+    W +FT++YET   L  LQ +L+          P     T++QL P  
Sbjct:   141 LSQGLAEIVQSFAWRSFTVVYETDKELQQLQDILQVGE-------PISNPTTVKQLGPG- 192

Query:   180 DDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTV 239
             DD+RP LKEIK S+++ ++L C+ D  + IL+QA E+ ++G+YQ+  + L    ++ H++
Sbjct:   193 DDHRPFLKEIKLSTDNCLILHCAPDNLLKILQQANELKMLGEYQSVFIPL----LDTHSI 248

Query:   240 DFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDA 299
             DF +     ANITTVR+++P++ H++++++ W   E   GR   V    VK +  L+ DA
Sbjct:   249 DFGELSGVEANITTVRLMDPSDFHVKNVVHDWEEREKREGRYFKVDPNRVKSQMILLNDA 308

Query:   300 VYLFAAALQSLGERKPLPTP-LSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGR 358
             V+LF+  L  LG  + L  P L C     W  G  I   +K+ + +  TGRI+ + + G+
Sbjct:   309 VWLFSKGLTELGIFEELTAPDLECRRKKPWPFGKRIIEFIKARSEETSTGRIDFN-ENGQ 367

Query:   359 RNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTFAKL 418
             R+ F+L F+E  SD +  L TW+   GL+     E+ +K   +K+ N+T  V+S+     
Sbjct:   368 RSFFTLRFMELNSDGFLDLATWDPVNGLDVLNDDEESEKRVGQKLSNKTFIVSSRL---- 423

Query:   419 RVLFQGEPYM-MKNPETGEL------Y-GYSVDLIKMIANELNFTYKFVLERENTYGTLN 470
                  G P++ ++ P+ GE+      Y GYS+DLI  IA  LNF ++F +  +  YG LN
Sbjct:   424 -----GAPFLTLREPQEGEILTGNSRYEGYSIDLINEIAKMLNFKFEFRMSPDGKYGALN 478

Query:   471 PQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDL 530
               T  W+G++ +L +  ADL ICDLT+TS RR AVDFT PFMTLGISIL+ KP     DL
Sbjct:   479 KVTQTWDGIVRQLIDGNADLGICDLTMTSSRRQAVDFTPPFMTLGISILFSKPPTPPTDL 538

Query:   531 FSFLEPLSFDVWVYMATAYLGVSLLLFFLARIS 563
             FSFL P S DVW+YM +AYL +SLLLF LAR++
Sbjct:   539 FSFLSPFSLDVWIYMGSAYLFISLLLFALARMA 571


GO:0015277 "kainate selective glutamate receptor activity" evidence=ISS
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IEA
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0060025 "regulation of synaptic activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
FB|FBgn0038837 CG3822 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q13002 GRIK2 "Glutamate receptor ionotropic, kainate 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2733 Grik2 "glutamate receptor, ionotropic, kainate 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P42260 Grik2 "Glutamate receptor ionotropic, kainate 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP48 Grik2 "Glutamate receptor ionotropic, kainate 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG21 GRIK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:95815 Grik2 "glutamate receptor, ionotropic, kainate 2 (beta 2)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7K6 GRIK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYR0 GRIK5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
cd06382327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 9e-89
cd06368324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 9e-80
cd06393384 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal le 2e-59
cd06351328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 5e-59
cd06380382 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole 3e-43
pfam01094343 pfam01094, ANF_receptor, Receptor family ligand bi 5e-43
cd06390364 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine 5e-28
cd06389370 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine 6e-26
pfam00060 268 pfam00060, Lig_chan, Ligand-gated ion channel 1e-25
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 5e-25
cd06387372 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine 7e-24
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 4e-23
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 1e-22
cd06388371 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine 1e-22
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 4e-20
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 2e-18
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 6e-16
smart0091862 smart00918, Lig_chan-Glu_bd, Ligated ion channel L 6e-16
pfam1061365 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L- 3e-15
pfam1061365 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L- 3e-15
cd06394333 cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leuc 1e-14
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 3e-14
cd06352389 cd06352, PBP1_NPR_GC_like, Ligand-binding domain o 2e-13
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 4e-11
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 7e-11
PRK11260266 PRK11260, PRK11260, cystine transporter subunit; P 8e-10
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 8e-09
PRK09495247 PRK09495, glnH, glutamine ABC transporter periplas 1e-07
TIGR01096250 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-b 2e-07
cd06370404 cd06370, PBP1_Speract_GC_like, Ligand-binding doma 2e-05
cd06268298 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas 2e-05
cd06383368 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ 3e-05
TIGR04262257 TIGR04262, orph_peri_GRRM, extracellular substrate 3e-05
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-04
cd06366350 cd06366, PBP1_GABAb_receptor, Ligand-binding domai 1e-04
cd06379377 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i 3e-04
cd06367362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole 9e-04
cd06381363 cd06381, PBP1_iGluR_delta_like, N-terminal leucine 0.001
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
 Score =  283 bits (726), Expect = 9e-89
 Identities = 130/387 (33%), Positives = 211/387 (54%), Gaps = 61/387 (15%)

Query: 2   KIVGIFG-PNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNA 60
           +I  IF   ++     AF  A+ RIN++ K L  +  LE  ++ V+  DS  T K +C+ 
Sbjct: 1   RIGAIFDDDDDSGEELAFRYAIDRINRE-KELLANTTLEYDIKRVKPDDSFETTKKVCDL 59

Query: 61  TSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLI 120
             +G+AAIFGP S E  +I++S+C   +IPH++  WDP      +N    +N+YP +  +
Sbjct: 60  LQQGVAAIFGPSSSEASSIVQSICDAKEIPHIQTRWDPEPK---SNRQFTINLYPSNADL 116

Query: 121 SKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTD 180
           S+  + I+   +W +FTIIYE+ + L+ LQ++L+              ++T+RQL  D  
Sbjct: 117 SRAYADIVKSFNWKSFTIIYESAEGLLRLQELLQAFG-------ISGITITVRQLDDD-L 168

Query: 181 DYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVD 240
           DYRPLLKEIKNS ++ I++DCS D  + +LKQA++V +M +Y +YI  +T+  ++ HT+D
Sbjct: 169 DYRPLLKEIKNSGDNRIIIDCSADILIELLKQAQQVGMMSEYYHYI--ITN--LDLHTLD 224

Query: 241 FQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAV 300
            +D++    NIT  R+++P +P ++ ++       +E  R L      V  E+ALMYDAV
Sbjct: 225 LEDYRYSGVNITGFRLVDPDSPEVKEVIRSLELSWDEGCRILPST--GVTTESALMYDAV 282

Query: 301 YLFAAALQSLGERKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRN 360
           YLF                                         G+TGRI  DS +G+R+
Sbjct: 283 YLF-----------------------------------------GLTGRIEFDS-SGQRS 300

Query: 361 SFSLEFVEYVSDQWKVLGTWNTAFGLN 387
           +F+L+ +E      + +GTWN++ GLN
Sbjct: 301 NFTLDVIELTESGLRKVGTWNSSEGLN 327


N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels activated by kainate and glutamate when expressed in heterologous systems. Kainate receptors are involved in excitatory neurotransmission by activating postsynaptic receptors and in inhibitory neurotransmission by modulating release of the inhibitory neurotransmitter GABA through a presynaptic mechanism. Kainate receptors are closely related to AMAP receptors. In contrast of AMPA receptors, kainate receptors play only a minor role in signaling at synapses and their function is not well defined. Length = 327

>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107388 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|107385 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107384 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information
>gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|214911 smart00918, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|204533 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|204533 pfam10613, Lig_chan-Glu_bd, Ligated ion channel L-glutamate- and glycine-binding site Back     alignment and domain information
>gnl|CDD|107389 cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183061 PRK11260, PRK11260, cystine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|236540 PRK09495, glnH, glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>gnl|CDD|233269 TIGR01096, 3A0103s03R, lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>gnl|CDD|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>gnl|CDD|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>gnl|CDD|211985 TIGR04262, orph_peri_GRRM, extracellular substrate-binding orphan protein, GRRM family Back     alignment and domain information
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>gnl|CDD|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>gnl|CDD|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>gnl|CDD|107376 cd06381, PBP1_iGluR_delta_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 821
KOG1054|consensus 897 100.0
KOG4440|consensus 993 100.0
KOG1053|consensus 1258 100.0
cd06387372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 100.0
cd06392400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 100.0
cd06393384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 100.0
cd06390364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 100.0
cd06388371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 100.0
cd06389370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 100.0
cd06380382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 100.0
cd06391400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 100.0
cd06394333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 100.0
cd06382327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 100.0
KOG1052|consensus 656 100.0
cd06381363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 100.0
cd06386387 PBP1_NPR_C_like Ligand-binding domain of type C na 100.0
cd06379377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 100.0
cd06368324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 100.0
cd06367362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 100.0
cd06362452 PBP1_mGluR Ligand binding domain of the metabotrop 100.0
cd06373396 PBP1_NPR_like Ligand binding domain of natriuretic 100.0
cd06372391 PBP1_GC_G_like Ligand-binding domain of membrane g 100.0
cd06385405 PBP1_NPR_A Ligand-binding domain of type A natriur 100.0
cd06366350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 100.0
cd06352389 PBP1_NPR_GC_like Ligand-binding domain of membrane 100.0
cd06370404 PBP1_Speract_GC_like Ligand-binding domain of memb 100.0
cd06361403 PBP1_GPC6A_like Ligand-binding domain of the promi 100.0
cd06374472 PBP1_mGluR_groupI Ligand binding domain of the gro 100.0
cd06376463 PBP1_mGluR_groupIII Ligand-binding domain of the g 100.0
cd06377382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 100.0
cd06384399 PBP1_NPR_B Ligand-binding domain of type B natriur 100.0
cd06383368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 100.0
cd06371382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 100.0
cd06375458 PBP1_mGluR_groupII Ligand binding domain of the gr 100.0
cd06365469 PBP1_Pheromone_receptor Ligand-binding domain of t 100.0
cd06364510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 100.0
cd06363410 PBP1_Taste_receptor Ligand-binding domain of the T 100.0
PF01094348 ANF_receptor: Receptor family ligand binding regio 100.0
cd06351328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 100.0
cd06378362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 100.0
cd06342334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 100.0
cd06345344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 100.0
PRK15404369 leucine ABC transporter subunit substrate-binding 100.0
cd06338345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 100.0
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 100.0
cd06348344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 100.0
TIGR03669374 urea_ABC_arch urea ABC transporter, substrate-bind 100.0
cd06355348 PBP1_FmdD_like Periplasmic component (FmdD) of an 100.0
COG0683366 LivK ABC-type branched-chain amino acid transport 100.0
cd06340347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 100.0
cd06344332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 100.0
cd06350348 PBP1_GPCR_family_C_like Ligand-binding domain of m 100.0
cd06359333 PBP1_Nba_like Type I periplasmic binding component 100.0
cd06331333 PBP1_AmiC_like Type I periplasmic components of am 99.98
cd06329342 PBP1_SBP_like_3 Periplasmic solute-binding domain 99.98
TIGR03407359 urea_ABC_UrtA urea ABC transporter, urea binding p 99.98
cd06330346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 99.97
cd06343362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 99.97
cd06347334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 99.97
cd06349340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 99.97
cd06357360 PBP1_AmiC Periplasmic binding domain of amidase (A 99.97
cd06328333 PBP1_SBP_like_2 Periplasmic solute-binding domain 99.97
cd06327334 PBP1_SBP_like_1 Periplasmic solute-binding domain 99.97
PF13458343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 99.97
cd06356334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 99.97
cd06336347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 99.97
cd06358333 PBP1_NHase Type I periplasmic-binding protein of t 99.97
cd06360336 PBP1_alkylbenzenes_like Type I periplasmic binding 99.97
KOG1056|consensus878 99.97
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 99.97
cd06332333 PBP1_aromatic_compounds_like Type I periplasmic bi 99.97
cd06335347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 99.97
cd06337357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 99.96
PF13433363 Peripla_BP_5: Periplasmic binding protein domain; 99.96
cd06326336 PBP1_STKc_like Type I periplasmic binding domain o 99.95
cd06339336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.94
TIGR03863347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.93
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.93
KOG1055|consensus865 99.93
cd06341341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 99.92
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.91
cd06333312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.9
cd06369380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.9
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.88
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.85
PRK11260266 cystine transporter subunit; Provisional 99.84
PRK10859482 membrane-bound lytic transglycosylase F; Provision 99.83
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.83
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.82
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.81
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.8
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.8
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.79
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.79
PRK15007243 putative ABC transporter arginine-biding protein; 99.79
PRK15437259 histidine ABC transporter substrate-binding protei 99.78
TIGR02285268 conserved hypothetical protein. Members of this fa 99.71
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.68
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.64
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.58
COG4623473 Predicted soluble lytic transglycosylase fused to 99.57
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.57
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.56
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.51
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 99.35
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 99.2
PF04348536 LppC: LppC putative lipoprotein; InterPro: IPR0074 99.16
KOG1053|consensus 1258 99.1
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 98.79
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.72
KOG1054|consensus897 98.61
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 98.48
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 98.4
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 98.3
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 98.24
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 98.21
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 98.19
PF1061365 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- 98.19
COG3107604 LppC Putative lipoprotein [General function predic 98.14
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 97.95
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 97.92
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 97.84
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 97.77
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 97.76
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 97.76
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 97.69
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 97.66
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 97.64
KOG4440|consensus993 97.57
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 97.52
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 97.51
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 97.49
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 97.46
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 97.44
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 97.44
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 97.41
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 97.31
COG2984322 ABC-type uncharacterized transport system, peripla 97.3
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 97.29
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 97.27
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 97.26
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 97.2
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 97.19
PRK10653295 D-ribose transporter subunit RbsB; Provisional 97.18
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 97.17
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi 97.1
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 97.09
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot 97.08
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 97.02
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b 97.0
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding pr 96.99
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 96.98
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 96.93
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 96.92
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 96.92
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 96.87
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 96.82
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 96.81
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 96.78
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 96.78
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 96.72
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 96.71
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 96.71
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 96.7
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 96.68
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 96.68
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 96.67
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 96.63
cd06306268 PBP1_TorT-like TorT-like proteins, a periplasmic b 96.63
cd06324305 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b 96.58
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 96.56
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 96.56
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 96.55
cd01540289 PBP1_arabinose_binding Periplasmic L-arabinose-bin 96.54
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of unchara 96.5
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi 96.46
PRK10936343 TMAO reductase system periplasmic protein TorT; Pr 96.45
cd06295275 PBP1_CelR Ligand binding domain of a transcription 96.43
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 96.38
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 96.38
COG1879322 RbsB ABC-type sugar transport system, periplasmic 96.35
PRK10423327 transcriptional repressor RbsR; Provisional 96.35
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 96.24
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 96.24
cd06304260 PBP1_BmpA_like Periplasmic binding component of a 96.23
COG1609333 PurR Transcriptional regulators [Transcription] 96.23
TIGR02634302 xylF D-xylose ABC transporter, substrate-binding p 96.2
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 96.2
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 96.18
cd06307275 PBP1_uncharacterized_sugar_binding Periplasmic sug 96.17
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 96.06
PRK15408336 autoinducer 2-binding protein lsrB; Provisional 96.03
cd06302298 PBP1_LsrB_Quorum_Sensing Periplasmic binding domai 95.92
PRK09701311 D-allose transporter subunit; Provisional 95.9
cd06314271 PBP1_tmGBP Periplasmic sugar-binding domain of The 95.89
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 95.84
TIGR02955295 TMAO_TorT TMAO reductase system periplasmic protei 95.79
cd06354265 PBP1_BmpA_PnrA_like Periplasmic binding domain of 95.68
PRK09526342 lacI lac repressor; Reviewed 95.66
PRK09492315 treR trehalose repressor; Provisional 95.64
KOG1052|consensus656 95.56
cd06315280 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi 95.43
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 95.4
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 95.35
PRK14987331 gluconate operon transcriptional regulator; Provis 95.28
TIGR02637302 RhaS rhamnose ABC transporter, rhamnose-binding pr 95.19
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 95.19
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 95.13
PRK11553314 alkanesulfonate transporter substrate-binding subu 95.02
PRK10355330 xylF D-xylose transporter subunit XylF; Provisiona 94.99
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 94.91
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 94.9
PRK10401346 DNA-binding transcriptional regulator GalS; Provis 94.81
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of unchara 94.73
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 94.49
PRK15395330 methyl-galactoside ABC transporter galactose-bindi 94.22
TIGR02122320 TRAP_TAXI TRAP transporter solute receptor, TAXI f 93.69
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 93.66
PRK11041309 DNA-binding transcriptional regulator CytR; Provis 93.56
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 92.4
cd01544270 PBP1_GalR Ligand-binding domain of DNA transcripti 90.61
cd06353258 PBP1_BmpA_Med_like Periplasmic binding domain of t 88.53
TIGR02995 275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 87.77
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharac 85.6
PRK11260266 cystine transporter subunit; Provisional 85.28
PRK07377184 hypothetical protein; Provisional 84.73
TIGR03427328 ABC_peri_uca ABC transporter periplasmic binding p 83.93
PF12683275 DUF3798: Protein of unknown function (DUF3798); In 83.35
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 83.06
TIGR03870 246 ABC_MoxJ methanol oxidation system protein MoxJ. T 82.94
PF14503232 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B. 82.73
PF06506176 PrpR_N: Propionate catabolism activator; InterPro: 81.97
PRK09495247 glnH glutamine ABC transporter periplasmic protein 81.76
>KOG1054|consensus Back     alignment and domain information
Probab=100.00  E-value=4.2e-86  Score=678.96  Aligned_cols=644  Identities=33%  Similarity=0.615  Sum_probs=554.0

Q ss_pred             CcEEEEeCCCchHHHHHHHHHHHHHhcCCCCCCCceEEEEEEEEecCCChhHHHHHHHHHhhcCeEEEEcCCCcchHHHH
Q psy16206          1 MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNII   80 (821)
Q Consensus         1 i~IG~i~~~~~~~~~~a~~lAv~~iN~~~~~ll~~~~l~~~~~D~~~~~~~~a~~~a~~li~~~V~aiiGp~~s~~~~~v   80 (821)
                      |.||.+|+.+.++...|++.|+...|.....--..++|.+++...+..+++..+.+.|...++||.||+|.+.......+
T Consensus        27 iqigglF~~n~~qe~~Afr~~~~~~~~~~~~~~~pf~L~~~~d~~e~a~Sf~~tnafCsq~s~Gv~Aifg~yd~ks~~~l  106 (897)
T KOG1054|consen   27 IQIGGLFPRNTDQEHSAFRFAVQLYNTNQNTTEKPFKLNPHVDNLESANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTL  106 (897)
T ss_pred             eeeccccCCcchHHHHHHHHHHHHhhcCCCCCCCCcccccccchhhhhhhHHHHHHHHHHHhhhHhhheecccccchhhh
Confidence            57899999999888999999999988754311234678888888888899999999999999999999999999999999


Q ss_pred             HHHhccCCCceeeeccCCCCCCCCCCCccEEEEecChhhHHHHHHHHHHhCCCCEEEEEEecCCchhHHHHHHHhcCCCC
Q psy16206         81 ESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDD  160 (821)
Q Consensus        81 ~~i~~~~~iP~is~~~~~~~~~~~~~~~~~~r~~p~~~~~~~al~~~~~~~~w~~v~ii~~~~~~~~~~~~~~~~~~~~~  160 (821)
                      .++|...++|+|+++. |.    ....+|.++++|+.   ..++++++.||+|.+|..+|+.+.+...++.+++.+.   
T Consensus       107 tsfc~aLh~~~vtpsf-p~----~~~~~Fviq~RP~l---~~al~s~i~hy~W~~fv~lyD~~rg~s~Lqai~~~a~---  175 (897)
T KOG1054|consen  107 TSFCGALHVSFVTPSF-PT----DGDNQFVIQMRPAL---KGALLSLIDHYKWEKFVYLYDTDRGLSILQAIMEAAA---  175 (897)
T ss_pred             hhhccceeeeeecccC-Cc----CCCceEEEEeCchH---HHHHHHHHHhcccceEEEEEcccchHHHHHHHHHHHH---
Confidence            9999999999999865 22    34578999999994   6899999999999999999999999999999999998   


Q ss_pred             CcCCCCCCeEEEEEcCC--CCCChHHHHHHhhcCCCcEEEEeCChhHHHHHHHHHHHccccCcceEEEEecccccccccc
Q psy16206        161 KEIRPGRPSVTIRQLPP--DTDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHT  238 (821)
Q Consensus       161 ~~~~~~g~~v~~~~~~~--~~~d~~~~l~~lk~~~~~~ivl~~~~~~~~~~l~~a~~~g~~~~~~~~i~~~~~~~~~~~~  238 (821)
                          ..++.|+...+..  +...|+.+++.|.....+.|+++|..+....++.|+.+.+....+|||++++    ++...
T Consensus       176 ----~~nw~VtA~~v~~~~d~~~yr~~f~~l~~r~e~rv~iDce~~~~~~il~q~i~~~k~~~~YHYvlaN----l~f~d  247 (897)
T KOG1054|consen  176 ----QNNWQVTAINVGNINDVKEYRMLFEMLDRRQENRVLIDCESERRNRILLQVIELGKHVKGYHYVLAN----LGFTD  247 (897)
T ss_pred             ----hcCceEEEEEcCCcccHHHHHHHHHHHhccccceEEEEcccHHHHHHHHHHHHHhhhccceEEEEee----CCCch
Confidence                7799998776543  2444999999999999999999999999999999999999888999999999    88888


Q ss_pred             cCcccccCCceeeEEEEeecCCChhHHHhhhhhhhhhhcccccccccccccchhHHHHHHHHHHHHHHHHHhhccC-CC-
Q psy16206        239 VDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERK-PL-  316 (821)
Q Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~~~a~Al~~~~~~~-~~-  316 (821)
                      .+++.+..+..+++|+++.+.+++-.++|.++|++.....  .+..+..++.+.++++|||+.+.++|++.+.++. .. 
T Consensus       248 ~dl~~f~~g~aNitgFqivn~~~~~~~k~~~~~~~l~~~~--~~g~~~~~~k~tsAlthDailV~~eaf~~~~~q~~~~~  325 (897)
T KOG1054|consen  248 IDLERFQHGGANITGFQIVNKNNPMVKKFIQRWKELDERE--YPGASNDPIKYTSALTHDAILVMAEAFRSLRRQRIDIS  325 (897)
T ss_pred             hhHHHHhcCCcceeEEEEecCCChHHHHHHHHHhhhcccc--cCCCCCCCcchhhhhhhhHHHHHHHHHHHHHHhhhchh
Confidence            8889998889999999999999999999999998876555  3333446788899999999999999999987542 22 


Q ss_pred             --CCCCCCCC--CCCCCCchhHHHhhhhceeccceeeEEEeCCCCccceeEEEEEEEeecceEEEEEEecCCCcceeccc
Q psy16206        317 --PTPLSCEN--PSSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTV  392 (821)
Q Consensus       317 --~~~~~c~~--~~~~~~g~~l~~~l~~~~~~G~tG~i~fd~~~g~~~~~~~~i~~~~~~~~~~vG~w~~~~gl~~~~~~  392 (821)
                        ....+|..  ..+|..|..+-.+|+++.++|+||+|.||. .|.|.++..+|++++.++.+++|+|+...|+......
T Consensus       326 rRG~~GD~~an~~~p~~qG~~I~ralk~v~~eGLTGniqFd~-~G~R~Nyt~~i~elk~~~~rk~~~W~e~~~fv~~~t~  404 (897)
T KOG1054|consen  326 RRGNAGDCLANPAVPWEQGIDIERALKQVQVEGLTGNIQFDK-YGRRTNYTIDIVELKSNGSRKVGYWNEGEGFVPGSTV  404 (897)
T ss_pred             ccCCCccccCCCCCchhcchhHHHHHHheeecccccceeecc-cCccccceEEEEEeccCCcceeeeecccCceeecccc
Confidence              45668854  568999999999999999999999999999 9999999999999999999999999999999876554


Q ss_pred             cccchhhhhhccCceEEEEeeccceeeeeecCCCcee-ecC----CCCCce-eeHHHHHHHHHHHcCCeEEEEEecCCcc
Q psy16206        393 EQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMM-KNP----ETGELY-GYSVDLIKMIANELNFTYKFVLERENTY  466 (821)
Q Consensus       393 ~~~~~~~~~~~~~~~l~v~~~~g~~lrVgv~~~P~~~-~~~----~~~~~~-G~~~dll~~ia~~l~~~~~~~~~~~~~~  466 (821)
                      . +...-....++++++|.|.         ...||.+ +.+    .|+.+| |||+||+.+||+..+.+|++..++|++|
T Consensus       405 a-~~~~d~~~~~n~tvvvtti---------L~spyvm~kkn~~~~egn~ryEGyCvdLa~~iAkhi~~~Y~l~iv~dgky  474 (897)
T KOG1054|consen  405 A-QSRNDQASKENRTVVVTTI---------LESPYVMLKKNHEQLEGNERYEGYCVDLAAEIAKHIGIKYKLFIVGDGKY  474 (897)
T ss_pred             c-cccccccccccceEEEEEe---------cCCchhHHHhhHHHhcCCcccceeHHHHHHHHHHhcCceEEEEEecCCcc
Confidence            3 2234445667789999999         7788877 322    344679 9999999999999999999999999999


Q ss_pred             cccCCCCCcchHHHHHHHcCCcceEEeccccchhhhcceeecccceeeceEEEEEcCCCCCCCcccccccCchhHHHHHH
Q psy16206        467 GTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWVYMA  546 (821)
Q Consensus       467 g~~~~~~~~~~~~~~~l~~g~~Di~~~~~~~t~~R~~~~~fS~p~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~vw~~~~  546 (821)
                      |+++++..-|++|+++|..|++|++++++++|.+|++.+|||.|+|..+++|+.++|..+.++.++|++|+..++|+|++
T Consensus       475 GardaD~k~WnGMvGeLv~grAdiavApLTIt~~REeviDFSKPfMslGISIMIKKPqKsk~gVFSFldPLa~eIWm~iv  554 (897)
T KOG1054|consen  475 GARDADTKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV  554 (897)
T ss_pred             cccCCCcccccchhHHHhcCccceEEeeeeeehhhhhhhccccchhhcCeEEEEeCcccCCCCeeeecchhHHHHHHHHH
Confidence            99999555599999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhhhcCCCcceeEeecCCChHHHHHHHHhhhccCCcccccCchhHHHHHHhccCceEEEecccchhhhh
Q psy16206        547 TAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEV  626 (821)
Q Consensus       547 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~g~~da~i~~~~~~~~~~  626 (821)
                      .+++|++.++|++.||+||+                 |..-+.                                     
T Consensus       555 faYiGVSvvlFLVSrFSPYE-----------------wh~Ee~-------------------------------------  580 (897)
T KOG1054|consen  555 FAYIGVSVVLFLVSRFSPYE-----------------WHTEEF-------------------------------------  580 (897)
T ss_pred             HHHhcceEEEEEEeccCchh-----------------eecccc-------------------------------------
Confidence            99999999999999999971                 000000                                     


Q ss_pred             hhcCCceeecceecCCCcccccCCchhhcccccceeEEEEeecCCccccccCCCCCccceecchHHHHHhhcCceEEEEE
Q psy16206        627 EKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYKFVL  706 (821)
Q Consensus       627 ~~~~~~~~~~~~~~~~~~~~a~~k~~l~~~in~al~~l~~~~~g~~~~i~~k~~g~~~g~~~d~~~~~~~~~~~~~~~~~  706 (821)
                                                             +  +|....             .                  
T Consensus       581 ---------------------------------------~--rg~~t~-------------~------------------  588 (897)
T KOG1054|consen  581 ---------------------------------------E--RGRFTP-------------S------------------  588 (897)
T ss_pred             ---------------------------------------c--cCCCCC-------------C------------------
Confidence                                                   0  010000             0                  


Q ss_pred             ccCCcccccCCCCCcchhhHHHHhhccceeeeehhhhhhhhhhcccccccccchhhHHHHHHHHHHHHHHHHHHHhhhhc
Q psy16206        707 ERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFIYTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAAFLTN  786 (821)
Q Consensus       707 ~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~w~~~~~i~~~~yt~~l~~~lt~  786 (821)
                      ...+.++.+   +..|-.+-+.|||+-|                +.||++|+|++.++||||+||++|+|||||+||||+
T Consensus       589 ~~~NeFgif---NsLWFsLgAFMQQG~D----------------I~PRslSGRIvggvWWFFTlIIiSSYTANLAAFLTv  649 (897)
T KOG1054|consen  589 DPPNEFGIF---NSLWFSLGAFMQQGCD----------------ISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV  649 (897)
T ss_pred             CCCccchhh---HHHHHHHHHHHhcCCC----------------CCccccccceeccchhhhhhhhhhhhhhHHHHHHhH
Confidence            000112222   2457777777777776                589999999999999999999999999999999999


Q ss_pred             cCCCCCCCChhhhhhcCceeEEEEecCcccccccC
Q psy16206        787 TRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFKV  821 (821)
Q Consensus       787 ~~~~~~i~s~~dL~~~~~~~~~~~~~~~~~~~~~~  821 (821)
                      +||.+||.|.||||+|++|.||++.++||..||+.
T Consensus       650 ErMvsPIESaEDLAkQteIaYGt~~~GSTkeFFr~  684 (897)
T KOG1054|consen  650 ERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRR  684 (897)
T ss_pred             HhhcCcchhHHHHhhcceeeeeecCCCchHHHHhh
Confidence            99999999999999999999999999999999973



>KOG4440|consensus Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>KOG1055|consensus Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PF10613 Lig_chan-Glu_bd: Ligated ion channel L-glutamate- and glycine-binding site; InterPro: IPR019594 This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ] Back     alignment and domain information
>COG3107 LppC Putative lipoprotein [General function prediction only] Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria Back     alignment and domain information
>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK15408 autoinducer 2-binding protein lsrB; Provisional Back     alignment and domain information
>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT Back     alignment and domain information
>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15395 methyl-galactoside ABC transporter galactose-binding periplasmic protein MglB; Provisional Back     alignment and domain information
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PRK07377 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>PF12683 DUF3798: Protein of unknown function (DUF3798); InterPro: IPR024258 This entry represents functionally uncharacterised proteins that are found in bacteria Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B Back     alignment and domain information
>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
3kg2_A823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 1e-57
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 8e-18
3qlt_A395 Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge H 1e-49
3h6g_A395 Crystal Structure Of The Glur6 Amino Terminal Domai 1e-49
3olz_A398 Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At 2e-49
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 8e-44
1yae_A 312 Structure Of The Kainate Receptor Subunit Glur6 Ago 4e-09
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-41
3g3k_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-41
3g3i_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 5e-09
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 4e-41
2i0b_A 259 Crystal Structure Of The Glur6 Ligand Binding Core 1e-08
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-41
3g3j_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 6e-09
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 7e-41
2i0c_A 259 Crystal Structure Of The Glur6 Ligand Binding Core 4e-09
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-40
3g3h_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-08
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 2e-40
3qxm_A 258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 6e-09
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 3e-40
1s50_A 259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 9e-09
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 3e-40
2xxw_A 261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 1e-08
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 3e-40
3g3g_A 259 Crystal Structure Of The Glur6 Ligand Binding Domai 9e-09
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 3e-40
2xxu_A 261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 9e-09
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 3e-40
2xxr_A 261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 9e-09
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 1e-39
1gr2_A 279 Structure Of A Glutamate Receptor Ligand Binding Co 2e-06
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 4e-39
1txf_A 258 Crystal Structure Of The Glur5 Ligand Binding Core 4e-08
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 4e-39
2f34_A 258 Crystal Structure Of The Glur5 Ligand Binding Core 4e-08
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 5e-39
2wky_A 258 Crystal Structure Of The Ligand-Binding Core Of Glu 4e-08
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 5e-39
1ycj_A 257 Crystal Structure Of The Kainate Receptor Glur5 Lig 4e-08
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 9e-39
4f2o_A 258 Quisqualate Bound To The D655a Mutant Of The Ligand 3e-07
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 1e-38
2zns_A 256 Crystal Structure Of The Ligand-Binding Core Of The 3e-08
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 1e-38
3m3f_A 258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 2e-07
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 1e-38
3dp4_A 278 Crystal Structure Of The Binding Domain Of The Ampa 2e-07
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 2e-38
4f22_A 258 Kainate Bound To The K660a Mutant Of The Ligand Bin 4e-07
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 2e-38
3u92_A 257 Crystal Structure Of The Gluk3 Ligand Binding Domai 8e-08
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 2e-38
3lsw_A 258 Aniracetam Bound To The Ligand Binding Domain Of Gl 2e-07
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 3e-38
2uxa_A 261 Crystal Structure Of The Glur2-Flip Ligand Binding 7e-07
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 3e-38
3s9e_A 258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 9e-08
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 4e-38
1m5d_A 263 X-ray Structure Of The Glur2 Ligand Binding Core (s 8e-07
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 7e-38
3tdj_A 263 Crystal Structure Of The Glua2 Ligand-Binding Domai 8e-07
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 7e-38
1mqh_A 263 Crystal Structure Of The Glur2 Ligand Binding Core 6e-07
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 7e-38
1lbc_A 263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 8e-07
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 7e-38
3ijo_B 258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 7e-07
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-38
3b6w_C 263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-07
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 8e-38
1lb8_A 263 Crystal Structure Of The Non-Desensitizing Glur2 Li 9e-07
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 9e-38
2xx7_A 291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 8e-07
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 9e-38
1mqd_A 261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 8e-07
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 9e-38
1lbb_A 263 Crystal Structure Of The Glur2 Ligand Binding Domai 7e-07
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-38
3pd8_A 261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 8e-07
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 1e-37
3h03_A 258 Crystal Structure Of The Binding Domain Of The Ampa 8e-07
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 1e-37
2xhd_A 263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 6e-07
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-37
1fw0_A 263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-07
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 1e-37
3dp6_A 279 Crystal Structure Of The Binding Domain Of The Ampa 9e-07
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 1e-37
3pd9_A 260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 9e-07
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 1e-37
3rn8_A 280 Crystal Structure Of Iglur2 Ligand Binding Domain A 9e-07
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 1e-37
3rnn_A 292 Crystal Structure Of Iglur2 Ligand Binding Domain W 1e-06
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-37
3o29_A 263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 7e-07
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 1e-37
3r7x_A 263 Crystal Structure Analysis Of A Quinazolinedione Su 8e-07
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 1e-37
3o28_A 263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 7e-07
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 1e-37
3b6t_A 263 Crystal Structure Of The Glur2 Ligand Binding Core 8e-07
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 2e-37
3t9x_B 258 Glutamate Bound To A Double Cysteine Mutant (V484cE 1e-06
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 2e-37
1p1w_A 263 Crystal Structure Of The Glur2 Ligand-Binding Core 1e-06
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 2e-37
3t93_B 258 Glutamate Bound To A Double Cysteine Mutant (A452cS 5e-07
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 2e-37
1p1n_A 263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 1e-06
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 3e-37
2anj_A 263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-06
2i3w_A259 Measurement Of Conformational Changes Accompanying 3e-37
2i3w_A 259 Measurement Of Conformational Changes Accompanying 8e-07
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 4e-37
2gfe_A 262 Crystal Structure Of The Glur2 A476e S673d Ligand B 1e-06
2i3v_A259 Measurement Of Conformational Changes Accompanying 7e-37
2i3v_A 259 Measurement Of Conformational Changes Accompanying 7e-07
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 2e-36
3kei_A 257 Crystal Structure Of The Glua4 Ligand-Binding Domai 5e-07
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 4e-36
3en3_A 257 Crystal Structure Of The Glur4 Ligand-Binding Domai 1e-06
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 4e-36
3fat_A 260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 1e-06
3saj_A384 Crystal Structure Of Glutamate Receptor Glua1 Amino 7e-26
3om0_A393 Crystal Structure Of The Gluk5 (Ka2) Atd Crystallog 3e-23
3o21_A389 High Resolution Structure Of Glua3 N-Terminal Domai 4e-23
4gpa_A389 High Resolution Structure Of The Glua4 N-Terminal D 7e-23
3o2j_A388 Structure Of The Glua2 Ntd-Dimer Interface Mutant, 1e-22
3n6v_A374 Structure Of The Glua2 Ntd-Dimer Interface Mutant, 1e-22
3hsy_A376 High Resolution Structure Of A Dimeric Glur2 N-Term 1e-22
2wjw_A388 Crystal Structure Of The Human Ionotropic Glutamate 2e-22
3h5v_A394 Crystal Structure Of The Glur2-atd Length = 394 2e-22
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 5e-18
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 3e-04
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 2e-17
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 6e-17
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 7e-17
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 2e-15
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 4e-15
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 2e-14
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 7e-12
2pyy_A228 Crystal Structure Of The Glur0 Ligand-Binding Core 6e-06
1ggg_A226 Glutamine Binding Protein Open Ligand-Free Structur 2e-05
4f3p_A249 Crystal Structure Of A Glutamine-Binding Periplasmi 3e-05
4io2_A248 Crystal Structure Of The Avglur1 Ligand Binding Dom 5e-05
2q2c_A272 Crystal Structures Of The Arginine-, Lysine-, Histi 2e-04
3k4u_A245 Crystal Structure Of Putative Binding Component Of 3e-04
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure

Iteration: 1

Score = 221 bits (562), Expect = 1e-57, Method: Compositional matrix adjust. Identities = 161/582 (27%), Positives = 282/582 (48%), Gaps = 65/582 (11%) Query: 1 MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNA 60 ++I G+F ++ +AF + + + + + L P + ++E +S C+ Sbjct: 3 IQIGGLFPRGADQEYSAFRVGMVQFS------TSEFRLTPHIDNLEVANSFAVTNAFCSQ 56 Query: 61 TSEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLI 120 S G+ AIFG ++ N I S C HV +F P+ PT+G H + L Sbjct: 57 FSRGVYAIFGFYDKKSVNTITSFCGTL---HV-SFITPS---FPTDGTHPFVIQMRPDLK 109 Query: 121 SKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTD 180 +S +I WD F +Y++ L LQ VL++A + ++ ++ + + D Sbjct: 110 GALLS-LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQV----TAINVGNINNDKK 164 Query: 181 D--YRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEV--HLMGDYQNYILSLTSYWINA 236 D YR L ++++ E ++LDC DK I+ Q + H+ G +YI++ + Sbjct: 165 DETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKG--YHYIIANLGF---- 218 Query: 237 HTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGW-IYEENERGRSLNVRAETVKIEAAL 295 D Q G A ++ ++++ + + + W EE E T+K +AL Sbjct: 219 TDGDLLKIQFGGAEVSGFQIVDYDDSLVSKFIERWSTLEEKEYP---GAHTATIKYTSAL 275 Query: 296 MYDAVYLFAAALQSLGERK----PLPTPLSC-ENPS-SWQHGLGIGNLMKSITIDGMTGR 349 YDAV + A ++L +++ C NP+ W G+ I +K + ++G++G Sbjct: 276 TYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGN 335 Query: 350 INLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQM--DKEKKEKIENRT 407 I D Q G+R ++++ +E ++ + +G W+ V++M ++ +E +T Sbjct: 336 IKFD-QNGKRINYTINIMELKTNGPRKIGYWSE---------VDKMVLTEDDTSGLEQKT 385 Query: 408 LTVTSKTFAKLRVLFQGEPYMMKNPETGELYG------YSVDLIKMIANELNFTYKFVLE 461 + VT+ PY+M L G Y VDL IA F YK + Sbjct: 386 VVVTT---------ILESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIV 436 Query: 462 RENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYR 521 + YG + T WNG++GEL +AD+AI LTIT R +DF+ PFM+LGISI+ + Sbjct: 437 GDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIK 496 Query: 522 KPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARIS 563 KP K +P +FSFL+PL++++W+ + AY+GVS++LF ++R S Sbjct: 497 KPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFS 538
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure
>pdb|3QLT|A Chain A, Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge Homodimer Assembly Length = 395 Back     alignment and structure
>pdb|3H6G|A Chain A, Crystal Structure Of The Glur6 Amino Terminal Domain Dimer Assembly Length = 395 Back     alignment and structure
>pdb|3OLZ|A Chain A, Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At 2.75 Angstrom Resolution Length = 398 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3SAJ|A Chain A, Crystal Structure Of Glutamate Receptor Glua1 Amino Terminal Domain Length = 384 Back     alignment and structure
>pdb|3OM0|A Chain A, Crystal Structure Of The Gluk5 (Ka2) Atd Crystallographic Dimer At 1.4 Angstrom Resolution Length = 393 Back     alignment and structure
>pdb|3O21|A Chain A, High Resolution Structure Of Glua3 N-Terminal Domain (Ntd) Length = 389 Back     alignment and structure
>pdb|4GPA|A Chain A, High Resolution Structure Of The Glua4 N-Terminal Domain (Ntd) Length = 389 Back     alignment and structure
>pdb|3O2J|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, N54a Length = 388 Back     alignment and structure
>pdb|3N6V|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, T78a Length = 374 Back     alignment and structure
>pdb|3HSY|A Chain A, High Resolution Structure Of A Dimeric Glur2 N-Terminal Domain (Ntd) Length = 376 Back     alignment and structure
>pdb|2WJW|A Chain A, Crystal Structure Of The Human Ionotropic Glutamate Receptor Glur2 Atd Region At 1.8 A Resolution Length = 388 Back     alignment and structure
>pdb|3H5V|A Chain A, Crystal Structure Of The Glur2-atd Length = 394 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2PYY|A Chain A, Crystal Structure Of The Glur0 Ligand-Binding Core From Nostoc Punctiforme In Complex With (L)-Glutamate Length = 228 Back     alignment and structure
>pdb|1GGG|A Chain A, Glutamine Binding Protein Open Ligand-Free Structure Length = 226 Back     alignment and structure
>pdb|4F3P|A Chain A, Crystal Structure Of A Glutamine-Binding Periplasmic Protein From Burkholderia Pseudomallei In Complex With Glutamine Length = 249 Back     alignment and structure
>pdb|4IO2|A Chain A, Crystal Structure Of The Avglur1 Ligand Binding Domain Complex With Glutamate At 1.37 Angstrom Resolution Length = 248 Back     alignment and structure
>pdb|2Q2C|A Chain A, Crystal Structures Of The Arginine-, Lysine-, Histidine-Binding Protein Artj From The Thermophilic Bacterium Geobacillus Stearothermophilus Length = 272 Back     alignment and structure
>pdb|3K4U|A Chain A, Crystal Structure Of Putative Binding Component Of Abc Transporter From Wolinella Succinogenes Dsm 1740 Complexed With Lysine Length = 245 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query821
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 1e-114
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 4e-22
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 6e-20
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 2e-08
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 4e-75
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 3e-72
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 5e-70
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 2e-69
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 2e-68
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-61
3g3k_A 259 Glutamate receptor, ionotropic kainate 2; membrane 3e-14
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 1e-60
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 6e-20
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-57
1mqi_A 263 Glutamate receptor 2; GLUR2, ligand binding core, 4e-18
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 4e-54
2v3u_A 265 Glutamate receptor delta-2 subunit; postsynaptic m 1e-12
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 2e-37
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 3e-09
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 3e-34
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 1e-32
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 1e-26
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 5e-06
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 5e-25
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 5e-07
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 3e-22
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 4e-21
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 7e-18
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 2e-04
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 2e-16
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 6e-04
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 3e-16
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 2e-05
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 4e-16
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 5e-04
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 5e-16
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 4e-04
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 5e-16
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 5e-04
3k4u_A245 Binding component of ABC transporter; structural g 9e-16
3k4u_A245 Binding component of ABC transporter; structural g 6e-04
3kzg_A237 Arginine 3RD transport system periplasmic binding 1e-15
3kzg_A237 Arginine 3RD transport system periplasmic binding 3e-04
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 1e-15
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 1e-04
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 6e-15
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 1e-14
3hv1_A268 Polar amino acid ABC uptake transporter substrate 2e-14
3del_B242 Arginine binding protein; alpha and beta protein ( 2e-14
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 2e-14
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 4e-04
2yln_A283 Putative ABC transporter, periplasmic binding Pro 3e-14
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 3e-14
2q88_A257 EHUB, putative ABC transporter amino acid-binding 6e-14
3qax_A268 Probable ABC transporter arginine-binding protein; 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-14
4eq9_A246 ABC transporter substrate-binding protein-amino A 1e-13
3tql_A227 Arginine-binding protein; transport and binding pr 1e-13
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 2e-13
2o1m_A258 Probable amino-acid ABC transporter extracellular- 2e-13
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 3e-13
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 4e-13
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 3e-12
1xt8_A292 Putative amino-acid transporter periplasmic solut 1e-10
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 4e-10
2vha_A287 Periplasmic binding transport protein; periplasmic 5e-10
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  365 bits (938), Expect = e-114
 Identities = 142/574 (24%), Positives = 259/574 (45%), Gaps = 51/574 (8%)

Query: 2   KIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNAT 61
           +I G+F    ++  +AF + + + +        +  L P + ++E  +S       C+  
Sbjct: 4   QIGGLFPRGADQEYSAFRVGMVQFST------SEFRLTPHIDNLEVANSFAVTNAFCSQF 57

Query: 62  SEGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLIS 121
           S G+ AIFG    ++ N I S C    +  +   +              + + P+   + 
Sbjct: 58  SRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPT-----DGTHPFVIQMRPD---LK 109

Query: 122 KGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDDKEIRPGRPSVTIRQLPPDTDD 181
             +  +I    WD F  +Y++   L  LQ VL++A +   ++     +V         + 
Sbjct: 110 GALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTA--INVGNINNDKKDET 167

Query: 182 YRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDF 241
           YR L ++++   E  ++LDC  DK   I+ Q   +       +YI+      +     D 
Sbjct: 168 YRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYII----ANLGFTDGDL 223

Query: 242 QDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVY 301
              Q G A ++  ++++  +  +   +  W     E          T+K  +AL YDAV 
Sbjct: 224 LKIQFGGAEVSGFQIVDYDDSLVSKFIERW--STLEEKEYPGAHTATIKYTSALTYDAVQ 281

Query: 302 LFAAALQSLGE------RKPLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTGRINLDSQ 355
           +   A ++L +      R+             W  G+ I   +K + ++G++G I  D  
Sbjct: 282 VMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQN 341

Query: 356 TGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHSRTVEQMDKEKKEKIENRTLTVTSKTF 415
            G+R ++++  +E  ++  + +G W+    +        + ++    +E +T+ VT+   
Sbjct: 342 -GKRINYTINIMELKTNGPRKIGYWSEVDKMV-------LTEDDTSGLEQKTVVVTT--- 390

Query: 416 AKLRVLFQGEPYMMKNPETGELY------GYSVDLIKMIANELNFTYKFVLERENTYGTL 469
                     PY+M       L       GY VDL   IA    F YK  +  +  YG  
Sbjct: 391 ------ILESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGAR 444

Query: 470 NPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPD 529
           +  T  WNG++GEL   +AD+AI  LTIT  R   +DF+ PFM+LGISI+ +KP K +P 
Sbjct: 445 DADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPG 504

Query: 530 LFSFLEPLSFDVWVYMATAYLGVSLLLFFLARIS 563
           +FSFL+PL++++W+ +  AY+GVS++LF ++R S
Sbjct: 505 VFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFS 538


>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Length = 283 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>2o1m_A Probable amino-acid ABC transporter extracellular-binding protein YTMK; NESG X-RAY O34852 YTMK_bacsu, structural genomics, PSI-2; 2.00A {Bacillus subtilis} Length = 258 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 100.0
3o21_A389 Glutamate receptor 3; periplasmatic binding protei 100.0
3om0_A393 Glutamate receptor, ionotropic kainate 5; membrane 100.0
3h6g_A395 Glutamate receptor, ionotropic kainate 2; membrane 100.0
4gpa_A389 Glutamate receptor 4; PBP fold, ligand-gated ION c 100.0
3hsy_A376 Glutamate receptor 2; ligand-gated ION channel, sy 100.0
3saj_A384 Glutamate receptor 1; rossman fold, ION channel, m 100.0
3qek_A384 NMDA glutamate receptor subunit; amino terminal do 100.0
4f11_A433 Gamma-aminobutyric acid type B receptor subunit 2; 100.0
1dp4_A435 Atrial natriuretic peptide receptor A; periplasmic 100.0
1jdp_A441 NPR-C, atrial natriuretic peptide clearance recept 100.0
3qel_B364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 100.0
2e4u_A555 Metabotropic glutamate receptor 3; G-protein-coupl 100.0
3sm9_A479 Mglur3, metabotropic glutamate receptor 3; structu 100.0
3i45_A387 Twin-arginine translocation pathway signal protei; 100.0
3mq4_A481 Mglur7, metabotropic glutamate receptor 7; glutama 100.0
4f06_A371 Extracellular ligand-binding receptor; PSI-biology 100.0
3ks9_A496 Mglur1, metabotropic glutamate receptor 1; glutama 100.0
4gnr_A353 ABC transporter substrate-binding protein-branche 100.0
3h5l_A419 Putative branched-chain amino acid ABC transporter 100.0
3n0x_A374 Possible substrate binding protein of ABC transpo 100.0
3td9_A366 Branched chain amino acid ABC transporter, peripl 100.0
3ipc_A356 ABC transporter, substrate binding protein (amino; 100.0
3hut_A358 Putative branched-chain amino acid ABC transporter 100.0
3lkb_A392 Probable branched-chain amino acid ABC transporter 100.0
3i09_A375 Periplasmic branched-chain amino acid-binding Pro; 100.0
4eyg_A368 Twin-arginine translocation pathway signal; PSI-bi 100.0
1usg_A346 Leucine-specific binding protein; leucine-binding 100.0
3eaf_A391 ABC transporter, substrate binding protein; PSI2, 100.0
4evq_A375 Putative ABC transporter subunit, substrate-bindi 100.0
3n0w_A379 ABC branched chain amino acid family transporter, 100.0
3lop_A364 Substrate binding periplasmic protein; protein str 100.0
1pea_A385 Amidase operon; gene regulator, receptor, binding 99.97
3sg0_A386 Extracellular ligand-binding receptor; structural 99.97
3snr_A362 Extracellular ligand-binding receptor; structural 99.97
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.92
2h4a_A325 YRAM (HI1655); perplasmic binding protein, lipopro 99.92
3ckm_A327 YRAM (HI1655), LPOA; periplasmic-binding protein, 99.92
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.92
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.91
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.9
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.9
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.88
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.88
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.87
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.87
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.86
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.86
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.86
3k4u_A245 Binding component of ABC transporter; structural g 99.85
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.84
3del_B242 Arginine binding protein; alpha and beta protein ( 99.84
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.83
3tql_A227 Arginine-binding protein; transport and binding pr 99.83
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.82
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.82
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.81
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.81
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.81
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.81
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.8
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.79
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.79
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.79
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.77
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.77
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.76
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.76
2vha_A287 Periplasmic binding transport protein; periplasmic 99.76
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.75
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.75
3qax_A268 Probable ABC transporter arginine-binding protein; 99.75
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.63
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.71
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.64
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.56
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 98.02
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 97.94
2h3h_A313 Sugar ABC transporter, periplasmic sugar-binding p 97.9
3gbv_A304 Putative LACI-family transcriptional regulator; NY 97.75
1tjy_A316 Sugar transport protein; protein-ligand complex, s 97.74
2qh8_A302 Uncharacterized protein; conserved domain protein, 97.7
3l6u_A293 ABC-type sugar transport system periplasmic compo; 97.65
2iks_A293 DNA-binding transcriptional dual regulator; escher 97.65
3o74_A272 Fructose transport system repressor FRUR; dual tra 97.65
3c3k_A285 Alanine racemase; structural genomics, protein str 97.62
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 97.59
3d02_A303 Putative LACI-type transcriptional regulator; peri 97.59
3g1w_A305 Sugar ABC transporter; sugar-binding protein, baci 97.57
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 97.56
2vk2_A306 YTFQ, ABC transporter periplasmic-binding protein 97.56
3egc_A291 Putative ribose operon repressor; structural genom 97.54
3brs_A289 Periplasmic binding protein/LACI transcriptional; 97.53
2qu7_A288 Putative transcriptional regulator; structural gen 97.52
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 97.51
2x7x_A325 Sensor protein; transferase, sensor histidine kina 97.48
3lkv_A302 Uncharacterized conserved domain protein; ATPase b 97.47
2rjo_A332 Twin-arginine translocation pathway signal protei; 97.46
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 97.43
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 97.41
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 97.4
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 97.4
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 97.38
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 97.37
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 97.36
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 97.35
3h75_A350 Periplasmic sugar-binding domain protein; protein 97.31
3k4h_A292 Putative transcriptional regulator; structural gen 97.27
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 97.27
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 97.24
3m9w_A313 D-xylose-binding periplasmic protein; xylose bindi 97.19
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 97.18
3kke_A303 LACI family transcriptional regulator; structural 97.18
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 97.18
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 97.17
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 97.16
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 97.16
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 97.15
3e61_A277 Putative transcriptional repressor of ribose OPER; 97.1
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 97.07
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 97.05
8abp_A306 L-arabinose-binding protein; binding proteins; HET 97.05
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 97.02
3k9c_A289 Transcriptional regulator, LACI family protein; PS 96.99
3gv0_A288 Transcriptional regulator, LACI family; transcript 96.99
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 96.97
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 96.95
2dri_A271 D-ribose-binding protein; sugar transport; HET: RI 96.93
3bbl_A287 Regulatory protein of LACI family; protein structu 96.91
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 96.91
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 96.91
3gyb_A280 Transcriptional regulators (LACI-family transcript 96.88
3qsl_A346 Putative exported protein; unknown, structural gen 96.88
3qk7_A294 Transcriptional regulators; structural genomics, N 96.83
3miz_A301 Putative transcriptional regulator protein, LACI f 96.73
3bil_A348 Probable LACI-family transcriptional regulator; st 96.72
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 96.72
3e3m_A355 Transcriptional regulator, LACI family; structural 96.7
3uug_A330 Multiple sugar-binding periplasmic receptor CHVE; 96.69
3h5o_A339 Transcriptional regulator GNTR; transcription regu 96.68
3g85_A289 Transcriptional regulator (LACI family); transcrip 96.66
1gud_A288 ALBP, D-allose-binding periplasmic protein; peripl 96.62
1byk_A255 Protein (trehalose operon repressor); LACI family, 96.6
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 96.48
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 96.42
3jvd_A333 Transcriptional regulators; structural genomics, P 96.34
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 96.33
1jye_A349 Lactose operon repressor; gene regulation, protein 96.14
3ix1_A302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 96.11
3g3k_A 259 Glutamate receptor, ionotropic kainate 2; membrane 96.06
2fqx_A318 Membrane lipoprotein TMPC; ABC transport system, l 95.99
3uif_A348 Sulfonate ABC transporter, periplasmic sulfonate- 95.97
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 95.96
4fe7_A412 Xylose operon regulatory protein; HTH_ARAC, helix- 95.9
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 95.5
2f5x_A312 BUGD; periplasmic binding protein, transport prote 95.25
3qi7_A371 Putative transcriptional regulator; periplasmic bi 95.23
4ddd_A327 Immunogenic protein; ssgcid, structural genomics, 95.03
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 94.95
2rc8_A 294 Glutamate [NMDA] receptor subunit 3A; membrane pro 94.87
3h5t_A366 Transcriptional regulator, LACI family; DNA-depend 94.87
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 94.87
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 94.75
1mqi_A 263 Glutamate receptor 2; GLUR2, ligand binding core, 94.14
2hqb_A296 Transcriptional activator of COMK gene; berkeley s 93.85
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 93.62
3mpk_A 267 Virulence sensor protein BVGS; venus flytrap, sens 91.75
4gvo_A 243 LMO2349 protein; structural genomics, IDP05245, L- 91.58
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, s 91.56
2g29_A417 Nitrate transport protein NRTA; solute-binding pro 90.06
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 89.36
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 89.2
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 89.01
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 88.81
2q5c_A196 NTRC family transcriptional regulator; structural 88.22
2q88_A 257 EHUB, putative ABC transporter amino acid-binding 87.35
3kzg_A 237 Arginine 3RD transport system periplasmic binding 87.17
3s99_A356 Basic membrane lipoprotein; ssgcid, structural gen 86.48
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 85.91
4f3p_A 249 Glutamine-binding periplasmic protein; ssgcid, str 85.52
3k4u_A 245 Binding component of ABC transporter; structural g 85.46
4ab5_A222 Transcriptional regulator, LYSR family; transcript 85.35
3hn0_A283 Nitrate transport protein; ABC transporter, struct 85.02
3tql_A 227 Arginine-binding protein; transport and binding pr 84.52
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 84.23
3jv9_A219 OXYR, transcriptional regulator, LYSR family; LYSR 84.01
4dz1_A 259 DALS D-alanine transporter; D-alanine binding, per 83.48
3ho7_A232 OXYR; beta-alpha-barrels, DNA-binding, transcripti 83.14
4eq9_A 246 ABC transporter substrate-binding protein-amino A 82.92
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 82.9
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 82.73
4h5g_A 243 Amino acid ABC superfamily ATP binding cassette tr 82.67
3oxn_A241 Putative transcriptional regulator, LYSR family; s 82.36
3hv1_A 268 Polar amino acid ABC uptake transporter substrate 82.3
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 82.01
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 81.96
1lst_A 239 Lysine, arginine, ornithine-binding protein; amino 81.9
3del_B 242 Arginine binding protein; alpha and beta protein ( 81.09
2i49_A429 Bicarbonate transporter; alpha-beta protein, C-cla 80.74
2iee_A 271 ORF2, probable ABC transporter extracellular-bindi 80.55
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 80.39
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=8.8e-77  Score=721.17  Aligned_cols=631  Identities=30%  Similarity=0.571  Sum_probs=517.9

Q ss_pred             CcEEEEeCCCchHHHHHHHHHHHHHhcCCCCCCCceEEEEEEEEecCCChhHHHHHHHHHhhcCeEEEEcCCCcchHHHH
Q psy16206          1 MKIVGIFGPNEEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNATSEGIAAIFGPQSIENRNII   80 (821)
Q Consensus         1 i~IG~i~~~~~~~~~~a~~lAv~~iN~~~~~ll~~~~l~~~~~D~~~~~~~~a~~~a~~li~~~V~aiiGp~~s~~~~~v   80 (821)
                      ||||+++|++|...+.|+++|+|+||+++      ++|+++++|+.+.++..+++++|++++++|.|||||.+|..+.++
T Consensus         3 ikIG~l~~~tg~~~~~a~~lAveeiN~~~------~~l~~~~~D~~~~~~~~a~~~~~~l~~~~V~aiiG~~~S~~~~a~   76 (823)
T 3kg2_A            3 IQIGGLFPRGADQEYSAFRVGMVQFSTSE------FRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTI   76 (823)
T ss_dssp             EEEEEEEETTCHHHHHHHHHHHHHTCCSS------CEEEEEEEEECTTCHHHHHHHHHHHHHTTCSEEEECCCTTTHHHH
T ss_pred             ceEEEEeCCCChHHHHHHHHHHHHHhcCC------eEEEEEEEEcCCCChHHHHHHHHHHHhcCcEEEEcCCChhHHHHH
Confidence            69999999999999999999999999984      799999999654499999999999999999999999999999999


Q ss_pred             HHHhccCCCceeeeccCCCCCCCCCCCccEEEEecChhhHHHHHHHHHHhCCCCEEEEEEecCCchhHHHHHHHhcCCCC
Q psy16206         81 ESMCQMFDIPHVEAFWDPNKYFIPTNGVHGVNVYPESHLISKGISVIINDMDWDTFTIIYETHDNLVYLQQVLENAHDDD  160 (821)
Q Consensus        81 ~~i~~~~~iP~is~~~~~~~~~~~~~~~~~~r~~p~~~~~~~al~~~~~~~~w~~v~ii~~~~~~~~~~~~~~~~~~~~~  160 (821)
                      +++++.+++|+|+++. +.    ...++|+||+.|+   ++.+++++++++||++|++||+++.+...++.+.++..   
T Consensus        77 ~~i~~~~~iP~is~~~-~~----~~~~~~~~r~~p~---~~~a~~~l~~~~gw~~v~ii~d~~~g~~~~~~~~~~~~---  145 (823)
T 3kg2_A           77 TSFCGTLHVSFITPSF-PT----DGTHPFVIQMRPD---LKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAA---  145 (823)
T ss_dssp             HHHHHHTTCEEEECSC-CC----SSCCSSEEECSCC---CHHHHHHHHHHTTCSEEEEEECGGGCTHHHHHHHHHHH---
T ss_pred             HHHhhcCCCceeeccc-CC----CCCCceEEEeCCC---HHHHHHHHHHHCCCCEEEEEEeCChhHHHHHHHHHHhh---
Confidence            9999999999999732 32    2467899999999   88999999999999999999965556666666666665   


Q ss_pred             CcCCCCCCeEEEEE-cCCC----CCChHHHHHHhhcCCCcEEEEeCChhHHHHHHHHHHHccccCcceEEEEeccccccc
Q psy16206        161 KEIRPGRPSVTIRQ-LPPD----TDDYRPLLKEIKNSSESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWIN  235 (821)
Q Consensus       161 ~~~~~~g~~v~~~~-~~~~----~~d~~~~l~~lk~~~~~~ivl~~~~~~~~~~l~~a~~~g~~~~~~~~i~~~~~~~~~  235 (821)
                          ..|.+|.... ++.+    ..|+++++++|+++++++|++.+...++..+++||+++||.+++|+|++++    .+
T Consensus       146 ----~~g~~v~~~~~~~~~~~~~~~d~~~~l~~i~~~~~~vii~~~~~~~~~~~~~~a~~~g~~~~~~~~i~~~----~~  217 (823)
T 3kg2_A          146 ----EKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIAN----LG  217 (823)
T ss_dssp             ----HTTCEEEEEECSSCCSSSTTTTTTTHHHHTTTTTCCEEEEECCHHHHHHHHHHHHHHTTTBTTCEEEECS----SB
T ss_pred             ----ccCCceEEEEeecCCCCccchhHHHHHHHHHhcCCeEEEEECCHHHHHHHHHHHHHcCcCCCCeEEEEec----cc
Confidence                5578887653 5554    789999999999999999999999999999999999999999999999988    33


Q ss_pred             ccccCcccccCCceeeEEEEeecCCChhHHHhhhhhhhhhhcccccccccccccchhHHHHHHHHHHHHHHHHHhhccCC
Q psy16206        236 AHTVDFQDFQPGYANITTVRMINPTNPHIRSIMNGWIYEENERGRSLNVRAETVKIEAALMYDAVYLFAAALQSLGERKP  315 (821)
Q Consensus       236 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~a~~~YDAv~~~a~Al~~~~~~~~  315 (821)
                      ....+.........+++++..+.++++.+++|.++|+++++.+.  +......++.+++++||||+++|+|+++++.+..
T Consensus       218 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~~~~~~~--~~~~~~~~~~~a~~~YDAv~~la~Al~~~~~~~~  295 (823)
T 3kg2_A          218 FTDGDLLKIQFGGAEVSGFQIVDYDDSLVSKFIERWSTLEEKEY--PGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRI  295 (823)
T ss_dssp             SSSSCCSSSSSSBCEEEEEESSCTTSHHHHHHHHHHTTSCTTTS--TTCCSSCCCHHHHHHHHHHHHHHHHHHHHHTTTC
T ss_pred             ccccchHHhhcCCCCceEeeeecCCchHHHHHHHHHHhhccccc--CCCCccccchhhHHHHHHHHHHHHHHHHHHhhcc
Confidence            34444444545567789998888889999999999999886552  2223345788899999999999999999975422


Q ss_pred             C----CCCCCCCCC--CCCCCchhHHHhhhhceeccceeeEEEeCCCCccceeEEEEEEEeecceEEEEEEecCCCccee
Q psy16206        316 L----PTPLSCENP--SSWQHGLGIGNLMKSITIDGMTGRINLDSQTGRRNSFSLEFVEYVSDQWKVLGTWNTAFGLNHS  389 (821)
Q Consensus       316 ~----~~~~~c~~~--~~~~~g~~l~~~l~~~~~~G~tG~i~fd~~~g~~~~~~~~i~~~~~~~~~~vG~w~~~~gl~~~  389 (821)
                      -    ..++.|...  ..|.+|.+++++|++++|+|++|+++||+ +|++....|+|+++.+++++.||.|++..|+...
T Consensus       296 ~~~~~~~~~~c~~~~~~~~~~g~~l~~~l~~~~f~G~tG~i~fd~-~G~~~~~~~~I~~~~~~g~~~vg~w~~~~g~~~~  374 (823)
T 3kg2_A          296 EISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQ-NGKRINYTINIMELKTNGPRKIGYWSEVDKMVLT  374 (823)
T ss_dssp             CCCCSSCCCCTTCSSCCCCTHHHHHHHHHTTCCCEETTEECCBCS-SSCBCSCEEEEEEECSSCEEEEEEEETTTEEEEC
T ss_pred             ccccCCCCCCccCCCCCcccchHHHHHHHHhcccCCcccCeEECC-CCcccccEEEEEEEcCCCCeeEEEEcCCCCceec
Confidence            1    456788764  56889999999999999999999999999 9999999999999999999999999999998865


Q ss_pred             ccccccchhhhhhccCceEEEEeeccceeeeeecCCCceeecC-----CCCCce-eeHHHHHHHHHHHcCCeEEEEEecC
Q psy16206        390 RTVEQMDKEKKEKIENRTLTVTSKTFAKLRVLFQGEPYMMKNP-----ETGELY-GYSVDLIKMIANELNFTYKFVLERE  463 (821)
Q Consensus       390 ~~~~~~~~~~~~~~~~~~l~v~~~~g~~lrVgv~~~P~~~~~~-----~~~~~~-G~~~dll~~ia~~l~~~~~~~~~~~  463 (821)
                      .+.       ...+++++|+|+|.         .+|||.+...     ++++++ ||++|+++++++++|++++++.+++
T Consensus       375 ~~~-------~~~~~~~~l~v~~~---------~~~P~~~~~~~~~~~~~~~~~~G~~~dl~~~~a~~l~~~~~~~~~~~  438 (823)
T 3kg2_A          375 EDD-------TSGLEQKTVVVTTI---------LESPYVMMKANHAALAGNERYEGYCVDLAAEIAKHCGFKYKLTIVGD  438 (823)
T ss_dssp             CCC-------CSSCCCCCEEEEEC---------CCTTTSEECTTGGGCCGGGGEESHHHHHHHHHHHHHTCCEEEEECSS
T ss_pred             cCc-------ccccCCCEEEEEEe---------cCCCcEEEecCccccCCCCceEEEHHHHHHHHHHHcCCcEEEEEccC
Confidence            422       12356788999888         8999998532     233588 9999999999999999999999999


Q ss_pred             CcccccCCCCCcchHHHHHHHcCCcceEEeccccchhhhcceeecccceeeceEEEEEcCCCCCCCcccccccCchhHHH
Q psy16206        464 NTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISILYRKPAKKQPDLFSFLEPLSFDVWV  543 (821)
Q Consensus       464 ~~~g~~~~~~~~~~~~~~~l~~g~~Di~~~~~~~t~~R~~~~~fS~p~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~vw~  543 (821)
                      ++||..++++++|++++++|.+|++|++++++++|++|.+.++||.||+..+.+++++++.....+++.+++||+..+|+
T Consensus       439 ~~~g~~~~~~g~~~~~~~~l~~~~~D~~~~~~~~t~~R~~~~dfs~py~~~~~~~~v~~~~~~~~~~~~fl~Pf~~~vW~  518 (823)
T 3kg2_A          439 GKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM  518 (823)
T ss_dssp             CCCCCBCTTTCCBCHHHHHHHTTSCSEECSCCBCCHHHHTTEEECSCSEEECEEEEEECCCCCCCCGGGTTTTSCHHHHH
T ss_pred             CcccccCCCCCchhhHHHhhccccCcEEecceecchhheeeEEeccchhhCCEEEEEECCCcccccchHhhcCCchhHHH
Confidence            99999998899999999999999999999999999999999999999999999999999876667889999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhhcCCCcceeEeecCCChHHHHHHHHhhhccCCcccccCchhHHHHHHhccCceEEEecccchh
Q psy16206        544 YMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVSLYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIE  623 (821)
Q Consensus       544 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~g~~da~i~~~~~~~  623 (821)
                      +++++++++++++|++++++|++                 |.....                                  
T Consensus       519 ~i~~~~~~~~~~l~~~~~~~p~~-----------------w~~~~~----------------------------------  547 (823)
T 3kg2_A          519 CIVFAYIGVSVVLFLVSRFSPYE-----------------WHTEEF----------------------------------  547 (823)
T ss_dssp             HHHHHHHHHHTTGGGTC---------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHhcChhh-----------------ccCccc----------------------------------
Confidence            99999999999999999887630                 000000                                  


Q ss_pred             hhhhhcCCceeecceecCCCcccccCCchhhcccccceeEEEEeecCCccccccCCCCCccceecchHHHHHhhcCceEE
Q psy16206        624 YEVEKNCDLMQVGGLLDSKGYGIAMPTSKFLAKFSFGFAKLRVLFQGEPYMMKNPETGELYGYSVDLIKMIANELNFTYK  703 (821)
Q Consensus       624 ~~~~~~~~~~~~~~~~~~~~~~~a~~k~~l~~~in~al~~l~~~~~g~~~~i~~k~~g~~~g~~~d~~~~~~~~~~~~~~  703 (821)
                                                                   .+...    +..                       
T Consensus       548 ---------------------------------------------~~~~~----~~~-----------------------  555 (823)
T 3kg2_A          548 ---------------------------------------------EDGRE----TQS-----------------------  555 (823)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ---------------------------------------------ccccc----ccc-----------------------
Confidence                                                         00000    000                       


Q ss_pred             EEEccCCcccccCCCCCcchhhHHHHhhccceeeeehhhhhhhhh-hcccccccccchhhHHHHHHHHHHHHHHHHHHHh
Q psy16206        704 FVLERENTYGTLNPQTGKWNGLIGELQEQVDTFILFFIYSILFFI-YTFVNEAVSTRLVAGMWWFFTLIMISSYTANLAA  782 (821)
Q Consensus       704 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~r~~~~~w~~~~~i~~~~yt~~l~~  782 (821)
                                  .+....+ ++.         ..+|+.+++++.. ....|++.++|++.++|||++||++++|||+|+|
T Consensus       556 ------------~~~~~~~-~~~---------~~~~~~~~~l~~~g~~~~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s  613 (823)
T 3kg2_A          556 ------------SESTNEF-GIF---------NSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAA  613 (823)
T ss_dssp             ---------------CHHH-HHH---------HHHHHTTTTSCC------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ------------ccccccc-cHH---------HHHHHHHHHHHhcCCCcCCcchhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence                        0000000 000         0011222222211 1357999999999999999999999999999999


Q ss_pred             hhhccCCCCCCCChhhhhhcCceeEEEEecCccccccc
Q psy16206        783 FLTNTRMNPPIKNVEDLAKAGRIKYGCVEMGSTRNFFK  820 (821)
Q Consensus       783 ~lt~~~~~~~i~s~~dL~~~~~~~~~~~~~~~~~~~~~  820 (821)
                      +||++++.++|+|++||++|+++++|++.++++..||+
T Consensus       614 ~Lt~~~~~~~I~s~~dL~~~~~i~~~~~~~~~~~~~~~  651 (823)
T 3kg2_A          614 FLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFR  651 (823)
T ss_dssp             HHHHHHHCCCCCSSHHHHHCCSSEEECBSSSHHHHHHH
T ss_pred             HhcccccCCCCCCHHHHhhCCCeeEEEEeCCcHHHHHH
Confidence            99999999999999999999999999999999988875



>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3lkv_A Uncharacterized conserved domain protein; ATPase binding cassette, PSI, MCSG, structural genomics, Pro structure initiative; HET: PHE; 2.20A {Vibrio cholerae} Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>8abp_A L-arabinose-binding protein; binding proteins; HET: GLA GAL; 1.49A {Escherichia coli} SCOP: c.93.1.1 PDB: 7abp_A* 6abp_A* 1abe_A* 1abf_A* 5abp_A* 1bap_A* 1apb_A* 9abp_A* 2wrz_A Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>2dri_A D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} SCOP: c.93.1.1 PDB: 1urp_A* 1ba2_A 1dbp_A* 1drj_A* 1drk_A* 2gx6_A* Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3miz_A Putative transcriptional regulator protein, LACI family; LACL family, protein structure initiative II (PSI II), NYSGXRC, structural genomics; 1.91A {Rhizobium etli} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3uug_A Multiple sugar-binding periplasmic receptor CHVE; periplasmic binding protein, sugar-binding protein, sugar binding protein; HET: BDP; 1.75A {Agrobacterium tumefaciens} PDB: 3urm_A* Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1gud_A ALBP, D-allose-binding periplasmic protein; periplasmic binding protein, X-RAY crystallography, hinge bending, conformational change; 1.7A {Escherichia coli} SCOP: c.93.1.1 PDB: 1gub_A 1rpj_A* Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>3qi7_A Putative transcriptional regulator; periplasmic binding protein-like, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.86A {Clostridium difficile} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>2hqb_A Transcriptional activator of COMK gene; berkeley structure genomics center target 1957B, structural genomics, PSI; 2.70A {Bacillus halodurans} Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3s99_A Basic membrane lipoprotein; ssgcid, structural genomics, SEA structural genomics center for infectious disease, adenine; HET: ADE; 2.05A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>4ab5_A Transcriptional regulator, LYSR family; transcription factors; 2.51A {Neisseria meningitidis serogroup B} PDB: 4ab6_A Back     alignment and structure
>3hn0_A Nitrate transport protein; ABC transporter, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; 1.75A {Parabacteroides distasonis} Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3jv9_A OXYR, transcriptional regulator, LYSR family; LYSR-type transcriptional regulator, LTTR, redox, structural genomics, OPPF; 2.39A {Neisseria meningitidis} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3ho7_A OXYR; beta-alpha-barrels, DNA-binding, transcription, transcriptio regulation; 1.58A {Porphyromonas gingivalis} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3oxn_A Putative transcriptional regulator, LYSR family; structural genomics, PSI-2, protein structure initiative; 2.70A {Vibrio parahaemolyticus} Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>2i49_A Bicarbonate transporter; alpha-beta protein, C-clamp, ABC transporter, periplasmic SO binding protein, bicarbonate-binding protein; 1.35A {Synechocystis SP} PDB: 2i48_A 2i4b_A 2i4c_A Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 821
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 1e-31
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 5e-08
d1jdpa_401 c.93.1.1 (A:) Hormone binding domain of the atrial 1e-25
d1dp4a_425 c.93.1.1 (A:) Hormone binding domain of the atrial 9e-24
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 9e-23
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 2e-05
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 4e-18
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 3e-04
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 7e-17
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 4e-05
d1ewka_477 c.93.1.1 (A:) Metabotropic glutamate receptor subt 3e-08
d1wdna_223 c.94.1.1 (A:) Glutamine-binding protein {Escherich 3e-07
d1qo0a_373 c.93.1.1 (A:) Amide receptor/negative regulator of 9e-05
d1usga_346 c.93.1.1 (A:) Leucine-binding protein {Escherichia 2e-04
d1lsta_238 c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding 4e-04
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 6e-04
d1ii5a_226 c.94.1.1 (A:) Glutamate receptor ligand binding co 6e-04
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Glutamate receptor ligand binding core
species: Rat (Rattus norvegicus), GluR2 [TaxId: 10116]
 Score =  122 bits (305), Expect = 1e-31
 Identities = 91/269 (33%), Positives = 127/269 (47%), Gaps = 37/269 (13%)

Query: 405 NRTLTVTSKTFAKLRVLFQGEPYMMKNP------ETGELYGYSVDLIKMIANELNFTYKF 458
           N+T+ VT+   +         PY+M               GY VDL   IA    F YK 
Sbjct: 1   NKTVVVTTILES---------PYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKL 51

Query: 459 VLERENTYGTLNPQTGKWNGLIGELQEQRADLAICDLTITSERRAAVDFTMPFMTLGISI 518
            +  +  YG  +  T  WNG++GEL   +AD+AI  LTIT  R   +DF+ PFM+LGISI
Sbjct: 52  TIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISI 111

Query: 519 LYRKPAKKQPDLFSFLEPLSFDVWVYMATAYLGVSLLLFFLARISSGSRLRYSAKNSNVS 578
           + +K    +            +          G                 +   + S ++
Sbjct: 112 MIKKGTPIES----------AEDLSKQTEIAYGT----------LDSGSTKEFFRRSKIA 151

Query: 579 LYQRMHSAMESSRPSVFVKSNKEGVERVVKEKGKYAFFMESTGIEYEVEKN-CDLMQVGG 637
           ++ +M + M S+ PSVFV++  EGV RV K KGKYA+ +EST  EY  ++  CD M+VGG
Sbjct: 152 VFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGG 211

Query: 638 LLDSKGYGIAMPT-SKFLAKFSFGFAKLR 665
            LDSKGYGIA P  S      +    KL 
Sbjct: 212 NLDSKGYGIATPKGSSLGNAVNLAVLKLN 240


>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 401 Back     information, alignment and structure
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 425 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 477 Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Length = 223 Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Length = 373 Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Length = 238 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Length = 226 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query821
d1ewka_477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 100.0
d1dp4a_425 Hormone binding domain of the atrial natriuretic p 100.0
d1jdpa_401 Hormone binding domain of the atrial natriuretic p 100.0
d1usga_346 Leucine-binding protein {Escherichia coli [TaxId: 100.0
d1qo0a_373 Amide receptor/negative regulator of the amidase o 100.0
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.93
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.92
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.91
d3ckma1317 YraM C-terminal domain {Haemophilus influenzae [Ta 99.9
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.87
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.87
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.86
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.86
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.83
d2fvya1305 Galactose/glucose-binding protein {Escherichia col 97.67
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 97.47
d8abpa_305 L-arabinose-binding protein {Escherichia coli [Tax 97.45
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 97.38
d2dria_271 D-ribose-binding protein {Escherichia coli, strain 97.09
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 97.0
d2nzug1275 Glucose-resistance amylase regulator CcpA, C-termi 96.85
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 96.48
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 96.44
d1tjya_316 AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370 96.19
d1guda_288 D-allose-binding protein {Escherichia coli [TaxId: 96.12
d1mqia_ 260 Glutamate receptor ligand binding core {Rat (Rattu 94.18
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 93.35
d2esna2212 Probable LysR-type transcriptional regulator PA047 88.36
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 85.94
d1xs5a_240 Putative lipoprotein (NlpA family) {Treponema pall 84.65
d2pjua1186 Propionate catabolism operon regulatory protein Pr 84.05
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 81.13
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=5.9e-40  Score=368.75  Aligned_cols=373  Identities=15%  Similarity=0.181  Sum_probs=277.8

Q ss_pred             CcEEEEeCCC--------------------chHHHHHHHHHHHHHhcCCCCCCCceEEEEEEEEecCCChhHHHHHHHHH
Q psy16206          1 MKIVGIFGPN--------------------EEEVATAFEIAVRRINKDFKALPPDIILEPIVQHVENYDSLHTAKLMCNA   60 (821)
Q Consensus         1 i~IG~i~~~~--------------------~~~~~~a~~lAv~~iN~~~~~ll~~~~l~~~~~D~~~~~~~~a~~~a~~l   60 (821)
                      |.||++||.-                    |-+...|+.+|||+||+++. ||||++|.+.++| .|+++..|++.+.++
T Consensus        10 ~~iGGlFp~h~~~~~~~~~~~~c~~~~~~~g~~~~~Am~~Aie~IN~~~~-lLPn~tLg~~i~D-tc~~~~~a~~~~~~~   87 (477)
T d1ewka_          10 VIIGALFSVHHQPPAEKVPERKCGEIREQYGIQRVEAMFHTLDKINADPV-LLPNITLGSEIRD-SCWHSSVALEQSIEF   87 (477)
T ss_dssp             EEEEEEECSBCCCCTTTGGGTCCCCBCTTTTHHHHHHHHHHHHHHHHCSS-SSTTCCEEEEEEE-CTTCHHHHHHHHHHH
T ss_pred             EEEEEEEECcCcCCCCCCCccccccccccccHHHHHHHHHHHHHHhCCCC-cCCCCEEEEEEEE-cCCChHHHHHHHHHH
Confidence            4699999861                    12355799999999999998 9999999999999 789999999999998


Q ss_pred             hh-----------------------------cCeEEEEcCCCcchHHHHHHHhccCCCceeeeccCCCCCCCCCCCccEE
Q psy16206         61 TS-----------------------------EGIAAIFGPQSIENRNIIESMCQMFDIPHVEAFWDPNKYFIPTNGVHGV  111 (821)
Q Consensus        61 i~-----------------------------~~V~aiiGp~~s~~~~~v~~i~~~~~iP~is~~~~~~~~~~~~~~~~~~  111 (821)
                      +.                             ..|.|||||.||..+.++++++..+++|+|+++++.+.++++..+|+++
T Consensus        88 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~aviGp~~s~~s~~va~~~~~~~iP~IS~~ats~~lsd~~~yp~f~  167 (477)
T d1ewka_          88 IRDSLISIRDEKDGLNRCLPDGQTLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFL  167 (477)
T ss_dssp             HC-----------------------------CCEEEEECCSSHHHHHHHHHHHGGGTCCEEESSCCCGGGGCTTTCTTEE
T ss_pred             HHhhhcccccccccccccccCCccccccccccceEEEECCCcchhHHHHHHHhhhccCceeccccCCccccccccCCceE
Confidence            73                             2689999999999999999999999999999988866668888999999


Q ss_pred             EEecChhhHHHHHHHHHHhCCCCEEEEEEecCCchh-HHHHHHHhcCCCCCcCCCCCCeEEEE-EcCC--CCCChHHHHH
Q psy16206        112 NVYPESHLISKGISVIINDMDWDTFTIIYETHDNLV-YLQQVLENAHDDDKEIRPGRPSVTIR-QLPP--DTDDYRPLLK  187 (821)
Q Consensus       112 r~~p~~~~~~~al~~~~~~~~w~~v~ii~~~~~~~~-~~~~~~~~~~~~~~~~~~~g~~v~~~-~~~~--~~~d~~~~l~  187 (821)
                      |+.|++..+++|+++++++|||++|++|++++++.. .++.+.+.+.       ..|+++... .++.  ...++...++
T Consensus       168 Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~~d~~g~~~~~~l~~~~~-------~~~i~v~~~~~i~~~~~~~~~~~~l~  240 (477)
T d1ewka_         168 RVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKELAA-------QEGLCIAHSDKIYSNAGEKSFDRLLR  240 (477)
T ss_dssp             ESSCCHHHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHHHH-------HHTCEEEEEEEECTTCCHHHHHHHHH
T ss_pred             EecccchhhHHHHHHHHHHcCCcEEEEEEecchhHHHHHHHHHHHHH-------HcCcEEEEEeeccCCCchhhHHHHHH
Confidence            999999999999999999999999999999987433 3333433343       446788644 4443  3557889999


Q ss_pred             HhhcC--CCcEEEEeCChhHHHHHHHHHHHccccCcceEEEEecccccccccccCcccccCCceeeEEEEeecCCChhHH
Q psy16206        188 EIKNS--SESHILLDCSMDKTVTILKQAKEVHLMGDYQNYILSLTSYWINAHTVDFQDFQPGYANITTVRMINPTNPHIR  265 (821)
Q Consensus       188 ~lk~~--~~~~ivl~~~~~~~~~~l~~a~~~g~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  265 (821)
                      +++++  .+++||+.+....+..++++|.++||+++ +.|+++++   +...............+..++.......+.++
T Consensus       241 ~l~~~~~~~rVIv~~~~~~~~~~ll~~a~~~g~~g~-~~~i~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~f~  316 (477)
T d1ewka_         241 KLRERLPKARVVVCFCEGMTVRGLLSAMRRLGVVGE-FSLIGSDG---WADRDEVIEGYEVEANGGITIKLQSPEVRSFD  316 (477)
T ss_dssp             HHHTTTTTCCEEEEECCHHHHHHHHHHHHHHTCCSC-CEEEECTT---TTTCHHHHTTCHHHHTTCEEEEECCCCCHHHH
T ss_pred             HHhhhccCceEEEEecCHHHHHHHHHHHHHcCccCC-ceEEEecc---cccchhhccccccccCcceEeeeccccchhHH
Confidence            99876  78999999999999999999999999975 55777663   22111111111112245556666666666555


Q ss_pred             Hhhhh---------------hhhhhhccccc-----c-----cc------cccccchhHHHHHHHHHHHHHHHHHhhccC
Q psy16206        266 SIMNG---------------WIYEENERGRS-----L-----NV------RAETVKIEAALMYDAVYLFAAALQSLGERK  314 (821)
Q Consensus       266 ~f~~~---------------~~~~~~~~~~~-----~-----~~------~~~~~~~~a~~~YDAv~~~a~Al~~~~~~~  314 (821)
                      +|...               |++.+.-..+.     .     ..      .......+++++||||+++|+||+++.+..
T Consensus       317 ~~~~~~~~~~~~~n~~~~~~w~~~f~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~yDAV~a~A~AL~~~~~~~  396 (477)
T d1ewka_         317 DYFLKLRLDTNTRNPWFPEFWQHRFQCRLPGHLLENPNFKKVCTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHAL  396 (477)
T ss_dssp             HHHTTCCTTTCCSCTTHHHHHHHHTTCBCTTCTTCCTTCCSBCCSCCCTTTTCCCCTTHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhcCcccCCCChHHHHHHHHHhCCCcccccccCccccccccchhhcccccccchHHHHHHHHHHHHHHHHHHHHHhh
Confidence            55433               22222110000     0     00      001224577899999999999999986532


Q ss_pred             CCCCCCCCCCCCCCCCchhHHHhhhhceecccee-eEEEeCCCCccceeEEEEEEEeec-----ceEEEEEEecCCCcce
Q psy16206        315 PLPTPLSCENPSSWQHGLGIGNLMKSITIDGMTG-RINLDSQTGRRNSFSLEFVEYVSD-----QWKVLGTWNTAFGLNH  388 (821)
Q Consensus       315 ~~~~~~~c~~~~~~~~g~~l~~~l~~~~~~G~tG-~i~fd~~~g~~~~~~~~i~~~~~~-----~~~~vG~w~~~~gl~~  388 (821)
                      .-.....|.... +.+|..+++.|++++|+|++| .|.||+ +|++. ..|+|++++..     ++++||.|++ .+|++
T Consensus       397 ~~~~~~~~~~~~-~~~~~~l~~~l~~v~F~G~tG~~v~Fd~-nGd~~-~~y~I~n~q~~~~~~~~~~~VG~w~~-~~l~i  472 (477)
T d1ewka_         397 CPGHVGLCDAMK-PIDGRKLLDFLIKSSFVGVSGEEVWFDE-KGDAP-GRYDIMNLQYTEANRYDYVHVGTWHE-GVLNI  472 (477)
T ss_dssp             STTCSSCCGGGS-SCCHHHHHHHHHTCEEECTTSCEEECCT-TSCCC-CCEEEEEEEECSSSCEEEEEEEEEET-TEEEE
T ss_pred             CCCCCCcccCCC-cCCHHHHHHHHhcCeeECCCCCEEEECC-CCCcc-ceEEEEEEEECCCCcEEEEEEEEEeC-CCccc
Confidence            112233444333 456899999999999999999 599999 99986 77999988732     3799999996 45666


Q ss_pred             ec
Q psy16206        389 SR  390 (821)
Q Consensus       389 ~~  390 (821)
                      ++
T Consensus       473 ~~  474 (477)
T d1ewka_         473 DD  474 (477)
T ss_dssp             CT
T ss_pred             cc
Confidence            54



>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fvya1 c.93.1.1 (A:2-306) Galactose/glucose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d8abpa_ c.93.1.1 (A:) L-arabinose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2dria_ c.93.1.1 (A:) D-ribose-binding protein {Escherichia coli, strain k-12 [TaxId: 562]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2nzug1 c.93.1.1 (G:58-332) Glucose-resistance amylase regulator CcpA, C-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1tjya_ c.93.1.1 (A:) AI-2 receptor LsrB {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d2pjua1 c.92.3.1 (A:11-196) Propionate catabolism operon regulatory protein PrpR {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure