Psyllid ID: psy16238
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 242006896 | 750 | tkr, putative [Pediculus humanus corpori | 0.292 | 0.048 | 0.805 | 1e-09 | |
| 270012342 | 567 | hypothetical protein TcasGA2_TC006481 [T | 0.292 | 0.063 | 0.75 | 7e-09 | |
| 242012006 | 262 | B-cell CLL/lymphoma 6 member B protein, | 0.528 | 0.248 | 0.530 | 9e-09 | |
| 91088849 | 643 | PREDICTED: similar to Tyrosine kinase-re | 0.235 | 0.045 | 0.75 | 9e-09 | |
| 194886981 | 1044 | GG19859 [Drosophila erecta] gi|190659910 | 0.276 | 0.032 | 0.764 | 5e-08 | |
| 195489912 | 1044 | GE11385 [Drosophila yakuba] gi|194179040 | 0.276 | 0.032 | 0.764 | 6e-08 | |
| 195430050 | 1149 | GK21725 [Drosophila willistoni] gi|19415 | 0.260 | 0.027 | 0.781 | 6e-08 | |
| 198458752 | 1092 | GA14141 [Drosophila pseudoobscura pseudo | 0.260 | 0.029 | 0.781 | 6e-08 | |
| 194756350 | 1099 | GF11509 [Drosophila ananassae] gi|190621 | 0.260 | 0.029 | 0.781 | 6e-08 | |
| 195380423 | 1155 | GJ21336 [Drosophila virilis] gi|19414376 | 0.260 | 0.027 | 0.781 | 6e-08 |
| >gi|242006896|ref|XP_002424278.1| tkr, putative [Pediculus humanus corporis] gi|212507678|gb|EEB11540.1| tkr, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 67.0 bits (162), Expect = 1e-09, Method: Compositional matrix adjust.
Identities = 29/36 (80%), Positives = 34/36 (94%)
Query: 1 MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLA 36
MSS HYSLRWNNHQ+++LNAFD+LLQ+ETLVDVTL
Sbjct: 1 MSSQHYSLRWNNHQNYILNAFDTLLQSETLVDVTLV 36
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270012342|gb|EFA08790.1| hypothetical protein TcasGA2_TC006481 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242012006|ref|XP_002426734.1| B-cell CLL/lymphoma 6 member B protein, putative [Pediculus humanus corporis] gi|212510905|gb|EEB13996.1| B-cell CLL/lymphoma 6 member B protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91088849|ref|XP_971045.1| PREDICTED: similar to Tyrosine kinase-related protein CG16778-PB [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|194886981|ref|XP_001976723.1| GG19859 [Drosophila erecta] gi|190659910|gb|EDV57123.1| GG19859 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195489912|ref|XP_002092939.1| GE11385 [Drosophila yakuba] gi|194179040|gb|EDW92651.1| GE11385 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195430050|ref|XP_002063070.1| GK21725 [Drosophila willistoni] gi|194159155|gb|EDW74056.1| GK21725 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|198458752|ref|XP_001361151.2| GA14141 [Drosophila pseudoobscura pseudoobscura] gi|198136451|gb|EAL25728.2| GA14141 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|194756350|ref|XP_001960442.1| GF11509 [Drosophila ananassae] gi|190621740|gb|EDV37264.1| GF11509 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195380423|ref|XP_002048970.1| GJ21336 [Drosophila virilis] gi|194143767|gb|EDW60163.1| GJ21336 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| FB|FBgn0003715 | 1046 | CG16778 [Drosophila melanogast | 0.276 | 0.032 | 0.722 | 3e-13 | |
| FB|FBgn0264981 | 1089 | mamo "maternal gene required f | 0.536 | 0.060 | 0.462 | 4.7e-09 | |
| FB|FBgn0000210 | 880 | br "broad" [Drosophila melanog | 0.260 | 0.036 | 0.562 | 6.3e-09 | |
| FB|FBgn0263108 | 798 | BtbVII "BTB-protein-VII" [Dros | 0.333 | 0.051 | 0.536 | 1.4e-08 | |
| FB|FBgn0004870 | 977 | bab1 "bric a brac 1" [Drosophi | 0.284 | 0.035 | 0.628 | 1.3e-07 | |
| FB|FBgn0264442 | 904 | ab "abrupt" [Drosophila melano | 0.292 | 0.039 | 0.5 | 1.9e-07 | |
| FB|FBgn0003870 | 813 | ttk "tramtrack" [Drosophila me | 0.512 | 0.077 | 0.449 | 1.7e-06 | |
| FB|FBgn0005630 | 970 | lola "longitudinals lacking" [ | 0.252 | 0.031 | 0.709 | 2.7e-06 | |
| FB|FBgn0004652 | 955 | fru "fruitless" [Drosophila me | 0.252 | 0.032 | 0.580 | 2.9e-06 | |
| FB|FBgn0025525 | 1067 | bab2 "bric a brac 2" [Drosophi | 0.463 | 0.053 | 0.444 | 2.7e-05 |
| FB|FBgn0003715 CG16778 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 139 (54.0 bits), Expect = 3.0e-13, Sum P(2) = 3.0e-13
Identities = 26/36 (72%), Positives = 32/36 (88%)
Query: 2 SSP--HYSLRWNNHQSHLLNAFDSLLQNETLVDVTL 35
S+P HYSLRWNNHQ+H+L AFD+LL+ +TLVDVTL
Sbjct: 109 SAPQDHYSLRWNNHQNHILRAFDALLKTKTLVDVTL 144
|
|
| FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| PHA02713 | 557 | hypothetical protein; Provisional | 99.53 | |
| KOG4441|consensus | 571 | 99.53 | ||
| PHA02790 | 480 | Kelch-like protein; Provisional | 99.27 | |
| PF00651 | 111 | BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( | 99.13 | |
| PHA03098 | 534 | kelch-like protein; Provisional | 98.94 | |
| KOG4350|consensus | 620 | 98.55 | ||
| smart00225 | 90 | BTB Broad-Complex, Tramtrack and Bric a brac. Doma | 98.38 | |
| KOG2075|consensus | 521 | 97.74 | ||
| KOG4591|consensus | 280 | 97.18 | ||
| KOG0783|consensus | 1267 | 96.83 | ||
| KOG0783|consensus | 1267 | 96.76 | ||
| KOG2838|consensus | 401 | 94.24 | ||
| KOG4682|consensus | 488 | 93.04 | ||
| KOG2838|consensus | 401 | 90.44 | ||
| PF03931 | 62 | Skp1_POZ: Skp1 family, tetramerisation domain; Int | 80.4 |
| >PHA02713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Probab=99.53 E-value=5.3e-15 Score=129.11 Aligned_cols=56 Identities=16% Similarity=0.134 Sum_probs=51.4
Q ss_pred CCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCC
Q psy16238 11 NNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPE 67 (123)
Q Consensus 11 ~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~ 67 (123)
..|...++..|++||.++.||||+|.+++|++|+|||+ ||||||+||++||++++.
T Consensus 6 ~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~-vLaa~S~YF~amF~~~~~ 61 (557)
T PHA02713 6 IKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKT-ILAAGSKYFRTLFTTPMI 61 (557)
T ss_pred hhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHH-HHhhcCHHHHHHhcCCch
Confidence 46899999999999999999999999954789999995 999999999999998754
|
|
| >KOG4441|consensus | Back alignment and domain information |
|---|
| >PHA02790 Kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins | Back alignment and domain information |
|---|
| >PHA03098 kelch-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4350|consensus | Back alignment and domain information |
|---|
| >smart00225 BTB Broad-Complex, Tramtrack and Bric a brac | Back alignment and domain information |
|---|
| >KOG2075|consensus | Back alignment and domain information |
|---|
| >KOG4591|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >KOG4682|consensus | Back alignment and domain information |
|---|
| >KOG2838|consensus | Back alignment and domain information |
|---|
| >PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 2ihc_A | 124 | Transcription regulator protein BACH1; BRIC-A-BRAC | 99.72 | |
| 2z8h_A | 138 | Transcription regulator protein BACH1; BTB, POZ, d | 99.71 | |
| 3ohu_A | 125 | Transcription regulator protein BACH2; BTB/POZ dom | 99.7 | |
| 3b84_A | 119 | Zinc finger and BTB domain-containing protein 48; | 99.69 | |
| 2if5_A | 120 | Zinc finger and BTB domain-containing protein 7A; | 99.68 | |
| 1r29_A | 127 | B-cell lymphoma 6 protein; BTB domain, transcripti | 99.68 | |
| 3fkc_A | 116 | Transcriptional regulator kaiso; zinc finger and B | 99.67 | |
| 1buo_A | 121 | POZ domain, protein (promyelocytic leukemia zinc f | 99.66 | |
| 3ga1_A | 129 | Nucleus accumbens-associated protein 1; BTB/POZ do | 99.65 | |
| 2ppi_A | 144 | Gigaxonin; BTB domain, protein degradation, struct | 99.65 | |
| 2yy9_A | 135 | Zinc finger and BTB domain-containing protein 48; | 99.62 | |
| 3i3n_A | 279 | Kelch-like protein 11; structural genomics, BTB, K | 99.6 | |
| 2vpk_A | 116 | Myoneurin; transcription regulation, transcription | 99.59 | |
| 2q81_A | 119 | MIZ-1 protein; BTB/POZ domain, transcription; HET: | 99.59 | |
| 3hve_A | 256 | Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis | 99.57 | |
| 3htm_A | 172 | Speckle-type POZ protein; BTB, SPOP, ubiquitin, li | 99.45 | |
| 4eoz_A | 145 | Speckle-type POZ protein; E3 ubiquitin ligase, nuc | 99.35 | |
| 3m5b_A | 119 | Zinc finger and BTB domain-containing protein 32; | 99.34 | |
| 2vkp_A | 109 | BTB/POZ domain-containing protein 6; protein-bindi | 99.33 | |
| 3hqi_A | 312 | Speckle-type POZ protein; SPOP, ubiquitin, puckere | 99.21 | |
| 4ajy_C | 97 | Transcription elongation factor B polypeptide 1; E | 97.94 | |
| 2ast_A | 159 | S-phase kinase-associated protein 1A; SCF-substrat | 97.51 | |
| 1fs1_B | 141 | SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le | 96.49 | |
| 2p1m_A | 160 | SKP1-like protein 1A; F-BOX, leucine rich repeat, | 95.1 | |
| 2fnj_C | 96 | Transcription elongation factor B polypeptide 1; b | 94.21 | |
| 1hv2_A | 99 | Elongin C, ELC1; protein-peptide complex, signalin | 93.48 |
| >2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.72 E-value=1.7e-18 Score=121.45 Aligned_cols=65 Identities=15% Similarity=0.195 Sum_probs=57.8
Q ss_pred CCCceeeecCCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCCC
Q psy16238 2 SSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEI 68 (123)
Q Consensus 2 ~~~~~~l~w~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~~ 68 (123)
+++.+.++|..|++.+++.|++||+++.+|||+|.++ |+.|+|||+ ||||+|+||++||.+.+..
T Consensus 1 ~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~-~~~~~aHk~-vLaa~S~yF~~mf~~~~~e 65 (124)
T 2ihc_A 1 SMSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVE-GQRFRAHRS-VLAACSSYFHSRIVGQADG 65 (124)
T ss_dssp --CEEEEECSSHHHHHHHHHHHHHHHTCSCCEEEEET-TEEEEECHH-HHHHHBHHHHHHHTTC---
T ss_pred CCceeeecCcchHHHHHHHHHHHHhcCCCcCEEEEEC-CEEEecHHH-HHHHcCHHHHHHHcCCCCC
Confidence 4578999999999999999999999999999999997 999999995 9999999999999987643
|
| >2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A | Back alignment and structure |
|---|
| >3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A | Back alignment and structure |
|---|
| >1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A | Back alignment and structure |
|---|
| >3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A | Back alignment and structure |
|---|
| >1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A | Back alignment and structure |
|---|
| >3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} | Back alignment and structure |
|---|
| >3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A | Back alignment and structure |
|---|
| >2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A | Back alignment and structure |
|---|
| >3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B | Back alignment and structure |
|---|
| >3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 | Back alignment and structure |
|---|
| >2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} | Back alignment and structure |
|---|
| >3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A | Back alignment and structure |
|---|
| >4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* | Back alignment and structure |
|---|
| >1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D | Back alignment and structure |
|---|
| >2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* | Back alignment and structure |
|---|
| >2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B | Back alignment and structure |
|---|
| >1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 123 | ||||
| d1r29a_ | 122 | d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB | 2e-05 | |
| d1buoa_ | 121 | d.42.1.1 (A:) Promyelocytic leukaemia zinc finger | 3e-04 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 38.9 bits (90), Expect = 2e-05
Identities = 7/28 (25%), Positives = 14/28 (50%)
Query: 8 LRWNNHQSHLLNAFDSLLQNETLVDVTL 35
+++ H S +L + L + L DV +
Sbjct: 3 IQFTRHASDVLLNLNRLRSRDILTDVVI 30
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d1r29a_ | 122 | B-cell lymphoma 6 (Bcl6) protein BTB domain {Human | 99.73 | |
| d1buoa_ | 121 | Promyelocytic leukaemia zinc finger (PLZF) protein | 99.67 |
| >d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: POZ domain superfamily: POZ domain family: BTB/POZ domain domain: B-cell lymphoma 6 (Bcl6) protein BTB domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73 E-value=6.7e-19 Score=122.41 Aligned_cols=66 Identities=20% Similarity=0.242 Sum_probs=58.8
Q ss_pred eeecCCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCCCCceeee
Q psy16238 7 SLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLST 74 (123)
Q Consensus 7 ~l~w~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~~~~~l~v 74 (123)
.|+|++|+..++..|++||+++.||||+|.++ |++|+||| +|||++|+||++||.+.+.......+
T Consensus 2 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~-~~~~~~Hk-~vLa~~S~~F~~~f~~~~~e~~~~~~ 67 (122)
T d1r29a_ 2 QIQFTRHASDVLLNLNRLRSRDILTDVVIVVS-REQFRAHK-TVLMACSGLFYSIFTDQLKRNLSVIN 67 (122)
T ss_dssp CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEET-TEEEEECH-HHHHHHCHHHHHHHTSTTTTTCSEEE
T ss_pred CcccchHHHHHHHHHHHHHhcCCCeEEEEEEC-CEEEEEeh-HHhhhCCHHHHHHhccchhhhcceee
Confidence 37899999999999999999999999999997 99999999 59999999999999987765544333
|
| >d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|