Psyllid ID: psy16238


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLSTKKSGPCTAENNNKTSAHNNNLKLRESLTPNSSPTNNICNEKRNLHRKQN
cccccEEEEEcccHHHHHHHHHHHHcccccccEEEEcccccccccccEEEEccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcc
cccccEEEEccccHHHHHHHHHHHHHccccEEEEEccccccccHHEEEEEEccccHHHHHHHccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHHHHHccc
mssphyslrwnnHQSHLLNAFDSLlqnetlvdvtlarprrrsgeacgaqdlskcpagspdafidgpeipenlstkksgpctaennnktsahnnnlklresltpnssptnnicnekrnlhrkqn
MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSgeacgaqdlskcpAGSPDAFIDGPEIPENLSTKKSGPCTaennnktsahnnnlklresltpnssptnnicnekrnlhrkqn
MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLSTKKSGPCTAENNNKTSAHNNNLKLRESLTPNSSPTNNICNEKRNLHRKQN
*******LRWNNHQSHLLNAFDSLLQNETLVDVTL****************************************************************************************
**SPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLSTKKSGPCTA*****************************************
********RWNNHQSHLLNAFDSLLQNETLVDVTLARP****************PAGSPDAFIDGPEIPENLSTKKSGPCTAENNNKTSAHNNNLKLRESLTPNSSPTNNICNEKRNLHRKQN
****HYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLSTKKSGPCT****************RESLTPNSSPTNNICNEKRNL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLSTKKSGPCTAENNNKTSAHNNNLKLRESLTPNSSPTNNICNEKRNLHRKQN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
P14083 1046 Protein TKR OS=Drosophila yes N/A 0.260 0.030 0.75 4e-09
Q9V5M6 963 Longitudinals lacking pro no N/A 0.260 0.033 0.687 3e-07
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.260 0.040 0.687 3e-07
P42283 891 Longitudinals lacking pro no N/A 0.260 0.035 0.687 4e-07
Q867Z4 970 Longitudinals lacking pro no N/A 0.252 0.031 0.709 5e-07
Q9V5M3 878 Longitudinals lacking pro no N/A 0.260 0.036 0.687 5e-07
P42282 813 Protein tramtrack, alpha no N/A 0.292 0.044 0.638 5e-07
P17789 643 Protein tramtrack, beta i no N/A 0.292 0.055 0.638 5e-07
P42284 549 Longitudinals lacking pro no N/A 0.260 0.058 0.687 2e-06
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.260 0.029 0.625 5e-06
>sp|P14083|TKR_DROME Protein TKR OS=Drosophila melanogaster GN=Tkr PE=2 SV=2 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (90%)

Query: 5   HYSLRWNNHQSHLLNAFDSLLQNETLVDVTLA 36
           HYSLRWNNHQ+H+L AFD+LL+ +TLVDVTL 
Sbjct: 114 HYSLRWNNHQNHILRAFDALLKTKTLVDVTLV 145




Has a regulatory role during midline cell development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
242006896 750 tkr, putative [Pediculus humanus corpori 0.292 0.048 0.805 1e-09
270012342 567 hypothetical protein TcasGA2_TC006481 [T 0.292 0.063 0.75 7e-09
242012006 262 B-cell CLL/lymphoma 6 member B protein, 0.528 0.248 0.530 9e-09
91088849 643 PREDICTED: similar to Tyrosine kinase-re 0.235 0.045 0.75 9e-09
194886981 1044 GG19859 [Drosophila erecta] gi|190659910 0.276 0.032 0.764 5e-08
195489912 1044 GE11385 [Drosophila yakuba] gi|194179040 0.276 0.032 0.764 6e-08
195430050 1149 GK21725 [Drosophila willistoni] gi|19415 0.260 0.027 0.781 6e-08
198458752 1092 GA14141 [Drosophila pseudoobscura pseudo 0.260 0.029 0.781 6e-08
194756350 1099 GF11509 [Drosophila ananassae] gi|190621 0.260 0.029 0.781 6e-08
195380423 1155 GJ21336 [Drosophila virilis] gi|19414376 0.260 0.027 0.781 6e-08
>gi|242006896|ref|XP_002424278.1| tkr, putative [Pediculus humanus corporis] gi|212507678|gb|EEB11540.1| tkr, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/36 (80%), Positives = 34/36 (94%)

Query: 1  MSSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLA 36
          MSS HYSLRWNNHQ+++LNAFD+LLQ+ETLVDVTL 
Sbjct: 1  MSSQHYSLRWNNHQNYILNAFDTLLQSETLVDVTLV 36




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270012342|gb|EFA08790.1| hypothetical protein TcasGA2_TC006481 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242012006|ref|XP_002426734.1| B-cell CLL/lymphoma 6 member B protein, putative [Pediculus humanus corporis] gi|212510905|gb|EEB13996.1| B-cell CLL/lymphoma 6 member B protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|91088849|ref|XP_971045.1| PREDICTED: similar to Tyrosine kinase-related protein CG16778-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|194886981|ref|XP_001976723.1| GG19859 [Drosophila erecta] gi|190659910|gb|EDV57123.1| GG19859 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195489912|ref|XP_002092939.1| GE11385 [Drosophila yakuba] gi|194179040|gb|EDW92651.1| GE11385 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195430050|ref|XP_002063070.1| GK21725 [Drosophila willistoni] gi|194159155|gb|EDW74056.1| GK21725 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198458752|ref|XP_001361151.2| GA14141 [Drosophila pseudoobscura pseudoobscura] gi|198136451|gb|EAL25728.2| GA14141 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194756350|ref|XP_001960442.1| GF11509 [Drosophila ananassae] gi|190621740|gb|EDV37264.1| GF11509 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195380423|ref|XP_002048970.1| GJ21336 [Drosophila virilis] gi|194143767|gb|EDW60163.1| GJ21336 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0003715 1046 CG16778 [Drosophila melanogast 0.276 0.032 0.722 3e-13
FB|FBgn0264981 1089 mamo "maternal gene required f 0.536 0.060 0.462 4.7e-09
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.260 0.036 0.562 6.3e-09
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.333 0.051 0.536 1.4e-08
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.284 0.035 0.628 1.3e-07
FB|FBgn0264442 904 ab "abrupt" [Drosophila melano 0.292 0.039 0.5 1.9e-07
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.512 0.077 0.449 1.7e-06
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.252 0.031 0.709 2.7e-06
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.252 0.032 0.580 2.9e-06
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.463 0.053 0.444 2.7e-05
FB|FBgn0003715 CG16778 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 139 (54.0 bits), Expect = 3.0e-13, Sum P(2) = 3.0e-13
 Identities = 26/36 (72%), Positives = 32/36 (88%)

Query:     2 SSP--HYSLRWNNHQSHLLNAFDSLLQNETLVDVTL 35
             S+P  HYSLRWNNHQ+H+L AFD+LL+ +TLVDVTL
Sbjct:   109 SAPQDHYSLRWNNHQNHILRAFDALLKTKTLVDVTL 144


GO:0003677 "DNA binding" evidence=ISS;NAS
GO:0042332 "gravitaxis" evidence=IMP
GO:0007418 "ventral midline development" evidence=IMP
FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264442 ab "abrupt" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
PHA02713 557 hypothetical protein; Provisional 99.53
KOG4441|consensus 571 99.53
PHA02790 480 Kelch-like protein; Provisional 99.27
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.13
PHA03098 534 kelch-like protein; Provisional 98.94
KOG4350|consensus 620 98.55
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 98.38
KOG2075|consensus 521 97.74
KOG4591|consensus 280 97.18
KOG0783|consensus 1267 96.83
KOG0783|consensus 1267 96.76
KOG2838|consensus 401 94.24
KOG4682|consensus 488 93.04
KOG2838|consensus401 90.44
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 80.4
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.53  E-value=5.3e-15  Score=129.11  Aligned_cols=56  Identities=16%  Similarity=0.134  Sum_probs=51.4

Q ss_pred             CCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCC
Q psy16238         11 NNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPE   67 (123)
Q Consensus        11 ~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~   67 (123)
                      ..|...++..|++||.++.||||+|.+++|++|+|||+ ||||||+||++||++++.
T Consensus         6 ~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~-vLaa~S~YF~amF~~~~~   61 (557)
T PHA02713          6 IKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKT-ILAAGSKYFRTLFTTPMI   61 (557)
T ss_pred             hhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHH-HHhhcCHHHHHHhcCCch
Confidence            46899999999999999999999999954789999995 999999999999998754



>KOG4441|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.72
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.71
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.7
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.69
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.68
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.68
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.67
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.66
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.65
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.65
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.62
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.6
2vpk_A116 Myoneurin; transcription regulation, transcription 99.59
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.59
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.57
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.45
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.35
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.34
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.33
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.21
4ajy_C97 Transcription elongation factor B polypeptide 1; E 97.94
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 97.51
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 96.49
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 95.1
2fnj_C96 Transcription elongation factor B polypeptide 1; b 94.21
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 93.48
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
Probab=99.72  E-value=1.7e-18  Score=121.45  Aligned_cols=65  Identities=15%  Similarity=0.195  Sum_probs=57.8

Q ss_pred             CCCceeeecCCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCCC
Q psy16238          2 SSPHYSLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEI   68 (123)
Q Consensus         2 ~~~~~~l~w~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~~   68 (123)
                      +++.+.++|..|++.+++.|++||+++.+|||+|.++ |+.|+|||+ ||||+|+||++||.+.+..
T Consensus         1 ~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~-~~~~~aHk~-vLaa~S~yF~~mf~~~~~e   65 (124)
T 2ihc_A            1 SMSVFAYESSVHSTNVLLSLNDQRKKDVLCDVTIFVE-GQRFRAHRS-VLAACSSYFHSRIVGQADG   65 (124)
T ss_dssp             --CEEEEECSSHHHHHHHHHHHHHHHTCSCCEEEEET-TEEEEECHH-HHHHHBHHHHHHHTTC---
T ss_pred             CCceeeecCcchHHHHHHHHHHHHhcCCCcCEEEEEC-CEEEecHHH-HHHHcCHHHHHHHcCCCCC
Confidence            4578999999999999999999999999999999997 999999995 9999999999999987643



>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-05
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-04
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 38.9 bits (90), Expect = 2e-05
 Identities = 7/28 (25%), Positives = 14/28 (50%)

Query: 8  LRWNNHQSHLLNAFDSLLQNETLVDVTL 35
          +++  H S +L   + L   + L DV +
Sbjct: 3  IQFTRHASDVLLNLNRLRSRDILTDVVI 30


>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.73
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.67
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=6.7e-19  Score=122.41  Aligned_cols=66  Identities=20%  Similarity=0.242  Sum_probs=58.8

Q ss_pred             eeecCCcHHHHHHHHHHHhhcCCCccEEEecCCCceEecccceeeecCCcchHHhhcCCCCCCceeee
Q psy16238          7 SLRWNNHQSHLLNAFDSLLQNETLVDVTLARPRRRSGEACGAQDLSKCPAGSPDAFIDGPEIPENLST   74 (123)
Q Consensus         7 ~l~w~~h~s~ll~~L~~LR~~~~l~DVtL~v~dg~~f~AHKv~VLAA~S~YFr~mF~~~p~~~~~l~v   74 (123)
                      .|+|++|+..++..|++||+++.||||+|.++ |++|+||| +|||++|+||++||.+.+.......+
T Consensus         2 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~-~~~~~~Hk-~vLa~~S~~F~~~f~~~~~e~~~~~~   67 (122)
T d1r29a_           2 QIQFTRHASDVLLNLNRLRSRDILTDVVIVVS-REQFRAHK-TVLMACSGLFYSIFTDQLKRNLSVIN   67 (122)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEET-TEEEEECH-HHHHHHCHHHHHHHTSTTTTTCSEEE
T ss_pred             CcccchHHHHHHHHHHHHHhcCCCeEEEEEEC-CEEEEEeh-HHhhhCCHHHHHHhccchhhhcceee
Confidence            37899999999999999999999999999997 99999999 59999999999999987765544333



>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure