Psyllid ID: psy16244


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVWQ
ccccccccccccccccEEHHHHHHHHHHcccccEEEEEEEEEccEEEEcccEEcccccccccEEEEcccccccccEEEEEcccccc
cccccEEEEccccccEEEEEEEHHHHEEccHHHccEcEcEEEEEEEcccEEEEcHHHccccEEEEccccHcccccEEEEccEEEEc
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYdyklrwepkeyggvhmlhvpsdhiwrpdivlynkftvwq
MGQNRVLKLLQNHETLLVELRTAtllsrhnlknqimttnlwvEQSWYDYKLRWEPKEYGGVHMLHvpsdhiwrpdIVLYNKFTVWQ
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVWQ
*****VLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVW*
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFT***
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVWQ
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVWQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQNRVLKLLQNHETLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNKFTVWQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query86 2.2.26 [Sep-21-2011]
P91766 516 Acetylcholine receptor su N/A N/A 0.755 0.125 0.772 3e-24
P09478 567 Acetylcholine receptor su no N/A 0.883 0.134 0.587 4e-21
P25162 519 Acetylcholine receptor su no N/A 0.883 0.146 0.612 1e-20
Q9N587 502 Acetylcholine receptor su yes N/A 0.802 0.137 0.625 7e-19
P23414 557 Acetylcholine receptor su N/A N/A 0.883 0.136 0.55 2e-17
P17644 576 Acetylcholine receptor su no N/A 0.883 0.131 0.537 4e-17
Q19AE6 627 Neuronal acetylcholine re N/A N/A 0.569 0.078 0.673 6e-17
O70174 629 Neuronal acetylcholine re yes N/A 0.569 0.077 0.653 5e-16
P43681 627 Neuronal acetylcholine re yes N/A 0.569 0.078 0.653 5e-16
P09483 630 Neuronal acetylcholine re yes N/A 0.569 0.077 0.653 7e-16
>sp|P91766|ACH1_MANSE Acetylcholine receptor subunit alpha-like OS=Manduca sexta GN=ARA1 PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 58/66 (87%), Gaps = 1/66 (1%)

Query: 15  TLLVELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRP 74
           T+ ++L+ + L+   NLKNQIMTTNLWVEQSWYDYKL WEP+EYGGV MLHVPSDHIWRP
Sbjct: 51  TVRIKLKLSQLIDV-NLKNQIMTTNLWVEQSWYDYKLSWEPREYGGVEMLHVPSDHIWRP 109

Query: 75  DIVLYN 80
           DIVLYN
Sbjct: 110 DIVLYN 115




After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Manduca sexta (taxid: 7130)
>sp|P09478|ACH1_DROME Acetylcholine receptor subunit alpha-like 1 OS=Drosophila melanogaster GN=nAcRalpha-96Aa PE=2 SV=2 Back     alignment and function description
>sp|P25162|ACH4_DROME Acetylcholine receptor subunit beta-like 2 OS=Drosophila melanogaster GN=nAcRbeta-96A PE=2 SV=3 Back     alignment and function description
>sp|Q9N587|ACH6_CAEEL Acetylcholine receptor subunit alpha-type unc-63 OS=Caenorhabditis elegans GN=unc-63 PE=1 SV=2 Back     alignment and function description
>sp|P23414|ACH1_SCHGR Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria PE=2 SV=1 Back     alignment and function description
>sp|P17644|ACH2_DROME Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster GN=nAcRalpha-96Ab PE=2 SV=1 Back     alignment and function description
>sp|Q19AE6|ACHA4_MUSPF Neuronal acetylcholine receptor subunit alpha-4 OS=Mustela putorius furo GN=CHRNA4 PE=2 SV=1 Back     alignment and function description
>sp|O70174|ACHA4_MOUSE Neuronal acetylcholine receptor subunit alpha-4 OS=Mus musculus GN=Chrna4 PE=2 SV=2 Back     alignment and function description
>sp|P43681|ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens GN=CHRNA4 PE=1 SV=2 Back     alignment and function description
>sp|P09483|ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus GN=Chrna4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
221513709 539 nicotinic acetylcholine receptor alpha 8 0.883 0.141 0.7 4e-26
442634276 499 nicotinic acetylcholine receptor alpha 8 0.883 0.152 0.7 4e-26
7258392 568 nicotinic acetylcholine receptor Dalpha 0.883 0.133 0.7 4e-26
267925056 577 nicotinic acetylcholine receptor subunit 0.883 0.131 0.7 5e-26
158186744 569 nicotinic acetylcholine receptor subunit 0.883 0.133 0.7 5e-26
290560640 569 nicotinic acetylcholine receptor subunit 0.883 0.133 0.7 5e-26
350536205 577 nicotinic acetylcholine receptor alpha 4 0.883 0.131 0.7 6e-26
195446115 564 GK12171 [Drosophila willistoni] gi|19416 0.883 0.134 0.7 8e-26
383847485 569 PREDICTED: acetylcholine receptor subuni 0.883 0.133 0.7 9e-26
380018139 569 PREDICTED: acetylcholine receptor subuni 0.883 0.133 0.7 9e-26
>gi|221513709|ref|NP_001097669.2| nicotinic acetylcholine receptor alpha 80B, isoform C [Drosophila melanogaster] gi|220902701|gb|ABW08585.2| nicotinic acetylcholine receptor alpha 80B, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 67/80 (83%), Gaps = 4/80 (5%)

Query: 4   NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
           N++++ + N   +L   ++L+ + L+   NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG
Sbjct: 24  NKLVRPVVNTTDVLKVCIKLKLSQLIDV-NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 82

Query: 61  VHMLHVPSDHIWRPDIVLYN 80
           VHMLHVPSDHIWRPDIVLYN
Sbjct: 83  VHMLHVPSDHIWRPDIVLYN 102




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442634276|ref|NP_001262234.1| nicotinic acetylcholine receptor alpha 80B, isoform G [Drosophila melanogaster] gi|440216215|gb|AGB94927.1| nicotinic acetylcholine receptor alpha 80B, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|7258392|emb|CAB77445.1| nicotinic acetylcholine receptor Dalpha 4 subunit [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|267925056|gb|ACY82686.1| nicotinic acetylcholine receptor subunit alpha 4 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|158186744|ref|NP_001103389.1| nicotinic acetylcholine receptor subunit alpha 4 isoform 1 precursor [Bombyx mori] gi|157367291|gb|ABV45514.1| nicotinic acetylcholine receptor subunit alpha 4 transcript variant 1 [Bombyx mori] Back     alignment and taxonomy information
>gi|290560640|ref|NP_001166816.1| nicotinic acetylcholine receptor subunit alpha 4 isoform 2 precursor [Bombyx mori] gi|157367293|gb|ABV45515.1| nicotinic acetylcholine receptor subunit alpha 4 transcript variant 2 [Bombyx mori] gi|157783830|gb|ABV72686.1| nicotinic acetylcholine receptor alpha 4 subunit [Bombyx mori] Back     alignment and taxonomy information
>gi|350536205|ref|NP_001234904.1| nicotinic acetylcholine receptor alpha 4 subunit precursor [Nasonia vitripennis] gi|267925083|gb|ACY82687.1| nicotinic acetylcholine receptor subunit alpha 4' [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195446115|ref|XP_002070634.1| GK12171 [Drosophila willistoni] gi|194166719|gb|EDW81620.1| GK12171 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|383847485|ref|XP_003699383.1| PREDICTED: acetylcholine receptor subunit alpha-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380018139|ref|XP_003692993.1| PREDICTED: acetylcholine receptor subunit alpha-like isoform 1 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query86
FB|FBgn0037212 568 nAcRalpha-80B "nicotinic Acety 0.883 0.133 0.7 3.5e-26
FB|FBgn0015519 795 nAcRalpha-7E "nicotinic Acetyl 0.755 0.081 0.787 7.9e-25
FB|FBgn0004118 519 nAcRbeta-96A "nicotinic Acetyl 0.918 0.152 0.604 6.2e-22
FB|FBgn0000036 567 nAcRalpha-96Aa "nicotinic Acet 0.883 0.134 0.587 2.1e-20
WB|WBGene00006797 502 unc-63 [Caenorhabditis elegans 0.883 0.151 0.575 4.1e-20
FB|FBgn0000039 576 nAcRalpha-96Ab "nicotinic Acet 0.883 0.131 0.537 1.2e-18
UNIPROTKB|H0YBH1137 CHRNA4 "Neuronal acetylcholine 0.906 0.569 0.487 3.7e-16
UNIPROTKB|F1NKI5 325 CHRNA6 "Neuronal acetylcholine 0.895 0.236 0.468 5.8e-16
UNIPROTKB|F1NWX4 470 CHRNB4 "Neuronal acetylcholine 0.883 0.161 0.475 8e-16
UNIPROTKB|P26153 470 CHRNB4 "Neuronal acetylcholine 0.883 0.161 0.475 8e-16
FB|FBgn0037212 nAcRalpha-80B "nicotinic Acetylcholine Receptor alpha 80B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 302 (111.4 bits), Expect = 3.5e-26, P = 3.5e-26
 Identities = 56/80 (70%), Positives = 67/80 (83%)

Query:     4 NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
             N++++ + N   +L   ++L+ + L+   NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG
Sbjct:    53 NKLVRPVVNTTDVLKVCIKLKLSQLIDV-NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 111

Query:    61 VHMLHVPSDHIWRPDIVLYN 80
             VHMLHVPSDHIWRPDIVLYN
Sbjct:   112 VHMLHVPSDHIWRPDIVLYN 131




GO:0005892 "acetylcholine-gated channel complex" evidence=ISS
GO:0004889 "acetylcholine-activated cation-selective channel activity" evidence=ISS
GO:0006811 "ion transport" evidence=IEA
GO:0045211 "postsynaptic membrane" evidence=IEA
FB|FBgn0015519 nAcRalpha-7E "nicotinic Acetylcholine Receptor alpha 7E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004118 nAcRbeta-96A "nicotinic Acetylcholine Receptor beta 96A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000036 nAcRalpha-96Aa "nicotinic Acetylcholine Receptor alpha 96Aa" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00006797 unc-63 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0000039 nAcRalpha-96Ab "nicotinic Acetylcholine Receptor alpha 96Ab" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H0YBH1 CHRNA4 "Neuronal acetylcholine receptor subunit alpha-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKI5 CHRNA6 "Neuronal acetylcholine receptor subunit alpha-6" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWX4 CHRNB4 "Neuronal acetylcholine receptor subunit beta-4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P26153 CHRNB4 "Neuronal acetylcholine receptor subunit beta-4" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P09483ACHA4_RATNo assigned EC number0.65300.56970.0777yesN/A
P09482ACHA4_CHICKNo assigned EC number0.67340.56970.0787yesN/A
Q5IS77ACHA4_PANTRNo assigned EC number0.65300.56970.0781yesN/A
Q9N587ACH6_CAEELNo assigned EC number0.6250.80230.1374yesN/A
O70174ACHA4_MOUSENo assigned EC number0.65300.56970.0779yesN/A
P43681ACHA4_HUMANNo assigned EC number0.65300.56970.0781yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
pfam02931 215 pfam02931, Neur_chan_LBD, Neurotransmitter-gated i 1e-22
TIGR00860 459 TIGR00860, LIC, Cation transporter family protein 1e-14
>gnl|CDD|217293 pfam02931, Neur_chan_LBD, Neurotransmitter-gated ion-channel ligand binding domain Back     alignment and domain information
 Score = 86.1 bits (214), Expect = 1e-22
 Identities = 30/52 (57%), Positives = 41/52 (78%)

Query: 30 NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
          + KNQ +TTN+W+ Q W D +L W+P++YGG+  L +PSD IW+PDIVLYNK
Sbjct: 41 DEKNQDLTTNVWLRQQWTDERLAWDPEDYGGITSLRLPSDKIWKPDIVLYNK 92


This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. Length = 215

>gnl|CDD|233155 TIGR00860, LIC, Cation transporter family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 86
TIGR00860 459 LIC Cation transporter family protein. selective w 99.93
KOG3646|consensus 486 99.93
KOG3645|consensus 449 99.92
PF02931 217 Neur_chan_LBD: Neurotransmitter-gated ion-channel 99.89
KOG3643|consensus 459 99.72
KOG3642|consensus 466 99.56
KOG3644|consensus 457 99.54
>TIGR00860 LIC Cation transporter family protein Back     alignment and domain information
Probab=99.93  E-value=1.3e-26  Score=166.09  Aligned_cols=85  Identities=31%  Similarity=0.610  Sum_probs=81.2

Q ss_pred             CCCCCCCCCCCCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCEEEE
Q psy16244          1 MGQNRVLKLLQNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLY   79 (86)
Q Consensus         1 ~~Yd~~~rP~~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi~i~   79 (86)
                      ++||+.+||+.++++++|.++ .+.+|+++||++|++++++|++++|+|+||+|||++|+|++.+.++.++||+||++++
T Consensus        40 ~~Yd~~~RPv~~~~~v~V~~~i~l~~i~~vde~~q~~t~~~wl~~~W~D~rL~Wnp~~y~~i~~i~~~~~~IW~PDi~l~  119 (459)
T TIGR00860        40 KNYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDYTTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFY  119 (459)
T ss_pred             hcCCCCcCCCCCCCCEEEEEEEEEEEecccccccceEEEeeeeeeEEeCCccCCCCccCCCceeccccccccccCcEEee
Confidence            489999999944899999999 9999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCCcC
Q psy16244         80 NKFTVW   85 (86)
Q Consensus        80 ns~d~~   85 (86)
                      |++++.
T Consensus       120 N~~~~~  125 (459)
T TIGR00860       120 NEKDAR  125 (459)
T ss_pred             cCcccc
Confidence            999864



selective while glycine receptors are anion selective).

>KOG3646|consensus Back     alignment and domain information
>KOG3645|consensus Back     alignment and domain information
>PF02931 Neur_chan_LBD: Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] Back     alignment and domain information
>KOG3643|consensus Back     alignment and domain information
>KOG3642|consensus Back     alignment and domain information
>KOG3644|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2qc1_B 212 Crystal Structure Of The Extracellular Domain Of Th 2e-14
4aq5_A 461 Gating Movement In Acetylcholine Receptor Analysed 8e-12
2bg9_A 370 Refined Structure Of The Nicotinic Acetylcholine Re 1e-11
4aq5_B 493 Gating Movement In Acetylcholine Receptor Analysed 3e-11
2bg9_B 370 Refined Structure Of The Nicotinic Acetylcholine Re 4e-11
2bg9_E 370 Refined Structure Of The Nicotinic Acetylcholine Re 1e-10
4aq5_E 488 Gating Movement In Acetylcholine Receptor Analysed 3e-10
2bg9_C 369 Refined Structure Of The Nicotinic Acetylcholine Re 1e-07
4aq5_C 522 Gating Movement In Acetylcholine Receptor Analysed 1e-07
3sq6_A 204 Crystal Structures Of The Ligand Binding Domain Of 5e-07
4afg_A 230 Capitella Teleta Achbp In Complex With Varenicline 1e-04
3sio_A 230 Ac-Achbp Ligand Binding Domain (Not Including Beta 5e-04
3sh1_A 230 Ac-Achbp Ligand Binding Domain Mutated To Human Alp 5e-04
>pdb|2QC1|B Chain B, Crystal Structure Of The Extracellular Domain Of The Nicotinic Acetylcholine Receptor 1 Subunit Bound To Alpha-Bungarotoxin At 1.9 A Resolution Length = 212 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 34/80 (42%), Positives = 56/80 (70%), Gaps = 4/80 (5%) Query: 4 NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60 + V++ +++H ++ V L+ L++ + NQI+TTN+ ++Q W DY L+W P +YGG Sbjct: 17 SSVVRPVEDHREIVQVTVGLQLIQLINVDEV-NQIVTTNVRLKQQWVDYNLKWNPDDYGG 75 Query: 61 VHMLHVPSDHIWRPDIVLYN 80 V +H+PS+ IWRPD+VLYN Sbjct: 76 VKKIHIPSEKIWRPDVVLYN 95
>pdb|4AQ5|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 461 Back     alignment and structure
>pdb|2BG9|A Chain A, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution. Length = 370 Back     alignment and structure
>pdb|4AQ5|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 493 Back     alignment and structure
>pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure
>pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 Back     alignment and structure
>pdb|4AQ5|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 488 Back     alignment and structure
>pdb|2BG9|C Chain C, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 369 Back     alignment and structure
>pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 522 Back     alignment and structure
>pdb|3SQ6|A Chain A, Crystal Structures Of The Ligand Binding Domain Of A Pentameric Alpha7 Nicotinic Receptor Chimera With Its Agonist Epibatidine Length = 204 Back     alignment and structure
>pdb|4AFG|A Chain A, Capitella Teleta Achbp In Complex With Varenicline Length = 230 Back     alignment and structure
>pdb|3SIO|A Chain A, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10 Linker) Mutated To Human Alpha-7 Nachr Length = 230 Back     alignment and structure
>pdb|3SH1|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7 Nachr Length = 230 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query86
2qc1_B 212 Acetylcholine receptor subunit alpha; nicotinic ac 6e-25
2bg9_B 370 Acetylcholine receptor protein, beta chain; ION ch 5e-24
3sq6_A 204 ACHBP, neuronal acetylcholine receptor subunit alp 7e-24
2bg9_C 369 Acetylcholine receptor protein, delta chain; ION c 9e-24
2bg9_A 370 Acetylcholine receptor protein, alpha chain; ION c 2e-23
2wn9_A 228 Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl 2e-23
2bg9_E 370 Acetylcholine receptor protein, gamma chain; ION c 6e-23
1uw6_A 211 Acetylcholine-binding protein; pentamer, IGG fold, 2e-21
2bj0_A 203 Acetylcholine-binding protein; 3D-structure, glyco 2e-21
4aq5_E 488 Acetylcholine receptor gamma subunit; membrane pro 1e-20
4aq5_C 522 Acetylcholine receptor delta subunit; membrane pro 2e-20
3tlw_A 321 GLR4197 protein, GLIC; Cys-loop receptor family, m 3e-20
4afh_A 230 ACHBP; acetylcholine-binding protein, nicotinic re 4e-20
4aq5_B 493 Acetylcholine receptor beta subunit; membrane prot 6e-20
4aq5_A 461 Acetylcholine receptor subunit alpha; membrane pro 7e-19
3igq_A 201 GLR4197 protein; plgic Cys-loop, membrane protein, 6e-17
3rhw_A 347 Avermectin-sensitive glutamate-gated chloride CHA 9e-16
3rqw_A 322 ELIC pentameric ligand gated ION channel from ERW 1e-15
>2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Length = 212 Back     alignment and structure
 Score = 91.3 bits (227), Expect = 6e-25
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 12 NHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDH 70
          + E + V +      L   +  NQI+TTN+ ++Q W DY L+W P +YGGV  +H+PS+ 
Sbjct: 26 HREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEK 85

Query: 71 IWRPDIVLYN 80
          IWRPD+VLYN
Sbjct: 86 IWRPDVVLYN 95


>2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} PDB: 3sq9_A* Length = 204 Back     alignment and structure
>2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 369 Back     alignment and structure
>2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Length = 228 Back     alignment and structure
>2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 Back     alignment and structure
>1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Length = 211 Back     alignment and structure
>2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Length = 203 Back     alignment and structure
>4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Length = 488 Back     alignment and structure
>4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Length = 522 Back     alignment and structure
>3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 3ehz_A 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Length = 321 Back     alignment and structure
>4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* Length = 230 Back     alignment and structure
>4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Length = 493 Back     alignment and structure
>4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Length = 461 Back     alignment and structure
>3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Length = 201 Back     alignment and structure
>3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Length = 347 Back     alignment and structure
>3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A Length = 322 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
4aod_A 205 Acetylcholine-binding protein type 1; ligand gated 99.95
4aoe_A 205 Acetylcholine-binding protein type 2; ligand gated 99.95
3sq6_A 204 ACHBP, neuronal acetylcholine receptor subunit alp 99.95
2qc1_B 212 Acetylcholine receptor subunit alpha; nicotinic ac 99.95
4afh_A 230 ACHBP; acetylcholine-binding protein, nicotinic re 99.95
1uw6_A 211 Acetylcholine-binding protein; pentamer, IGG fold, 99.94
2bg9_C 369 Acetylcholine receptor protein, delta chain; ION c 99.94
2wn9_A 228 Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl 99.93
2bg9_B 370 Acetylcholine receptor protein, beta chain; ION ch 99.93
4aq5_C 522 Acetylcholine receptor delta subunit; membrane pro 99.93
3rhw_A 347 Avermectin-sensitive glutamate-gated chloride CHA 99.93
2bg9_E 370 Acetylcholine receptor protein, gamma chain; ION c 99.93
4aq5_A 461 Acetylcholine receptor subunit alpha; membrane pro 99.93
4aq5_E 488 Acetylcholine receptor gamma subunit; membrane pro 99.93
2bg9_A 370 Acetylcholine receptor protein, alpha chain; ION c 99.93
4aq5_B 493 Acetylcholine receptor beta subunit; membrane prot 99.92
2bj0_A 203 Acetylcholine-binding protein; 3D-structure, glyco 99.92
3tlw_A 321 GLR4197 protein, GLIC; Cys-loop receptor family, m 99.91
3igq_A 201 GLR4197 protein; plgic Cys-loop, membrane protein, 99.9
3rqw_A 322 ELIC pentameric ligand gated ION channel from ERW 99.73
>4aod_A Acetylcholine-binding protein type 1; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholine receptor; 6.00A {Biomphalaria glabrata} Back     alignment and structure
Probab=99.95  E-value=3e-29  Score=163.10  Aligned_cols=83  Identities=22%  Similarity=0.482  Sum_probs=79.5

Q ss_pred             CCCCCCCCCCCCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCEEEE
Q psy16244          1 MGQNRVLKLLQNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLY   79 (86)
Q Consensus         1 ~~Yd~~~rP~~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi~i~   79 (86)
                      .+||+.+||+.+++|+.|.++ +|.+|++|+|++|++++++|++|.|+|+||+|+| +|+||+.+.++.++||+||++++
T Consensus        14 ~~Y~~~~rPv~~~~pv~V~~~l~l~~i~~vde~~q~~t~~~wl~~~W~D~rL~W~~-~~~~i~~i~v~~~~IW~PDi~l~   92 (205)
T 4aod_A           14 SRCSPLNIPIEDDQPVKVSFEYSLQKIFRADVENDEVDIGLWTTLVWKDRCLNWFN-EFTSFKELTVPIAEIWTPDIFIF   92 (205)
T ss_dssp             HTTCSSSCCCCSSCCEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEECCCCCCSC-CCSCCCEEEEEGGGSCCCCEEET
T ss_pred             hcCCCcCCCCCCCccEEEEEEEEeeeeeeecccCCEEEEEEEEEEEEECCceeeCC-cCCCccEeeccHHhcCcCCEEEE
Confidence            379999999998999999999 9999999999999999999999999999999997 79999999999999999999999


Q ss_pred             ecCCc
Q psy16244         80 NKFTV   84 (86)
Q Consensus        80 ns~d~   84 (86)
                      |++++
T Consensus        93 N~~~~   97 (205)
T 4aod_A           93 DSVGA   97 (205)
T ss_dssp             TBSSC
T ss_pred             ccccc
Confidence            99864



>4aoe_A Acetylcholine-binding protein type 2; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholin receptor; 5.80A {Biomphalaria glabrata} Back     alignment and structure
>3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} SCOP: b.96.1.1 PDB: 3sq9_A* Back     alignment and structure
>2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Back     alignment and structure
>4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* 4b5d_A* Back     alignment and structure
>1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Back     alignment and structure
>2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Back     alignment and structure
>2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Back     alignment and structure
>3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Back     alignment and structure
>2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Back     alignment and structure
>4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Back     alignment and structure
>2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Back     alignment and structure
>4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Back     alignment and structure
>2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Back     alignment and structure
>3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 4f8h_A* 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Back     alignment and structure
>3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Back     alignment and structure
>3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 2yn6_A* 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A 4a97_A* 4a96_A* 2yoe_A* 4a98_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 86
d1uw6a_ 208 b.96.1.1 (A:) Acetylcholine binding protein (ACHBP 4e-11
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Length = 208 Back     information, alignment and structure

class: All beta proteins
fold: Nicotinic receptor ligand binding domain-like
superfamily: Nicotinic receptor ligand binding domain-like
family: Nicotinic receptor ligand binding domain-like
domain: Acetylcholine binding protein (ACHBP)
species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]
 Score = 54.0 bits (129), Expect = 4e-11
 Identities = 13/51 (25%), Positives = 19/51 (37%), Gaps = 2/51 (3%)

Query: 30 NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
          N     +    W + +W D  L W          + VP   +W PD+  YN
Sbjct: 43 NEITNEVDVVFWQQTTWSDRTLAWNSSHSPD--QVSVPISSLWVPDLAAYN 91


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query86
d1uw6a_ 208 Acetylcholine binding protein (ACHBP) {Great pond 99.89
>d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Back     information, alignment and structure
class: All beta proteins
fold: Nicotinic receptor ligand binding domain-like
superfamily: Nicotinic receptor ligand binding domain-like
family: Nicotinic receptor ligand binding domain-like
domain: Acetylcholine binding protein (ACHBP)
species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]
Probab=99.89  E-value=2e-24  Score=138.91  Aligned_cols=81  Identities=19%  Similarity=0.389  Sum_probs=72.2

Q ss_pred             CCCCCCCCC----CCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCE
Q psy16244          2 GQNRVLKLL----QNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDI   76 (86)
Q Consensus         2 ~Yd~~~rP~----~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi   76 (86)
                      +|+|..||.    .++.|+.|.++ .|.+|++++|++|++++.+|++|.|+|+||+|+|++|+++  +.++.++||+|||
T Consensus        10 ~y~~~~rP~~~P~~~~~pv~V~~~l~l~~i~~vde~~q~~~~~~~~~~~W~D~rL~Wnp~~~~~~--~~v~~~~iW~PDi   87 (208)
T d1uw6a_          10 NIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQ--VSVPISSLWVPDL   87 (208)
T ss_dssp             HHHHHCCTTSCCCCTTCCEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEECGGGCCCCTTSCSE--EEEEGGGSCCCCE
T ss_pred             ccccccCCCcCCcCCCCCEEEEEEEEEEeEeeecccCCEEEEEEEEEEEEECCccccccccCCce--eccchhccccccE
Confidence            567777775    33789999999 9999999999999999999999999999999999999875  5677899999999


Q ss_pred             EEEecCCc
Q psy16244         77 VLYNKFTV   84 (86)
Q Consensus        77 ~i~ns~d~   84 (86)
                      +++|+++.
T Consensus        88 ~l~n~~~~   95 (208)
T d1uw6a_          88 AAYNAISK   95 (208)
T ss_dssp             EETTBCSC
T ss_pred             EEEEEccc
Confidence            99998764