Psyllid ID: psy16244
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| 221513709 | 539 | nicotinic acetylcholine receptor alpha 8 | 0.883 | 0.141 | 0.7 | 4e-26 | |
| 442634276 | 499 | nicotinic acetylcholine receptor alpha 8 | 0.883 | 0.152 | 0.7 | 4e-26 | |
| 7258392 | 568 | nicotinic acetylcholine receptor Dalpha | 0.883 | 0.133 | 0.7 | 4e-26 | |
| 267925056 | 577 | nicotinic acetylcholine receptor subunit | 0.883 | 0.131 | 0.7 | 5e-26 | |
| 158186744 | 569 | nicotinic acetylcholine receptor subunit | 0.883 | 0.133 | 0.7 | 5e-26 | |
| 290560640 | 569 | nicotinic acetylcholine receptor subunit | 0.883 | 0.133 | 0.7 | 5e-26 | |
| 350536205 | 577 | nicotinic acetylcholine receptor alpha 4 | 0.883 | 0.131 | 0.7 | 6e-26 | |
| 195446115 | 564 | GK12171 [Drosophila willistoni] gi|19416 | 0.883 | 0.134 | 0.7 | 8e-26 | |
| 383847485 | 569 | PREDICTED: acetylcholine receptor subuni | 0.883 | 0.133 | 0.7 | 9e-26 | |
| 380018139 | 569 | PREDICTED: acetylcholine receptor subuni | 0.883 | 0.133 | 0.7 | 9e-26 |
| >gi|221513709|ref|NP_001097669.2| nicotinic acetylcholine receptor alpha 80B, isoform C [Drosophila melanogaster] gi|220902701|gb|ABW08585.2| nicotinic acetylcholine receptor alpha 80B, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Score = 121 bits (304), Expect = 4e-26, Method: Composition-based stats.
Identities = 56/80 (70%), Positives = 67/80 (83%), Gaps = 4/80 (5%)
Query: 4 NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
N++++ + N +L ++L+ + L+ NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG
Sbjct: 24 NKLVRPVVNTTDVLKVCIKLKLSQLIDV-NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 82
Query: 61 VHMLHVPSDHIWRPDIVLYN 80
VHMLHVPSDHIWRPDIVLYN
Sbjct: 83 VHMLHVPSDHIWRPDIVLYN 102
|
Source: Drosophila melanogaster Species: Drosophila melanogaster Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|442634276|ref|NP_001262234.1| nicotinic acetylcholine receptor alpha 80B, isoform G [Drosophila melanogaster] gi|440216215|gb|AGB94927.1| nicotinic acetylcholine receptor alpha 80B, isoform G [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|7258392|emb|CAB77445.1| nicotinic acetylcholine receptor Dalpha 4 subunit [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|267925056|gb|ACY82686.1| nicotinic acetylcholine receptor subunit alpha 4 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|158186744|ref|NP_001103389.1| nicotinic acetylcholine receptor subunit alpha 4 isoform 1 precursor [Bombyx mori] gi|157367291|gb|ABV45514.1| nicotinic acetylcholine receptor subunit alpha 4 transcript variant 1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|290560640|ref|NP_001166816.1| nicotinic acetylcholine receptor subunit alpha 4 isoform 2 precursor [Bombyx mori] gi|157367293|gb|ABV45515.1| nicotinic acetylcholine receptor subunit alpha 4 transcript variant 2 [Bombyx mori] gi|157783830|gb|ABV72686.1| nicotinic acetylcholine receptor alpha 4 subunit [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|350536205|ref|NP_001234904.1| nicotinic acetylcholine receptor alpha 4 subunit precursor [Nasonia vitripennis] gi|267925083|gb|ACY82687.1| nicotinic acetylcholine receptor subunit alpha 4' [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195446115|ref|XP_002070634.1| GK12171 [Drosophila willistoni] gi|194166719|gb|EDW81620.1| GK12171 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|383847485|ref|XP_003699383.1| PREDICTED: acetylcholine receptor subunit alpha-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380018139|ref|XP_003692993.1| PREDICTED: acetylcholine receptor subunit alpha-like isoform 1 [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 86 | ||||||
| FB|FBgn0037212 | 568 | nAcRalpha-80B "nicotinic Acety | 0.883 | 0.133 | 0.7 | 3.5e-26 | |
| FB|FBgn0015519 | 795 | nAcRalpha-7E "nicotinic Acetyl | 0.755 | 0.081 | 0.787 | 7.9e-25 | |
| FB|FBgn0004118 | 519 | nAcRbeta-96A "nicotinic Acetyl | 0.918 | 0.152 | 0.604 | 6.2e-22 | |
| FB|FBgn0000036 | 567 | nAcRalpha-96Aa "nicotinic Acet | 0.883 | 0.134 | 0.587 | 2.1e-20 | |
| WB|WBGene00006797 | 502 | unc-63 [Caenorhabditis elegans | 0.883 | 0.151 | 0.575 | 4.1e-20 | |
| FB|FBgn0000039 | 576 | nAcRalpha-96Ab "nicotinic Acet | 0.883 | 0.131 | 0.537 | 1.2e-18 | |
| UNIPROTKB|H0YBH1 | 137 | CHRNA4 "Neuronal acetylcholine | 0.906 | 0.569 | 0.487 | 3.7e-16 | |
| UNIPROTKB|F1NKI5 | 325 | CHRNA6 "Neuronal acetylcholine | 0.895 | 0.236 | 0.468 | 5.8e-16 | |
| UNIPROTKB|F1NWX4 | 470 | CHRNB4 "Neuronal acetylcholine | 0.883 | 0.161 | 0.475 | 8e-16 | |
| UNIPROTKB|P26153 | 470 | CHRNB4 "Neuronal acetylcholine | 0.883 | 0.161 | 0.475 | 8e-16 |
| FB|FBgn0037212 nAcRalpha-80B "nicotinic Acetylcholine Receptor alpha 80B" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 302 (111.4 bits), Expect = 3.5e-26, P = 3.5e-26
Identities = 56/80 (70%), Positives = 67/80 (83%)
Query: 4 NRVLKLLQNHETLL---VELRTATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 60
N++++ + N +L ++L+ + L+ NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG
Sbjct: 53 NKLVRPVVNTTDVLKVCIKLKLSQLIDV-NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGG 111
Query: 61 VHMLHVPSDHIWRPDIVLYN 80
VHMLHVPSDHIWRPDIVLYN
Sbjct: 112 VHMLHVPSDHIWRPDIVLYN 131
|
|
| FB|FBgn0015519 nAcRalpha-7E "nicotinic Acetylcholine Receptor alpha 7E" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004118 nAcRbeta-96A "nicotinic Acetylcholine Receptor beta 96A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000036 nAcRalpha-96Aa "nicotinic Acetylcholine Receptor alpha 96Aa" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006797 unc-63 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000039 nAcRalpha-96Ab "nicotinic Acetylcholine Receptor alpha 96Ab" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YBH1 CHRNA4 "Neuronal acetylcholine receptor subunit alpha-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NKI5 CHRNA6 "Neuronal acetylcholine receptor subunit alpha-6" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWX4 CHRNB4 "Neuronal acetylcholine receptor subunit beta-4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P26153 CHRNB4 "Neuronal acetylcholine receptor subunit beta-4" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 86 | |||
| pfam02931 | 215 | pfam02931, Neur_chan_LBD, Neurotransmitter-gated i | 1e-22 | |
| TIGR00860 | 459 | TIGR00860, LIC, Cation transporter family protein | 1e-14 |
| >gnl|CDD|217293 pfam02931, Neur_chan_LBD, Neurotransmitter-gated ion-channel ligand binding domain | Back alignment and domain information |
|---|
Score = 86.1 bits (214), Expect = 1e-22
Identities = 30/52 (57%), Positives = 41/52 (78%)
Query: 30 NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNK 81
+ KNQ +TTN+W+ Q W D +L W+P++YGG+ L +PSD IW+PDIVLYNK
Sbjct: 41 DEKNQDLTTNVWLRQQWTDERLAWDPEDYGGITSLRLPSDKIWKPDIVLYNK 92
|
This family is the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. Length = 215 |
| >gnl|CDD|233155 TIGR00860, LIC, Cation transporter family protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| TIGR00860 | 459 | LIC Cation transporter family protein. selective w | 99.93 | |
| KOG3646|consensus | 486 | 99.93 | ||
| KOG3645|consensus | 449 | 99.92 | ||
| PF02931 | 217 | Neur_chan_LBD: Neurotransmitter-gated ion-channel | 99.89 | |
| KOG3643|consensus | 459 | 99.72 | ||
| KOG3642|consensus | 466 | 99.56 | ||
| KOG3644|consensus | 457 | 99.54 |
| >TIGR00860 LIC Cation transporter family protein | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.3e-26 Score=166.09 Aligned_cols=85 Identities=31% Similarity=0.610 Sum_probs=81.2
Q ss_pred CCCCCCCCCCCCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCEEEE
Q psy16244 1 MGQNRVLKLLQNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLY 79 (86)
Q Consensus 1 ~~Yd~~~rP~~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi~i~ 79 (86)
++||+.+||+.++++++|.++ .+.+|+++||++|++++++|++++|+|+||+|||++|+|++.+.++.++||+||++++
T Consensus 40 ~~Yd~~~RPv~~~~~v~V~~~i~l~~i~~vde~~q~~t~~~wl~~~W~D~rL~Wnp~~y~~i~~i~~~~~~IW~PDi~l~ 119 (459)
T TIGR00860 40 KNYDARVRPVFGGPPVTVSFNLFLRSIMDVDEKNMDYTTNIWLRQEWTDERLQWNPEEYPGVTLVRTPDDSIWVPDIFFY 119 (459)
T ss_pred hcCCCCcCCCCCCCCEEEEEEEEEEEecccccccceEEEeeeeeeEEeCCccCCCCccCCCceeccccccccccCcEEee
Confidence 489999999944899999999 9999999999999999999999999999999999999999999999999999999999
Q ss_pred ecCCcC
Q psy16244 80 NKFTVW 85 (86)
Q Consensus 80 ns~d~~ 85 (86)
|++++.
T Consensus 120 N~~~~~ 125 (459)
T TIGR00860 120 NEKDAR 125 (459)
T ss_pred cCcccc
Confidence 999864
|
selective while glycine receptors are anion selective). |
| >KOG3646|consensus | Back alignment and domain information |
|---|
| >KOG3645|consensus | Back alignment and domain information |
|---|
| >PF02931 Neur_chan_LBD: Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature; InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ] | Back alignment and domain information |
|---|
| >KOG3643|consensus | Back alignment and domain information |
|---|
| >KOG3642|consensus | Back alignment and domain information |
|---|
| >KOG3644|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 86 | ||||
| 2qc1_B | 212 | Crystal Structure Of The Extracellular Domain Of Th | 2e-14 | ||
| 4aq5_A | 461 | Gating Movement In Acetylcholine Receptor Analysed | 8e-12 | ||
| 2bg9_A | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 1e-11 | ||
| 4aq5_B | 493 | Gating Movement In Acetylcholine Receptor Analysed | 3e-11 | ||
| 2bg9_B | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 4e-11 | ||
| 2bg9_E | 370 | Refined Structure Of The Nicotinic Acetylcholine Re | 1e-10 | ||
| 4aq5_E | 488 | Gating Movement In Acetylcholine Receptor Analysed | 3e-10 | ||
| 2bg9_C | 369 | Refined Structure Of The Nicotinic Acetylcholine Re | 1e-07 | ||
| 4aq5_C | 522 | Gating Movement In Acetylcholine Receptor Analysed | 1e-07 | ||
| 3sq6_A | 204 | Crystal Structures Of The Ligand Binding Domain Of | 5e-07 | ||
| 4afg_A | 230 | Capitella Teleta Achbp In Complex With Varenicline | 1e-04 | ||
| 3sio_A | 230 | Ac-Achbp Ligand Binding Domain (Not Including Beta | 5e-04 | ||
| 3sh1_A | 230 | Ac-Achbp Ligand Binding Domain Mutated To Human Alp | 5e-04 |
| >pdb|2QC1|B Chain B, Crystal Structure Of The Extracellular Domain Of The Nicotinic Acetylcholine Receptor 1 Subunit Bound To Alpha-Bungarotoxin At 1.9 A Resolution Length = 212 | Back alignment and structure |
|
| >pdb|4AQ5|A Chain A, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 461 | Back alignment and structure |
| >pdb|2BG9|A Chain A, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution. Length = 370 | Back alignment and structure |
| >pdb|4AQ5|B Chain B, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 493 | Back alignment and structure |
| >pdb|2BG9|B Chain B, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 | Back alignment and structure |
| >pdb|2BG9|E Chain E, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 370 | Back alignment and structure |
| >pdb|4AQ5|E Chain E, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 488 | Back alignment and structure |
| >pdb|2BG9|C Chain C, Refined Structure Of The Nicotinic Acetylcholine Receptor At 4a Resolution Length = 369 | Back alignment and structure |
| >pdb|4AQ5|C Chain C, Gating Movement In Acetylcholine Receptor Analysed By Time- Resolved Electron Cryo-Microscopy (Closed Class) Length = 522 | Back alignment and structure |
| >pdb|3SQ6|A Chain A, Crystal Structures Of The Ligand Binding Domain Of A Pentameric Alpha7 Nicotinic Receptor Chimera With Its Agonist Epibatidine Length = 204 | Back alignment and structure |
| >pdb|4AFG|A Chain A, Capitella Teleta Achbp In Complex With Varenicline Length = 230 | Back alignment and structure |
| >pdb|3SIO|A Chain A, Ac-Achbp Ligand Binding Domain (Not Including Beta 9-10 Linker) Mutated To Human Alpha-7 Nachr Length = 230 | Back alignment and structure |
| >pdb|3SH1|A Chain A, Ac-Achbp Ligand Binding Domain Mutated To Human Alpha-7 Nachr Length = 230 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 86 | |||
| 2qc1_B | 212 | Acetylcholine receptor subunit alpha; nicotinic ac | 6e-25 | |
| 2bg9_B | 370 | Acetylcholine receptor protein, beta chain; ION ch | 5e-24 | |
| 3sq6_A | 204 | ACHBP, neuronal acetylcholine receptor subunit alp | 7e-24 | |
| 2bg9_C | 369 | Acetylcholine receptor protein, delta chain; ION c | 9e-24 | |
| 2bg9_A | 370 | Acetylcholine receptor protein, alpha chain; ION c | 2e-23 | |
| 2wn9_A | 228 | Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl | 2e-23 | |
| 2bg9_E | 370 | Acetylcholine receptor protein, gamma chain; ION c | 6e-23 | |
| 1uw6_A | 211 | Acetylcholine-binding protein; pentamer, IGG fold, | 2e-21 | |
| 2bj0_A | 203 | Acetylcholine-binding protein; 3D-structure, glyco | 2e-21 | |
| 4aq5_E | 488 | Acetylcholine receptor gamma subunit; membrane pro | 1e-20 | |
| 4aq5_C | 522 | Acetylcholine receptor delta subunit; membrane pro | 2e-20 | |
| 3tlw_A | 321 | GLR4197 protein, GLIC; Cys-loop receptor family, m | 3e-20 | |
| 4afh_A | 230 | ACHBP; acetylcholine-binding protein, nicotinic re | 4e-20 | |
| 4aq5_B | 493 | Acetylcholine receptor beta subunit; membrane prot | 6e-20 | |
| 4aq5_A | 461 | Acetylcholine receptor subunit alpha; membrane pro | 7e-19 | |
| 3igq_A | 201 | GLR4197 protein; plgic Cys-loop, membrane protein, | 6e-17 | |
| 3rhw_A | 347 | Avermectin-sensitive glutamate-gated chloride CHA | 9e-16 | |
| 3rqw_A | 322 | ELIC pentameric ligand gated ION channel from ERW | 1e-15 |
| >2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B Length = 212 | Back alignment and structure |
|---|
Score = 91.3 bits (227), Expect = 6e-25
Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 1/70 (1%)
Query: 12 NHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDH 70
+ E + V + L + NQI+TTN+ ++Q W DY L+W P +YGGV +H+PS+
Sbjct: 26 HREIVQVTVGLQLIQLINVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEK 85
Query: 71 IWRPDIVLYN 80
IWRPD+VLYN
Sbjct: 86 IWRPDVVLYN 95
|
| >2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} PDB: 3sq9_A* Length = 204 | Back alignment and structure |
|---|
| >2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 369 | Back alignment and structure |
|---|
| >2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... Length = 228 | Back alignment and structure |
|---|
| >2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} Length = 370 | Back alignment and structure |
|---|
| >1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* Length = 211 | Back alignment and structure |
|---|
| >2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} Length = 203 | Back alignment and structure |
|---|
| >4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E Length = 488 | Back alignment and structure |
|---|
| >4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C Length = 522 | Back alignment and structure |
|---|
| >3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 3ehz_A 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... Length = 321 | Back alignment and structure |
|---|
| >4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* Length = 230 | Back alignment and structure |
|---|
| >4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B Length = 493 | Back alignment and structure |
|---|
| >4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A Length = 461 | Back alignment and structure |
|---|
| >3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} Length = 201 | Back alignment and structure |
|---|
| >3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* Length = 347 | Back alignment and structure |
|---|
| >3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A Length = 322 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| 4aod_A | 205 | Acetylcholine-binding protein type 1; ligand gated | 99.95 | |
| 4aoe_A | 205 | Acetylcholine-binding protein type 2; ligand gated | 99.95 | |
| 3sq6_A | 204 | ACHBP, neuronal acetylcholine receptor subunit alp | 99.95 | |
| 2qc1_B | 212 | Acetylcholine receptor subunit alpha; nicotinic ac | 99.95 | |
| 4afh_A | 230 | ACHBP; acetylcholine-binding protein, nicotinic re | 99.95 | |
| 1uw6_A | 211 | Acetylcholine-binding protein; pentamer, IGG fold, | 99.94 | |
| 2bg9_C | 369 | Acetylcholine receptor protein, delta chain; ION c | 99.94 | |
| 2wn9_A | 228 | Soluble acetylcholine receptor; 4-0H-DMXBA, acetyl | 99.93 | |
| 2bg9_B | 370 | Acetylcholine receptor protein, beta chain; ION ch | 99.93 | |
| 4aq5_C | 522 | Acetylcholine receptor delta subunit; membrane pro | 99.93 | |
| 3rhw_A | 347 | Avermectin-sensitive glutamate-gated chloride CHA | 99.93 | |
| 2bg9_E | 370 | Acetylcholine receptor protein, gamma chain; ION c | 99.93 | |
| 4aq5_A | 461 | Acetylcholine receptor subunit alpha; membrane pro | 99.93 | |
| 4aq5_E | 488 | Acetylcholine receptor gamma subunit; membrane pro | 99.93 | |
| 2bg9_A | 370 | Acetylcholine receptor protein, alpha chain; ION c | 99.93 | |
| 4aq5_B | 493 | Acetylcholine receptor beta subunit; membrane prot | 99.92 | |
| 2bj0_A | 203 | Acetylcholine-binding protein; 3D-structure, glyco | 99.92 | |
| 3tlw_A | 321 | GLR4197 protein, GLIC; Cys-loop receptor family, m | 99.91 | |
| 3igq_A | 201 | GLR4197 protein; plgic Cys-loop, membrane protein, | 99.9 | |
| 3rqw_A | 322 | ELIC pentameric ligand gated ION channel from ERW | 99.73 |
| >4aod_A Acetylcholine-binding protein type 1; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholine receptor; 6.00A {Biomphalaria glabrata} | Back alignment and structure |
|---|
Probab=99.95 E-value=3e-29 Score=163.10 Aligned_cols=83 Identities=22% Similarity=0.482 Sum_probs=79.5
Q ss_pred CCCCCCCCCCCCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCEEEE
Q psy16244 1 MGQNRVLKLLQNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLY 79 (86)
Q Consensus 1 ~~Yd~~~rP~~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi~i~ 79 (86)
.+||+.+||+.+++|+.|.++ +|.+|++|+|++|++++++|++|.|+|+||+|+| +|+||+.+.++.++||+||++++
T Consensus 14 ~~Y~~~~rPv~~~~pv~V~~~l~l~~i~~vde~~q~~t~~~wl~~~W~D~rL~W~~-~~~~i~~i~v~~~~IW~PDi~l~ 92 (205)
T 4aod_A 14 SRCSPLNIPIEDDQPVKVSFEYSLQKIFRADVENDEVDIGLWTTLVWKDRCLNWFN-EFTSFKELTVPIAEIWTPDIFIF 92 (205)
T ss_dssp HTTCSSSCCCCSSCCEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEECCCCCCSC-CCSCCCEEEEEGGGSCCCCEEET
T ss_pred hcCCCcCCCCCCCccEEEEEEEEeeeeeeecccCCEEEEEEEEEEEEECCceeeCC-cCCCccEeeccHHhcCcCCEEEE
Confidence 379999999998999999999 9999999999999999999999999999999997 79999999999999999999999
Q ss_pred ecCCc
Q psy16244 80 NKFTV 84 (86)
Q Consensus 80 ns~d~ 84 (86)
|++++
T Consensus 93 N~~~~ 97 (205)
T 4aod_A 93 DSVGA 97 (205)
T ss_dssp TBSSC
T ss_pred ccccc
Confidence 99864
|
| >4aoe_A Acetylcholine-binding protein type 2; ligand gated ION channel, LGI Cys-loop receptor, ACHBP, ACHR, acetylcholin receptor; 5.80A {Biomphalaria glabrata} | Back alignment and structure |
|---|
| >3sq6_A ACHBP, neuronal acetylcholine receptor subunit alpha-7, acetylcholine-binding protein; nicotinic receptor; HET: EPJ NAG; 2.80A {Homo sapiens} SCOP: b.96.1.1 PDB: 3sq9_A* | Back alignment and structure |
|---|
| >2qc1_B Acetylcholine receptor subunit alpha; nicotinic acetylcholine receptor, glycosylated protein, beta sandwich, Cys-loop, buried hydrophilic residues; HET: NAG MAN; 1.94A {Mus musculus} PDB: 1l4w_B 1ljz_B | Back alignment and structure |
|---|
| >4afh_A ACHBP; acetylcholine-binding protein, nicotinic receptor, ION chann; HET: NAG BMA MAN L0B; 1.88A {Capitella teleta} PDB: 4afg_A* 4b5d_A* | Back alignment and structure |
|---|
| >1uw6_A Acetylcholine-binding protein; pentamer, IGG fold, nicotine, glycoprotein; HET: NCT; 2.2A {Lymnaea stagnalis} SCOP: b.96.1.1 PDB: 1i9b_A* 1ux2_A* 3u8l_A* 1yi5_A 1uv6_A* 3u8k_A* 3u8j_B* 3u8m_A* 3u8n_A* 2zju_A* 2zjv_A* | Back alignment and structure |
|---|
| >2bg9_C Acetylcholine receptor protein, delta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >2wn9_A Soluble acetylcholine receptor; 4-0H-DMXBA, acetylcholine binding protein; HET: ZY5 NAG BMA MAN; 1.75A {Aplysia californica} PDB: 2wnj_A* 2wzy_A* 2x00_A* 3peo_A* 2pgz_A* 2ph9_A* 4dbm_A* 3c84_A* 2byq_A* 2byr_A* 2bys_A* 2wnc_A* 2wnl_A* 3c79_A* 2byn_A* 3pmz_A* 2x00_D* 2xnv_A* 2xnt_A* 2xnu_A* ... | Back alignment and structure |
|---|
| >2bg9_B Acetylcholine receptor protein, beta chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >4aq5_C Acetylcholine receptor delta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_C | Back alignment and structure |
|---|
| >3rhw_A Avermectin-sensitive glutamate-gated chloride CHA alpha; membrane protein, transport protein, Cys-loop receptor, LIGA ION channel, neurotransmitter receptor; HET: NAG IVM LMT UND; 3.26A {Caenorhabditis elegans} PDB: 3ri5_A* 3ria_A* 3rif_A* | Back alignment and structure |
|---|
| >2bg9_E Acetylcholine receptor protein, gamma chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >4aq5_A Acetylcholine receptor subunit alpha; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_A | Back alignment and structure |
|---|
| >4aq5_E Acetylcholine receptor gamma subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_E | Back alignment and structure |
|---|
| >2bg9_A Acetylcholine receptor protein, alpha chain; ION channel/receptor, ION channel, electron microscopy, ION transport, postsynaptic membrane; 4.00A {Torpedo marmorata} | Back alignment and structure |
|---|
| >4aq5_B Acetylcholine receptor beta subunit; membrane protein, freeze-trapping, asymmetric gating, allost mechanism; 6.20A {Torpedo marmorata} PDB: 4aq9_B | Back alignment and structure |
|---|
| >2bj0_A Acetylcholine-binding protein; 3D-structure, glycoprotein, glycprotein, IGG fold, immunoglobulin domain, pentamer, signal; HET: CXS; 2.0A {Bulinus truncatus} | Back alignment and structure |
|---|
| >3tlw_A GLR4197 protein, GLIC; Cys-loop receptor family, membrane protein, transport protei; HET: LMT; 2.60A {Gloeobacter violaceus} PDB: 3uu4_A* 3uub_A* 3tlv_A* 3uu6_A* 3uu5_A* 3uu3_A* 3tlu_A* 3uu8_A* 3tls_A* 3tlt_A* 3p4w_A* 3p50_A* 3eam_A* 4f8h_A* 2xq4_A 2xq5_A 2xq6_A 2xq3_A 2xq8_A 2xqa_A ... | Back alignment and structure |
|---|
| >3igq_A GLR4197 protein; plgic Cys-loop, membrane protein, transport protein; 2.30A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >3rqw_A ELIC pentameric ligand gated ION channel from ERW chrysanthemi; membrane, transport protein; HET: ACH MES; 2.91A {Dickeya dadantii} PDB: 2yn6_A* 3rqu_A* 3uq4_A 3uq5_A 3uq7_A 2vl0_A 2yks_A 4a97_A* 4a96_A* 2yoe_A* 4a98_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 86 | ||||
| d1uw6a_ | 208 | b.96.1.1 (A:) Acetylcholine binding protein (ACHBP | 4e-11 |
| >d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} Length = 208 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Nicotinic receptor ligand binding domain-like superfamily: Nicotinic receptor ligand binding domain-like family: Nicotinic receptor ligand binding domain-like domain: Acetylcholine binding protein (ACHBP) species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]
Score = 54.0 bits (129), Expect = 4e-11
Identities = 13/51 (25%), Positives = 19/51 (37%), Gaps = 2/51 (3%)
Query: 30 NLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYN 80
N + W + +W D L W + VP +W PD+ YN
Sbjct: 43 NEITNEVDVVFWQQTTWSDRTLAWNSSHSPD--QVSVPISSLWVPDLAAYN 91
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 86 | |||
| d1uw6a_ | 208 | Acetylcholine binding protein (ACHBP) {Great pond | 99.89 |
| >d1uw6a_ b.96.1.1 (A:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Nicotinic receptor ligand binding domain-like superfamily: Nicotinic receptor ligand binding domain-like family: Nicotinic receptor ligand binding domain-like domain: Acetylcholine binding protein (ACHBP) species: Great pond snail (Lymnaea stagnalis) [TaxId: 6523]
Probab=99.89 E-value=2e-24 Score=138.91 Aligned_cols=81 Identities=19% Similarity=0.389 Sum_probs=72.2
Q ss_pred CCCCCCCCC----CCCCeEEEEEc-chhhhhheeeeeeEEeeecEEEEEEEeCceeecCCCCCCeeEEeeCCCCcccCCE
Q psy16244 2 GQNRVLKLL----QNHETLLVELR-TATLLSRHNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDI 76 (86)
Q Consensus 2 ~Yd~~~rP~----~~~~~~~V~~~-~l~~i~~v~e~~~~~~~~~~~~~~W~D~rL~W~p~~~~~i~~~~~~~~~iW~Pdi 76 (86)
+|+|..||. .++.|+.|.++ .|.+|++++|++|++++.+|++|.|+|+||+|+|++|+++ +.++.++||+|||
T Consensus 10 ~y~~~~rP~~~P~~~~~pv~V~~~l~l~~i~~vde~~q~~~~~~~~~~~W~D~rL~Wnp~~~~~~--~~v~~~~iW~PDi 87 (208)
T d1uw6a_ 10 NIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQ--VSVPISSLWVPDL 87 (208)
T ss_dssp HHHHHCCTTSCCCCTTCCEEEEEEEEEEEEEEEETTTTEEEEEEEEEEEEECGGGCCCCTTSCSE--EEEEGGGSCCCCE
T ss_pred ccccccCCCcCCcCCCCCEEEEEEEEEEeEeeecccCCEEEEEEEEEEEEECCccccccccCCce--eccchhccccccE
Confidence 567777775 33789999999 9999999999999999999999999999999999999875 5677899999999
Q ss_pred EEEecCCc
Q psy16244 77 VLYNKFTV 84 (86)
Q Consensus 77 ~i~ns~d~ 84 (86)
+++|+++.
T Consensus 88 ~l~n~~~~ 95 (208)
T d1uw6a_ 88 AAYNAISK 95 (208)
T ss_dssp EETTBCSC
T ss_pred EEEEEccc
Confidence 99998764
|