Psyllid ID: psy1628


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
ccccccccccccccccccccEEEEcccccHHHHcccccccccEEEEEccccccccEEEccHHHHHHHHHHHHHHccEEEEcccccccccccccHHHHHHccccccccEEEEEcc
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHcccccccccEcccccHHHHHHHHHHHcccEEEEEEEEcccccccccEEHEEcccccccccEEEEccc
VHVPVLTECIIGRYIILLAVVHLFFERIFLsaslypflflypcaffaeslqscggqiippanYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFqlqgddiipdiVTVVWN
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFqlqgddiipdIVTVVWN
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
**VPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVW*
*HVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VHVPVLTECIIGRYIILLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDDIIPDIVTVVWN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query114 2.2.26 [Sep-21-2011]
Q7SY54 492 Ethanolamine-phosphate ph yes N/A 0.596 0.138 0.720 1e-26
Q5E9S4 497 Ethanolamine-phosphate ph yes N/A 0.596 0.136 0.691 6e-25
Q6DEB1 509 Ethanolamine-phosphate ph N/A N/A 0.596 0.133 0.705 6e-25
Q9VU95 494 Alanine--glyoxylate amino yes N/A 0.578 0.133 0.720 7e-25
Q8TBG4 499 Ethanolamine-phosphate ph no N/A 0.596 0.136 0.676 2e-24
Q8BWU8 499 Ethanolamine-phosphate ph yes N/A 0.596 0.136 0.661 4e-24
Q8IUZ5 450 5-phosphohydroxy-L-lysine no N/A 0.605 0.153 0.724 6e-24
Q8R1K4 467 5-phosphohydroxy-L-lysine no N/A 0.596 0.145 0.661 2e-23
P91408 467 Alanine--glyoxylate amino yes N/A 0.596 0.145 0.588 1e-20
Q940M2 476 Alanine--glyoxylate amino yes N/A 0.578 0.138 0.558 1e-17
>sp|Q7SY54|AT2L1_DANRE Ethanolamine-phosphate phospho-lyase OS=Danio rerio GN=agxt2l1 PE=2 SV=1 Back     alignment and function desciption
 Score =  118 bits (295), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 59/68 (86%)

Query: 44  AFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDD 103
           AF AESLQSCGGQ+IPP  Y ++V +HVR AGG+ +ADEVQVGFGRVGTH+W FQLQG+D
Sbjct: 211 AFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGTHFWGFQLQGED 270

Query: 104 IIPDIVTV 111
            +PDIVT+
Sbjct: 271 FVPDIVTM 278





Danio rerio (taxid: 7955)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: -
>sp|Q5E9S4|AT2L1_BOVIN Ethanolamine-phosphate phospho-lyase OS=Bos taurus GN=AGXT2L1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DEB1|AT2L1_XENLA Ethanolamine-phosphate phospho-lyase OS=Xenopus laevis GN=agxt2l1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VU95|AGT2L_DROME Alanine--glyoxylate aminotransferase 2-like OS=Drosophila melanogaster GN=CG8745 PE=2 SV=2 Back     alignment and function description
>sp|Q8TBG4|AT2L1_HUMAN Ethanolamine-phosphate phospho-lyase OS=Homo sapiens GN=AGXT2L1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BWU8|AT2L1_MOUSE Ethanolamine-phosphate phospho-lyase OS=Mus musculus GN=Agxt2l1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IUZ5|AT2L2_HUMAN 5-phosphohydroxy-L-lysine phospho-lyase OS=Homo sapiens GN=AGXT2L2 PE=1 SV=1 Back     alignment and function description
>sp|Q8R1K4|AT2L2_MOUSE 5-phosphohydroxy-L-lysine phospho-lyase OS=Mus musculus GN=Agxt2l2 PE=2 SV=1 Back     alignment and function description
>sp|P91408|AGT2L_CAEEL Alanine--glyoxylate aminotransferase 2-like OS=Caenorhabditis elegans GN=T01B11.2 PE=2 SV=1 Back     alignment and function description
>sp|Q940M2|AGT21_ARATH Alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial OS=Arabidopsis thaliana GN=AGT2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
242012375 440 alanine-glyoxylate aminotransferase, put 0.605 0.156 0.840 5e-32
383855028 484 PREDICTED: alanine--glyoxylate aminotran 0.605 0.142 0.797 3e-28
321459394 446 hypothetical protein DAPPUDRAFT_202337 [ 0.587 0.150 0.805 4e-28
443733377 474 hypothetical protein CAPTEDRAFT_188970 [ 0.596 0.143 0.764 6e-28
350419709 485 PREDICTED: alanine--glyoxylate aminotran 0.605 0.142 0.797 1e-27
340713065 485 PREDICTED: alanine--glyoxylate aminotran 0.605 0.142 0.782 1e-27
307174361 483 Alanine--glyoxylate aminotransferase 2-l 0.605 0.142 0.782 1e-27
345488761 485 PREDICTED: alanine--glyoxylate aminotran 0.596 0.140 0.794 3e-27
328705297 447 PREDICTED: alanine--glyoxylate aminotran 0.605 0.154 0.753 5e-27
328705295 379 PREDICTED: alanine--glyoxylate aminotran 0.605 0.182 0.753 5e-27
>gi|242012375|ref|XP_002426908.1| alanine-glyoxylate aminotransferase, putative [Pediculus humanus corporis] gi|212511137|gb|EEB14170.1| alanine-glyoxylate aminotransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  141 bits (356), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 58/69 (84%), Positives = 63/69 (91%)

Query: 43  CAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGD 102
           CAF  ESLQSCGGQIIPP NYLR VYKHV+ AGGVC+ADEVQVGFGRVG+HWW FQLQGD
Sbjct: 210 CAFIGESLQSCGGQIIPPKNYLRNVYKHVKEAGGVCIADEVQVGFGRVGSHWWGFQLQGD 269

Query: 103 DIIPDIVTV 111
           D+IPDIVT+
Sbjct: 270 DVIPDIVTL 278




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383855028|ref|XP_003703021.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|321459394|gb|EFX70448.1| hypothetical protein DAPPUDRAFT_202337 [Daphnia pulex] Back     alignment and taxonomy information
>gi|443733377|gb|ELU17763.1| hypothetical protein CAPTEDRAFT_188970 [Capitella teleta] Back     alignment and taxonomy information
>gi|350419709|ref|XP_003492276.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713065|ref|XP_003395072.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307174361|gb|EFN64903.1| Alanine--glyoxylate aminotransferase 2-like [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345488761|ref|XP_003425979.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like 1-like isoform 2 [Nasonia vitripennis] gi|345488763|ref|XP_001605716.2| PREDICTED: alanine--glyoxylate aminotransferase 2-like 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328705297|ref|XP_001949442.2| PREDICTED: alanine--glyoxylate aminotransferase 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328705295|ref|XP_003242758.1| PREDICTED: alanine--glyoxylate aminotransferase 2-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query114
ZFIN|ZDB-GENE-040426-1133 492 agxt2l1 "alanine-glyoxylate am 0.596 0.138 0.720 6.8e-24
UNIPROTKB|E1B8R9 450 AGXT2L2 "Uncharacterized prote 0.596 0.151 0.75 2.7e-23
UNIPROTKB|F6XN94 397 AGXT2L1 "Uncharacterized prote 0.596 0.171 0.691 3.9e-23
UNIPROTKB|E1C8Q2 501 AGXT2L1 "Uncharacterized prote 0.596 0.135 0.705 4.4e-23
UNIPROTKB|Q8IUZ5 450 AGXT2L2 "5-phosphohydroxy-L-ly 0.596 0.151 0.735 4.5e-23
UNIPROTKB|J9NYE8 456 AGXT2L1 "Uncharacterized prote 0.596 0.149 0.691 1.1e-22
UNIPROTKB|H9L0I3355 H9L0I3 "Uncharacterized protei 0.596 0.191 0.720 1.3e-22
UNIPROTKB|H9L0I4362 H9L0I4 "Uncharacterized protei 0.596 0.187 0.720 1.3e-22
UNIPROTKB|E2R2V9 494 AGXT2L1 "Uncharacterized prote 0.596 0.137 0.691 1.5e-22
UNIPROTKB|F1S421 450 AGXT2L2 "Uncharacterized prote 0.596 0.151 0.705 1.7e-22
ZFIN|ZDB-GENE-040426-1133 agxt2l1 "alanine-glyoxylate aminotransferase 2-like 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 279 (103.3 bits), Expect = 6.8e-24, P = 6.8e-24
 Identities = 49/68 (72%), Positives = 59/68 (86%)

Query:    44 AFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGDD 103
             AF AESLQSCGGQ+IPP  Y ++V +HVR AGG+ +ADEVQVGFGRVGTH+W FQLQG+D
Sbjct:   211 AFIAESLQSCGGQVIPPMGYFQKVAQHVRNAGGIFIADEVQVGFGRVGTHFWGFQLQGED 270

Query:   104 IIPDIVTV 111
              +PDIVT+
Sbjct:   271 FVPDIVTM 278




GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0035162 "embryonic hemopoiesis" evidence=IMP
GO:0050459 "ethanolamine-phosphate phospho-lyase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0016829 "lyase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
UNIPROTKB|E1B8R9 AGXT2L2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6XN94 AGXT2L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Q2 AGXT2L1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IUZ5 AGXT2L2 "5-phosphohydroxy-L-lysine phospho-lyase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYE8 AGXT2L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0I3 H9L0I3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0I4 H9L0I4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2V9 AGXT2L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S421 AGXT2L2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q940M2AGT21_ARATH2, ., 6, ., 1, ., 4, 40.55880.57890.1386yesN/A
Q5E9S4AT2L1_BOVIN2, ., 6, ., 1, ., -0.69110.59640.1368yesN/A
Q7SY54AT2L1_DANRE2, ., 6, ., 1, ., -0.72050.59640.1382yesN/A
Q9VU95AGT2L_DROME2, ., 6, ., 1, ., -0.72050.57890.1336yesN/A
Q8BWU8AT2L1_MOUSE2, ., 6, ., 1, ., -0.66170.59640.1362yesN/A
P91408AGT2L_CAEEL2, ., 6, ., 1, ., -0.58820.59640.1456yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
PRK06148 1013 PRK06148, PRK06148, hypothetical protein; Provisio 4e-38
COG0160 447 COG0160, GabT, 4-aminobutyrate aminotransferase an 5e-25
PRK06149 972 PRK06149, PRK06149, hypothetical protein; Provisio 9e-25
cd00610 413 cd00610, OAT_like, Acetyl ornithine aminotransfera 3e-23
COG4992 404 COG4992, ArgD, Ornithine/acetylornithine aminotran 6e-14
PRK02627 396 PRK02627, PRK02627, acetylornithine aminotransfera 6e-13
PRK07480 456 PRK07480, PRK07480, putative aminotransferase; Val 8e-13
PRK08360 443 PRK08360, PRK08360, 4-aminobutyrate aminotransfera 1e-12
PRK03244 398 PRK03244, argD, acetylornithine aminotransferase; 1e-12
PRK05769 441 PRK05769, PRK05769, 4-aminobutyrate aminotransfera 2e-12
PRK07036 466 PRK07036, PRK07036, hypothetical protein; Provisio 5e-12
COG0161 449 COG0161, BioA, Adenosylmethionine-8-amino-7-oxonon 7e-12
pfam00202338 pfam00202, Aminotran_3, Aminotransferase class-III 1e-11
PRK05965 459 PRK05965, PRK05965, hypothetical protein; Provisio 3e-11
PRK06105 460 PRK06105, PRK06105, aminotransferase; Provisional 2e-10
PRK11522 459 PRK11522, PRK11522, putrescine--2-oxoglutarate ami 6e-10
PRK06918 451 PRK06918, PRK06918, 4-aminobutyrate aminotransfera 7e-10
TIGR01885 401 TIGR01885, Orn_aminotrans, ornithine aminotransfer 4e-09
PRK07678 451 PRK07678, PRK07678, aminotransferase; Validated 4e-09
PRK06938 464 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarat 4e-09
PTZ00125 400 PTZ00125, PTZ00125, ornithine aminotransferase-lik 6e-09
PRK08593 445 PRK08593, PRK08593, 4-aminobutyrate aminotransfera 6e-09
TIGR00709 442 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminase 1e-08
PRK06058 443 PRK06058, PRK06058, 4-aminobutyrate aminotransfera 1e-08
PRK04073 396 PRK04073, rocD, ornithine--oxo-acid transaminase; 1e-08
PRK08117 433 PRK08117, PRK08117, 4-aminobutyrate aminotransfera 4e-08
PRK05639 457 PRK05639, PRK05639, 4-aminobutyrate aminotransfera 4e-08
PLN02760 504 PLN02760, PLN02760, 4-aminobutyrate:pyruvate trans 5e-08
PLN02624 474 PLN02624, PLN02624, ornithine-delta-aminotransfera 5e-08
TIGR00508 417 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxon 6e-08
TIGR00700 420 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransf 7e-08
PRK06062 451 PRK06062, PRK06062, hypothetical protein; Provisio 8e-08
PRK05964 423 PRK05964, PRK05964, adenosylmethionine--8-amino-7- 9e-08
PRK02936 377 PRK02936, argD, acetylornithine aminotransferase; 1e-07
TIGR00707 379 TIGR00707, argD, transaminase, acetylornithine/suc 1e-07
PRK07481 449 PRK07481, PRK07481, hypothetical protein; Provisio 1e-07
PRK12403 460 PRK12403, PRK12403, putative aminotransferase; Pro 1e-07
TIGR03372 442 TIGR03372, putres_am_tran, putrescine aminotransfe 1e-07
PRK06541 460 PRK06541, PRK06541, hypothetical protein; Provisio 2e-07
PLN00144 382 PLN00144, PLN00144, acetylornithine transaminase 3e-07
PRK06931 459 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarat 3e-07
PRK06916 460 PRK06916, PRK06916, adenosylmethionine--8-amino-7- 3e-07
PRK00854 401 PRK00854, rocD, ornithine--oxo-acid transaminase; 4e-07
PRK13360 442 PRK13360, PRK13360, omega amino acid--pyruvate tra 3e-06
PRK07482 461 PRK07482, PRK07482, hypothetical protein; Provisio 4e-06
TIGR03246 397 TIGR03246, arg_catab_astC, succinylornithine trans 7e-06
PRK06082 459 PRK06082, PRK06082, 4-aminobutyrate aminotransfera 1e-05
PRK08297 443 PRK08297, PRK08297, L-lysine aminotransferase; Pro 2e-05
PRK06917 447 PRK06917, PRK06917, hypothetical protein; Provisio 2e-05
PRK07495 425 PRK07495, PRK07495, 4-aminobutyrate aminotransfera 2e-05
PRK04612 408 PRK04612, argD, acetylornithine transaminase prote 3e-05
PRK05093 403 PRK05093, argD, bifunctional N-succinyldiaminopime 6e-05
PRK09264 425 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarat 7e-05
PRK08742 472 PRK08742, PRK08742, adenosylmethionine--8-amino-7- 8e-05
TIGR02407 412 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglu 1e-04
PRK03715 395 PRK03715, argD, acetylornithine transaminase prote 3e-04
PRK09221 445 PRK09221, PRK09221, beta alanine--pyruvate transam 4e-04
PRK01278 389 PRK01278, argD, acetylornithine transaminase prote 4e-04
PRK06777 421 PRK06777, PRK06777, 4-aminobutyrate aminotransfera 4e-04
PRK07483 443 PRK07483, PRK07483, hypothetical protein; Provisio 0.002
TIGR03251 431 TIGR03251, LAT_fam, L-lysine 6-transaminase 0.002
>gnl|CDD|180426 PRK06148, PRK06148, hypothetical protein; Provisional Back     alignment and domain information
 Score =  135 bits (341), Expect = 4e-38
 Identities = 48/69 (69%), Positives = 54/69 (78%), Gaps = 2/69 (2%)

Query: 42  PCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQG 101
           P  F AES+ S  GQI  P  YLREVY  VRAAGGVC+ADEVQVGFGRVG+HWWAF+ QG
Sbjct: 785 PAFFIAESIPSVAGQIFLPEGYLREVYAMVRAAGGVCIADEVQVGFGRVGSHWWAFETQG 844

Query: 102 DDIIPDIVT 110
             ++PDIVT
Sbjct: 845 --VVPDIVT 851


Length = 1013

>gnl|CDD|223238 COG0160, GabT, 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235716 PRK06149, PRK06149, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|99735 cd00610, OAT_like, Acetyl ornithine aminotransferase family Back     alignment and domain information
>gnl|CDD|227325 COG4992, ArgD, Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235056 PRK02627, PRK02627, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180994 PRK07480, PRK07480, putative aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|181401 PRK08360, PRK08360, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235112 PRK03244, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235599 PRK05769, PRK05769, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235913 PRK07036, PRK07036, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223239 COG0161, BioA, Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|201078 pfam00202, Aminotran_3, Aminotransferase class-III Back     alignment and domain information
>gnl|CDD|180330 PRK05965, PRK05965, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180401 PRK06105, PRK06105, aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|183175 PRK11522, PRK11522, putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235885 PRK06918, PRK06918, 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|130940 TIGR01885, Orn_aminotrans, ornithine aminotransferase Back     alignment and domain information
>gnl|CDD|181078 PRK07678, PRK07678, aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|235892 PRK06938, PRK06938, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|240281 PTZ00125, PTZ00125, ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|181493 PRK08593, PRK08593, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|129792 TIGR00709, dat, 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>gnl|CDD|235685 PRK06058, PRK06058, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179736 PRK04073, rocD, ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>gnl|CDD|181234 PRK08117, PRK08117, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|168145 PRK05639, PRK05639, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215405 PLN02760, PLN02760, 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>gnl|CDD|215335 PLN02624, PLN02624, ornithine-delta-aminotransferase Back     alignment and domain information
>gnl|CDD|233000 TIGR00508, bioA, adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>gnl|CDD|129783 TIGR00700, GABAtrnsam, 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>gnl|CDD|235687 PRK06062, PRK06062, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235656 PRK05964, PRK05964, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179505 PRK02936, argD, acetylornithine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|233098 TIGR00707, argD, transaminase, acetylornithine/succinylornithine family Back     alignment and domain information
>gnl|CDD|168967 PRK07481, PRK07481, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|171472 PRK12403, PRK12403, putative aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|132415 TIGR03372, putres_am_tran, putrescine aminotransferase Back     alignment and domain information
>gnl|CDD|235823 PRK06541, PRK06541, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|177748 PLN00144, PLN00144, acetylornithine transaminase Back     alignment and domain information
>gnl|CDD|235889 PRK06931, PRK06931, diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|180746 PRK06916, PRK06916, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|234848 PRK00854, rocD, ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>gnl|CDD|183999 PRK13360, PRK13360, omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|236026 PRK07482, PRK07482, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132290 TIGR03246, arg_catab_astC, succinylornithine transaminase family Back     alignment and domain information
>gnl|CDD|180390 PRK06082, PRK06082, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236224 PRK08297, PRK08297, L-lysine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235884 PRK06917, PRK06917, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236032 PRK07495, PRK07495, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|179868 PRK04612, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|179933 PRK05093, argD, bifunctional N-succinyldiaminopimelate- aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>gnl|CDD|236437 PRK09264, PRK09264, diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>gnl|CDD|236336 PRK08742, PRK08742, adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|233853 TIGR02407, ectoine_ectB, diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>gnl|CDD|179636 PRK03715, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|181707 PRK09221, PRK09221, beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>gnl|CDD|179270 PRK01278, argD, acetylornithine transaminase protein; Provisional Back     alignment and domain information
>gnl|CDD|180690 PRK06777, PRK06777, 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|236027 PRK07483, PRK07483, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132295 TIGR03251, LAT_fam, L-lysine 6-transaminase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 114
COG0160 447 GabT 4-aminobutyrate aminotransferase and related 99.97
COG4992 404 ArgD Ornithine/acetylornithine aminotransferase [A 99.97
COG0161 449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 99.96
PRK06943 453 adenosylmethionine--8-amino-7-oxononanoate transam 99.96
PRK05965 459 hypothetical protein; Provisional 99.95
PRK08742 472 adenosylmethionine--8-amino-7-oxononanoate transam 99.95
PRK07482 461 hypothetical protein; Provisional 99.95
PRK06931 459 diaminobutyrate--2-oxoglutarate aminotransferase; 99.95
PRK06938 464 diaminobutyrate--2-oxoglutarate aminotransferase; 99.95
PRK07030 466 adenosylmethionine--8-amino-7-oxononanoate transam 99.95
PRK07678 451 aminotransferase; Validated 99.95
KOG1401|consensus 433 99.95
PRK07481 449 hypothetical protein; Provisional 99.95
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 99.94
PLN02760 504 4-aminobutyrate:pyruvate transaminase 99.94
PRK07483 443 hypothetical protein; Provisional 99.94
PRK07480 456 putative aminotransferase; Validated 99.94
PRK12403 460 putative aminotransferase; Provisional 99.94
PRK08297 443 L-lysine aminotransferase; Provisional 99.94
PRK06916 460 adenosylmethionine--8-amino-7-oxononanoate transam 99.94
PRK06105 460 aminotransferase; Provisional 99.94
PRK07036 466 hypothetical protein; Provisional 99.94
TIGR03372 442 putres_am_tran putrescine aminotransferase. Member 99.94
PRK06173 429 adenosylmethionine--8-amino-7-oxononanoate transam 99.94
PRK06917 447 hypothetical protein; Provisional 99.94
PRK06062 451 hypothetical protein; Provisional 99.94
PRK11522 459 putrescine--2-oxoglutarate aminotransferase; Provi 99.94
PLN02974 817 adenosylmethionine-8-amino-7-oxononanoate transami 99.93
TIGR00699 464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 99.93
PRK05639 457 4-aminobutyrate aminotransferase; Provisional 99.93
PRK06082 459 4-aminobutyrate aminotransferase; Provisional 99.93
TIGR02407 412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 99.93
TIGR00709 442 dat 2,4-diaminobutyrate 4-transaminases. This fami 99.93
TIGR03251 431 LAT_fam L-lysine 6-transaminase. Characterized mem 99.93
PRK13360 442 omega amino acid--pyruvate transaminase; Provision 99.92
PRK06058 443 4-aminobutyrate aminotransferase; Provisional 99.92
PRK05630 422 adenosylmethionine--8-amino-7-oxononanoate transam 99.92
PRK09264 425 diaminobutyrate--2-oxoglutarate aminotransferase; 99.92
PRK09221 445 beta alanine--pyruvate transaminase; Provisional 99.92
PRK06148 1013 hypothetical protein; Provisional 99.92
KOG1402|consensus 427 99.92
KOG1404|consensus 442 99.92
PRK07986 428 adenosylmethionine--8-amino-7-oxononanoate transam 99.91
PRK06541 460 hypothetical protein; Provisional 99.91
PRK08593 445 4-aminobutyrate aminotransferase; Provisional 99.91
PRK04013 364 argD acetylornithine/acetyl-lysine aminotransferas 99.91
PRK06149 972 hypothetical protein; Provisional 99.9
PRK12389 428 glutamate-1-semialdehyde aminotransferase; Provisi 99.9
PRK03715 395 argD acetylornithine transaminase protein; Provisi 99.9
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 99.9
TIGR00700 420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 99.9
PRK05964 423 adenosylmethionine--8-amino-7-oxononanoate transam 99.9
PLN02482 474 glutamate-1-semialdehyde 2,1-aminomutase 99.89
PRK06777 421 4-aminobutyrate aminotransferase; Provisional 99.89
COG0001 432 HemL Glutamate-1-semialdehyde aminotransferase [Co 99.89
TIGR00508 427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 99.89
PRK00615 433 glutamate-1-semialdehyde aminotransferase; Provisi 99.89
PRK09792 421 4-aminobutyrate transaminase; Provisional 99.89
PRK05769 441 4-aminobutyrate aminotransferase; Provisional 99.88
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 99.88
PRK07495 425 4-aminobutyrate aminotransferase; Provisional 99.88
PLN00144 382 acetylornithine transaminase 99.87
PLN02624 474 ornithine-delta-aminotransferase 99.87
PRK06918 451 4-aminobutyrate aminotransferase; Reviewed 99.87
PRK12381 406 bifunctional succinylornithine transaminase/acetyl 99.86
KOG1405|consensus 484 99.85
PRK08360 443 4-aminobutyrate aminotransferase; Provisional 99.85
PRK07046 453 aminotransferase; Validated 99.84
PRK04612 408 argD acetylornithine transaminase protein; Provisi 99.84
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 99.83
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 99.81
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 99.8
KOG1403|consensus 452 99.78
PRK03244 398 argD acetylornithine aminotransferase; Provisional 99.78
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 99.78
PRK06209 431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 99.77
PRK02936 377 argD acetylornithine aminotransferase; Provisional 99.77
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 99.77
PRK01278 389 argD acetylornithine transaminase protein; Provisi 99.77
PRK08088 425 4-aminobutyrate aminotransferase; Validated 99.76
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 99.74
PTZ00125 400 ornithine aminotransferase-like protein; Provision 99.73
PRK04260 375 acetylornithine aminotransferase; Provisional 99.71
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 99.68
PRK02627 396 acetylornithine aminotransferase; Provisional 99.68
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 99.37
PRK07505 402 hypothetical protein; Provisional 99.13
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 99.11
PLN02822 481 serine palmitoyltransferase 99.05
PRK09064 407 5-aminolevulinate synthase; Validated 99.0
PRK13393 406 5-aminolevulinate synthase; Provisional 98.9
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 98.8
PLN02955 476 8-amino-7-oxononanoate synthase 98.64
PRK07179 407 hypothetical protein; Provisional 98.59
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 98.49
PRK13392 410 5-aminolevulinate synthase; Provisional 98.41
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 98.37
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.32
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 98.0
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 97.88
cd00609 350 AAT_like Aspartate aminotransferase family. This f 97.88
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 97.8
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 97.79
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 97.74
PLN02721 353 threonine aldolase 97.64
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 97.63
PLN02483 489 serine palmitoyltransferase 97.6
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 97.48
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 97.01
TIGR01814 406 kynureninase kynureninase. This model describes ky 96.99
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 96.66
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 96.64
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 96.62
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 96.54
PRK07682 378 hypothetical protein; Validated 96.54
PRK06225 380 aspartate aminotransferase; Provisional 96.49
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 96.49
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 96.47
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 96.47
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 96.42
PRK08960 387 hypothetical protein; Provisional 96.4
KOG0259|consensus 447 96.28
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 96.28
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 96.23
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 96.21
PRK13520 371 L-tyrosine decarboxylase; Provisional 96.19
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 96.12
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 96.11
PRK07777 387 aminotransferase; Validated 95.96
PRK06108 382 aspartate aminotransferase; Provisional 95.95
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 95.94
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 95.88
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 95.88
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 95.8
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 95.77
PLN02651 364 cysteine desulfurase 95.77
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 95.77
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 95.72
PRK14012 404 cysteine desulfurase; Provisional 95.68
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 95.6
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 95.57
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 95.53
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 95.52
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 95.52
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 95.37
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 95.25
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 95.13
PRK07550 386 hypothetical protein; Provisional 95.08
PRK08574 385 cystathionine gamma-synthase; Provisional 94.97
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 94.94
PRK08175 395 aminotransferase; Validated 94.93
PRK07324 373 transaminase; Validated 94.92
PRK07309 391 aromatic amino acid aminotransferase; Validated 94.9
PRK08636 403 aspartate aminotransferase; Provisional 94.87
PRK05764 393 aspartate aminotransferase; Provisional 94.87
TIGR02617 467 tnaA_trp_ase tryptophanase, leader peptide-associa 94.84
PRK10874 401 cysteine sulfinate desulfinase; Provisional 94.82
PRK05939 397 hypothetical protein; Provisional 94.75
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 94.74
PRK09257 396 aromatic amino acid aminotransferase; Provisional 94.74
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 94.73
PRK07568 397 aspartate aminotransferase; Provisional 94.71
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 94.68
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 94.53
PLN02231 534 alanine transaminase 94.47
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 94.47
PLN02656 409 tyrosine transaminase 94.43
PLN00175 413 aminotransferase family protein; Provisional 94.42
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 94.34
PRK07337 388 aminotransferase; Validated 94.3
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 94.3
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 94.28
PTZ00376 404 aspartate aminotransferase; Provisional 94.26
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 94.25
PRK06855 433 aminotransferase; Validated 94.24
PLN02187 462 rooty/superroot1 94.19
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 94.19
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 94.17
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 94.12
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 94.04
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 94.03
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 93.98
PRK06207 405 aspartate aminotransferase; Provisional 93.96
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 93.95
PTZ00094 452 serine hydroxymethyltransferase; Provisional 93.88
PRK02948 381 cysteine desulfurase; Provisional 93.86
PRK08361 391 aspartate aminotransferase; Provisional 93.86
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 93.8
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 93.75
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 93.67
PLN02242 418 methionine gamma-lyase 93.61
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 93.54
TIGR01141 346 hisC histidinol-phosphate aminotransferase. Histid 93.51
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 93.47
PLN02397 423 aspartate transaminase 93.35
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 93.26
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 93.26
TIGR02618 450 tyr_phenol_ly tyrosine phenol-lyase. This model de 93.26
PRK05967 395 cystathionine beta-lyase; Provisional 93.22
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 93.2
PRK08861 388 cystathionine gamma-synthase; Provisional 93.18
PRK09028 394 cystathionine beta-lyase; Provisional 93.16
PRK13237 460 tyrosine phenol-lyase; Provisional 93.12
PRK06348 384 aspartate aminotransferase; Provisional 93.11
PRK07681 399 aspartate aminotransferase; Provisional 93.08
PRK08056 356 threonine-phosphate decarboxylase; Provisional 92.92
PRK08068 389 transaminase; Reviewed 92.89
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 92.89
PRK08249 398 cystathionine gamma-synthase; Provisional 92.77
PRK07683 387 aminotransferase A; Validated 92.74
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 92.62
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 92.58
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 92.57
PRK07811 388 cystathionine gamma-synthase; Provisional 92.56
PRK13034 416 serine hydroxymethyltransferase; Reviewed 92.54
KOG1359|consensus 417 92.53
PRK06460 376 hypothetical protein; Provisional 92.46
PTZ00377 481 alanine aminotransferase; Provisional 92.43
PRK07503 403 methionine gamma-lyase; Provisional 92.41
PRK06358 354 threonine-phosphate decarboxylase; Provisional 92.4
PRK07050 394 cystathionine beta-lyase; Provisional 92.36
PRK07366 388 succinyldiaminopimelate transaminase; Validated 92.34
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 92.27
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 92.24
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 92.24
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 92.04
PLN02409 401 serine--glyoxylate aminotransaminase 92.03
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 91.98
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 91.89
PRK09148 405 aminotransferase; Validated 91.87
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 91.85
PRK06290 410 aspartate aminotransferase; Provisional 91.85
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 91.83
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 91.81
PLN02509 464 cystathionine beta-lyase 91.75
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 91.74
PRK08912 387 hypothetical protein; Provisional 91.72
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 91.61
PRK06767 386 methionine gamma-lyase; Provisional 91.6
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 91.49
PRK08045 386 cystathionine gamma-synthase; Provisional 91.44
PRK08363 398 alanine aminotransferase; Validated 91.38
PRK09082 386 methionine aminotransferase; Validated 91.36
PRK07582 366 cystathionine gamma-lyase; Validated 91.3
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 91.2
PRK06107 402 aspartate aminotransferase; Provisional 91.17
PRK05957 389 aspartate aminotransferase; Provisional 91.15
PRK15481 431 transcriptional regulatory protein PtsJ; Provision 91.14
PRK05664 330 threonine-phosphate decarboxylase; Reviewed 91.11
PTZ00433 412 tyrosine aminotransferase; Provisional 91.05
PRK02731 367 histidinol-phosphate aminotransferase; Validated 90.99
PLN02368 407 alanine transaminase 90.92
KOG0257|consensus 420 90.84
PRK00950 361 histidinol-phosphate aminotransferase; Validated 90.82
PRK12414 384 putative aminotransferase; Provisional 90.7
PRK08153 369 histidinol-phosphate aminotransferase; Provisional 90.66
PRK08247 366 cystathionine gamma-synthase; Reviewed 90.48
PRK07671 377 cystathionine beta-lyase; Provisional 90.4
PRK08637 388 hypothetical protein; Provisional 90.31
PRK09265 404 aminotransferase AlaT; Validated 90.26
PRK06425 332 histidinol-phosphate aminotransferase; Validated 90.26
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 90.25
COG0075 383 Serine-pyruvate aminotransferase/archaeal aspartat 90.2
PRK07269 364 cystathionine gamma-synthase; Reviewed 90.05
PRK08776 405 cystathionine gamma-synthase; Provisional 89.94
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 89.93
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 89.92
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 89.85
PRK06234 400 methionine gamma-lyase; Provisional 89.76
PRK05942 394 aspartate aminotransferase; Provisional 89.62
COG3033 471 TnaA Tryptophanase [Amino acid transport and metab 89.59
PRK03321 352 putative aminotransferase; Provisional 89.45
PRK08064 390 cystathionine beta-lyase; Provisional 89.42
PRK05839 374 hypothetical protein; Provisional 89.39
PRK08354 311 putative aminotransferase; Provisional 89.25
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 89.24
PLN02672 1082 methionine S-methyltransferase 88.79
PRK08114 395 cystathionine beta-lyase; Provisional 88.58
PRK06836 394 aspartate aminotransferase; Provisional 88.13
KOG0258|consensus 475 88.05
KOG0256|consensus 471 87.6
PRK13580 493 serine hydroxymethyltransferase; Provisional 86.97
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 86.64
KOG1360|consensus 570 86.56
PRK04366 481 glycine dehydrogenase subunit 2; Validated 86.36
PLN02414 993 glycine dehydrogenase (decarboxylating) 86.27
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 86.23
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 86.18
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 86.16
PRK04311 464 selenocysteine synthase; Provisional 85.99
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 85.46
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 84.96
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 84.49
KOG2862|consensus 385 83.77
PRK03158 359 histidinol-phosphate aminotransferase; Provisional 83.3
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 83.28
PRK05968 389 hypothetical protein; Provisional 83.19
PRK05367 954 glycine dehydrogenase; Provisional 82.92
KOG0053|consensus 409 82.85
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 82.3
PRK00451 447 glycine dehydrogenase subunit 1; Validated 81.85
PRK10534 333 L-threonine aldolase; Provisional 81.71
PRK09275 527 aspartate aminotransferase; Provisional 81.54
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 81.23
KOG1357|consensus 519 80.52
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
Probab=99.97  E-value=1.4e-30  Score=217.43  Aligned_cols=92  Identities=36%  Similarity=0.561  Sum_probs=83.0

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCCCceEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCeEEEccccccccccCccchh
Q psy1628          17 LLAVVHLFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWA   96 (114)
Q Consensus        17 ~~~~~~~~~e~~~~~~~~~~~~~~~iAAviiEPv~g~gG~~~~~~~fl~~lr~lc~~~gillI~DEV~tGfgRtG~~~~~   96 (114)
                      ......+++|+.+.+...++   +++||+|+||+||+||+++||++|++++|++|++||++||+|||||||||||+ ||+
T Consensus       201 ~~~~~~~~~e~~i~~~~~~~---~~vAaiI~EpIQgegG~~v~p~~fl~~l~~~~~~~gillI~DEVQtG~GRTG~-~fa  276 (447)
T COG0160         201 CGDDALEYIERALFDLEVGP---EEVAAIIIEPIQGEGGIIVPPKGFLKALRKLCREHGILLIADEVQTGFGRTGK-MFA  276 (447)
T ss_pred             hhHHHHHHHHHHHHhhcCCC---CceeEEEEecccCCCCCcCCCHHHHHHHHHHHHHcCCEEEEeccccCCCcccc-chh
Confidence            34556677888555544466   89999999999999999999999999999999999999999999999999998 999


Q ss_pred             hhhcCCCCCcCEEEeecC
Q psy1628          97 FQLQGDDIIPDIVTVVWN  114 (114)
Q Consensus        97 ~~~~g~~v~PDivt~gK~  114 (114)
                      +|++|  |+|||+|+||+
T Consensus       277 ~E~~g--v~PDivt~aK~  292 (447)
T COG0160         277 FEHFG--VEPDIVTLAKS  292 (447)
T ss_pred             hhhcC--CCCCEEEeccc
Confidence            99999  99999999996



>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>KOG1405|consensus Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>KOG1403|consensus Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
2eo5_A 419 Crystal Structure Of 4-Aminobutyrate Aminotransfera 2e-08
4a6r_A 459 Crystal Structure Of The Omega Transaminase From Ch 2e-07
4ffc_A 453 Crystal Structure Of A 4-Aminobutyrate Aminotransfe 3e-07
1z3z_A 431 The Crystal Structure Of A Dgd Mutant: Q52a Length 4e-07
1m0n_A 433 Structure Of Dialkylglycine Decarboxylase Complexed 4e-07
1d7r_A 433 Crystal Structure Of The Complex Of 2,2-Dialkylglyc 4e-07
1dgd_A 432 An Alkali Metal Ion Size-Dependent Switch In The Ac 4e-07
1z7d_A 433 Ornithine Aminotransferase Py00104 From Plasmodium 8e-07
4atp_A 456 Structure Of Gaba-Transaminase A1r958 From Arthroba 9e-07
3n5m_A 452 Crystals Structure Of A Bacillus Anthracis Aminotra 1e-06
3dxw_A 452 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 1e-06
2zuk_A 439 The Crystal Structure Of Alpha-Amino-Epsilon-Caprol 1e-06
3hmu_A 472 Crystal Structure Of A Class Iii Aminotransferase F 2e-06
3ruy_A 392 Crystal Structure Of The Ornithine-Oxo Acid Transam 2e-06
3i5t_A 476 Crystal Structure Of Aminotransferase Prk07036 From 8e-06
3q8n_A 453 Crystal Structure Of 4-Aminobutyrate Transaminase F 4e-05
4grx_A 465 Structure Of An Omega-Aminotransferase From Paracoc 9e-05
3gju_A 459 Crystal Structure Of A Putative Aminotransferase (M 9e-05
3nui_A 478 Crystal Structure Of Omega-Transferase From Vibrio 1e-04
4e3r_A 473 Plp-Bound Aminotransferase Mutant Crystal Structure 1e-04
2e54_A 385 Crystal Structure Of Acetylornithine Aminotransfera 2e-04
3lg0_A 422 Structure Of Plasmodium Falciparum Ornithine Delta- 2e-04
3fcr_A 459 Crystal Structure Of Putative Aminotransferase (Yp_ 3e-04
2ord_A 397 Crystal Structure Of Acetylornithine Aminotransfera 3e-04
3oks_A 451 Crystal Structure Of 4-Aminobutyrate Transaminase F 4e-04
3nx3_A 395 Crystal Structure Of Acetylornithine Aminotransfera 5e-04
>pdb|2EO5|A Chain A, Crystal Structure Of 4-Aminobutyrate Aminotransferase From Sulfolobus Tokodaii Strain7 Length = 419 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 2e-08, Method: Composition-based stats. Identities = 29/81 (35%), Positives = 44/81 (54%), Gaps = 7/81 (8%) Query: 35 YPFLFLYP----CAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRV 90 Y F+ L P F E +Q GG +IPP N+ E+ K + G + V DEVQ+G GR Sbjct: 202 YIFVNLVPPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLGRT 261 Query: 91 GTHWWAFQLQGDDIIPDIVTV 111 G F ++ + +PD++T+ Sbjct: 262 GK---LFAIENFNTVPDVITL 279
>pdb|4A6R|A Chain A, Crystal Structure Of The Omega Transaminase From Chromobacterium Violaceum In The Apo Form, Crystallised From Polyacrylic Acid Length = 459 Back     alignment and structure
>pdb|4FFC|A Chain A, Crystal Structure Of A 4-Aminobutyrate Aminotransferase (Gabt) From Mycobacterium Abscessus Length = 453 Back     alignment and structure
>pdb|1Z3Z|A Chain A, The Crystal Structure Of A Dgd Mutant: Q52a Length = 431 Back     alignment and structure
>pdb|1M0N|A Chain A, Structure Of Dialkylglycine Decarboxylase Complexed With 1- Aminocyclopentanephosphonate Length = 433 Back     alignment and structure
>pdb|1D7R|A Chain A, Crystal Structure Of The Complex Of 2,2-Dialkylglycine Decarboxylase With 5pa Length = 433 Back     alignment and structure
>pdb|1DGD|A Chain A, An Alkali Metal Ion Size-Dependent Switch In The Active Site Structure Of Dialkylglycine Decarboxylase Length = 432 Back     alignment and structure
>pdb|1Z7D|A Chain A, Ornithine Aminotransferase Py00104 From Plasmodium Yoelii Length = 433 Back     alignment and structure
>pdb|4ATP|A Chain A, Structure Of Gaba-Transaminase A1r958 From Arthrobacter Aurescens In Complex With Plp Length = 456 Back     alignment and structure
>pdb|3N5M|A Chain A, Crystals Structure Of A Bacillus Anthracis Aminotransferase Length = 452 Back     alignment and structure
>pdb|3DXW|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam Length = 452 Back     alignment and structure
>pdb|2ZUK|A Chain A, The Crystal Structure Of Alpha-Amino-Epsilon-Caprolactam Racemase From Achromobacter Obae Complexed With Epsilon Caprolactam (Different Binding Mode) Length = 439 Back     alignment and structure
>pdb|3HMU|A Chain A, Crystal Structure Of A Class Iii Aminotransferase From Silicibacter Pomeroyi Length = 472 Back     alignment and structure
>pdb|3RUY|A Chain A, Crystal Structure Of The Ornithine-Oxo Acid Transaminase Rocd From Bacillus Anthracis Length = 392 Back     alignment and structure
>pdb|3I5T|A Chain A, Crystal Structure Of Aminotransferase Prk07036 From Rhodobacter Sphaeroides Kd131 Length = 476 Back     alignment and structure
>pdb|3Q8N|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 453 Back     alignment and structure
>pdb|4GRX|A Chain A, Structure Of An Omega-Aminotransferase From Paracoccus Denitrificans Length = 465 Back     alignment and structure
>pdb|3GJU|A Chain A, Crystal Structure Of A Putative Aminotransferase (Mll7127) From Mesorhizobium Loti Maff303099 At 1.55 A Resolution Length = 459 Back     alignment and structure
>pdb|3NUI|A Chain A, Crystal Structure Of Omega-Transferase From Vibrio Fluvialis Js17 Length = 478 Back     alignment and structure
>pdb|4E3R|A Chain A, Plp-Bound Aminotransferase Mutant Crystal Structure From Vibrio Fluvialis Length = 473 Back     alignment and structure
>pdb|2E54|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase From Thermotoga Maritima Length = 385 Back     alignment and structure
>pdb|3LG0|A Chain A, Structure Of Plasmodium Falciparum Ornithine Delta-Aminotransferase Length = 422 Back     alignment and structure
>pdb|3FCR|A Chain A, Crystal Structure Of Putative Aminotransferase (Yp_614685.1) From Silicibacter Sp. Tm1040 At 1.80 A Resolution Length = 459 Back     alignment and structure
>pdb|2ORD|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Ec 2.6.1.11) (Acoat) (Tm1785) From Thermotoga Maritima At 1.40 A Resolution Length = 397 Back     alignment and structure
>pdb|3OKS|A Chain A, Crystal Structure Of 4-Aminobutyrate Transaminase From Mycobacterium Smegmatis Length = 451 Back     alignment and structure
>pdb|3NX3|A Chain A, Crystal Structure Of Acetylornithine Aminotransferase (Argd) From Campylobacter Jejuni Length = 395 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query114
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 1e-22
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 9e-22
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 6e-16
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 1e-15
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 5e-15
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 1e-14
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 1e-14
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 2e-14
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 5e-14
3nui_A 478 Pyruvate transaminase; amino transferase, transfer 5e-14
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 7e-14
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 1e-13
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 2e-13
3hmu_A 472 Aminotransferase, class III; structural genomics, 2e-13
1z7d_A 433 Ornithine aminotransferase; structural genomics co 3e-13
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 3e-13
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 4e-13
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 8e-13
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 2e-12
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 3e-12
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 4e-12
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 5e-12
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 9e-12
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 1e-11
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 1e-11
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 4e-11
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 2e-10
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 6e-10
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Length = 433 Back     alignment and structure
 Score = 89.5 bits (223), Expect = 1e-22
 Identities = 26/69 (37%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 43  CAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGD 102
            AF AE + S GG I  P  Y+  + +   A G + + DE Q G GR G   +A   Q D
Sbjct: 205 AAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVGRTG-TMFAC--QRD 261

Query: 103 DIIPDIVTV 111
            + PDI+T+
Sbjct: 262 GVTPDILTL 270


>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Length = 439 Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Length = 453 Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Length = 451 Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Length = 426 Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Length = 472 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Length = 419 Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Length = 395 Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Length = 452 Back     alignment and structure
>3nui_A Pyruvate transaminase; amino transferase, transferase; 2.00A {Vibrio fluvialis} Length = 478 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Length = 460 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Length = 439 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Length = 459 Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Length = 472 Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Length = 433 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} Length = 392 Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Length = 476 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Length = 449 Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Length = 375 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} PDB: 3drd_A 3du4_A* Length = 448 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Length = 449 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, pyridoxal phosphate, PSI-2, protein structure initiative; 1.70A {Deinococcus radiodurans} Length = 430 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Length = 397 Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Length = 395 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Length = 420 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Length = 429 Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Length = 457 Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Length = 831 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 99.96
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 99.96
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 99.92
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.9
3hmu_A 472 Aminotransferase, class III; structural genomics, 99.88
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 99.86
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.84
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 99.82
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 99.82
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.82
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 99.81
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 99.8
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 99.8
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 99.79
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 99.77
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 99.76
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 99.76
1z7d_A 433 Ornithine aminotransferase; structural genomics co 99.75
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 99.75
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 99.75
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 99.74
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.73
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 99.72
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 99.71
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 99.71
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 99.69
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 99.68
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 99.68
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 99.67
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 99.66
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.65
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 99.65
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 99.45
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 99.57
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 99.52
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 99.51
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 99.39
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.38
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 99.33
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 99.17
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 98.98
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.94
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.75
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 98.67
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.66
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 98.65
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.64
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.6
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.59
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.58
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 98.57
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 98.57
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.56
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 98.52
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 98.51
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 98.49
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.49
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.46
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 98.45
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 98.43
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 98.43
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 98.42
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 98.41
1vp4_A 425 Aminotransferase, putative; structural genomics, j 98.41
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 98.41
1svv_A 359 Threonine aldolase; structural genomics, structura 98.4
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 98.4
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 98.4
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 98.4
3nra_A 407 Aspartate aminotransferase; structural genomics, j 98.39
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 98.37
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 98.37
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 98.37
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 98.36
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 98.35
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 98.35
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 98.33
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 97.67
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.32
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 98.3
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 98.29
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 98.28
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 98.27
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 98.25
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 98.25
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 98.25
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 98.24
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.24
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 98.22
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 98.22
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 98.21
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 98.2
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.2
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 98.19
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 98.18
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 98.16
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 98.16
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 98.15
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 98.14
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 98.13
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 98.13
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 98.11
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 98.1
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 98.09
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 98.06
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 98.03
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 98.01
3ele_A 398 Amino transferase; RER070207001803, structural gen 98.0
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.0
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 97.99
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 97.99
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 97.99
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 97.98
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 97.98
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 97.96
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 97.96
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 97.96
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 97.94
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 97.92
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 97.92
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 97.91
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 97.91
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 97.91
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 97.89
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 97.89
3pj0_A 359 LMO0305 protein; structural genomics, joint center 97.88
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 97.86
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 97.85
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 97.85
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 97.85
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 97.85
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 97.84
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 97.84
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 97.84
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 97.83
3rq1_A 418 Aminotransferase class I and II; structural genomi 97.82
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 97.82
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 97.81
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 97.81
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 97.81
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 97.79
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 97.78
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 97.77
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 97.74
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 97.73
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 97.72
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 97.72
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 97.7
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 97.68
1o69_A 394 Aminotransferase; structural genomics, unknown fun 97.67
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 97.64
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 97.62
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 97.61
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 97.61
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 97.6
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 97.6
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 97.58
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 97.57
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 97.57
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 97.56
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 97.56
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 97.56
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 97.55
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 97.55
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 97.54
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 97.5
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 97.49
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 97.49
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 97.48
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 97.48
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 97.43
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 97.43
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 97.39
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 97.38
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 97.38
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 97.33
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 97.31
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 97.29
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 97.22
1iug_A 352 Putative aspartate aminotransferase; wild type, py 97.22
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 97.21
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 97.16
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 97.14
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 97.14
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 97.13
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 97.12
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 97.08
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 97.07
2fnu_A 375 Aminotransferase; protein-product complex, structu 97.07
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 97.03
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 97.02
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 96.92
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 96.84
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 96.83
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 96.63
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 96.45
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 96.45
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 96.39
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 96.28
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 96.24
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 96.2
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 96.09
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 95.95
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 95.86
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 95.68
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 95.66
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 95.59
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 94.97
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 94.82
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 94.81
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 94.46
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 94.4
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 94.13
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 93.64
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 93.18
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 93.09
3hl2_A 501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 92.99
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 92.82
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 92.67
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 89.98
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 89.84
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 89.82
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 87.78
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 86.56
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 84.86
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 84.83
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 84.8
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
Probab=99.96  E-value=2.3e-30  Score=214.47  Aligned_cols=84  Identities=27%  Similarity=0.415  Sum_probs=77.5

Q ss_pred             HHHHHHHHhcCCCCCCCCceEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCeEEEccccccccccCccchhhhhcCC
Q psy1628          23 LFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGD  102 (114)
Q Consensus        23 ~~~e~~~~~~~~~~~~~~~iAAviiEPv~g~gG~~~~~~~fl~~lr~lc~~~gillI~DEV~tGfgRtG~~~~~~~~~g~  102 (114)
                      ..+++.+.+.  ++   +++||||+||+||++|+++|+++|++++|++|++||+|||+|||||||||||+ ||+++++| 
T Consensus       223 ~~l~~~i~~~--~~---~~iAavi~EPiqg~gG~~~p~~~fl~~lr~lc~~~gilLI~DEV~tGfGRtG~-~fa~e~~g-  295 (473)
T 4e3q_A          223 RELEETIQRE--GA---DTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFGRTGN-TWGCVTYD-  295 (473)
T ss_dssp             HHHHHHHHHH--CG---GGEEEEEECSSBSTTTSBCCCTTHHHHHHHHHHHTTCCEEEECTTTSSSTTSS-SCHHHHTT-
T ss_pred             HHHHHHHHhh--CC---CceEEEEeCCccCCCCceeCCHHHHHHHHHHhcccceEEeccCccccCCcccc-hhHHHhcC-
Confidence            4566666654  34   79999999999999999999999999999999999999999999999999998 99999999 


Q ss_pred             CCCcCEEEeecC
Q psy1628         103 DIIPDIVTVVWN  114 (114)
Q Consensus       103 ~v~PDivt~gK~  114 (114)
                       ++|||+|+||+
T Consensus       296 -v~PDi~t~~K~  306 (473)
T 4e3q_A          296 -FTPDAIISSKN  306 (473)
T ss_dssp             -CCCSEEEECGG
T ss_pred             -CCCChHHhccc
Confidence             99999999995



>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 114
d1vefa1 387 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine a 7e-15
d1z7da1 404 c.67.1.4 (A:7-410) Ornithine aminotransferase {Pla 1e-14
d2byla1 404 c.67.1.4 (A:36-439) Ornithine aminotransferase {Hu 4e-14
d2gsaa_ 427 c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase 2e-08
d1sffa_ 425 c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GA 1e-07
d1s0aa_ 429 c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxonona 2e-05
d1zoda1 431 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {P 2e-05
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Length = 387 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Acetylornithine/acetyl-lysine aminotransferase ArgD
species: Thermus thermophilus [TaxId: 274]
 Score = 66.7 bits (162), Expect = 7e-15
 Identities = 20/68 (29%), Positives = 31/68 (45%), Gaps = 3/68 (4%)

Query: 43  CAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGD 102
            A   E +Q  GG       +LR   +  +  G + + DE+Q G GR G  +     +  
Sbjct: 179 AAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAF---EHF 235

Query: 103 DIIPDIVT 110
            I+PDI+T
Sbjct: 236 GIVPDILT 243


>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 404 Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 404 Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Length = 427 Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Length = 425 Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Length = 429 Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Length = 431 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query114
d1ohwa_ 461 4-aminobutyrate aminotransferase, GABA-aminotransf 99.95
d1sffa_ 425 4-aminobutyrate aminotransferase, GABA-aminotransf 99.95
d2byla1 404 Ornithine aminotransferase {Human (Homo sapiens) [ 99.95
d1zoda1 431 Dialkylglycine decarboxylase {Pseudomonas cepacia 99.95
d1z7da1 404 Ornithine aminotransferase {Plasmodium yoelii yoel 99.94
d1vefa1 387 Acetylornithine/acetyl-lysine aminotransferase Arg 99.94
d1s0aa_ 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.93
d2gsaa_ 427 Glutamate-1-semialdehyde aminomutase (aminotransfe 99.93
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 99.08
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.8
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 98.49
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 98.22
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 98.05
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 97.94
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 97.39
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 97.24
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 96.98
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 96.65
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 96.5
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 96.29
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 96.13
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 95.85
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 95.76
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 95.76
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 95.32
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 95.12
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 95.11
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 94.99
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 94.84
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 94.82
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 94.75
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 94.74
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 94.7
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 94.67
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 94.4
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 94.13
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 94.02
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 93.87
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 93.87
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 93.7
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 93.47
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 93.37
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 93.23
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 92.51
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 92.51
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 92.42
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 92.04
d1m32a_ 361 2-aminoethylphosphonate transaminase {Salmonella t 92.02
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 91.51
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 87.26
d1h0ca_ 388 Alanine-glyoxylate aminotransferase {Human (Homo s 86.99
d1svva_ 340 Low-specificity threonine aldolase {Leishmania maj 86.61
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 85.97
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 80.65
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: 4-aminobutyrate aminotransferase, GABA-aminotransferase
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=99.95  E-value=5e-29  Score=202.71  Aligned_cols=88  Identities=25%  Similarity=0.335  Sum_probs=76.3

Q ss_pred             HHHHHHHHhcCCCCCCCCceEEEEEcccCCCCCcccCCHHHHHHHHHHHHHhCCeEEEccccccccccCccchhhhhcCC
Q psy1628          23 LFFERIFLSASLYPFLFLYPCAFFAESLQSCGGQIIPPANYLREVYKHVRAAGGVCVADEVQVGFGRVGTHWWAFQLQGD  102 (114)
Q Consensus        23 ~~~e~~~~~~~~~~~~~~~iAAviiEPv~g~gG~~~~~~~fl~~lr~lc~~~gillI~DEV~tGfgRtG~~~~~~~~~g~  102 (114)
                      ..+++++.....++   ++|||+|+||+||++|++++|++|++++|++|++||++||+|||||||||||+ ||++|++|.
T Consensus       233 ~~l~~~~~~~~~~~---~~iAavivEPi~g~~G~~~~~~~fl~~lr~lc~~~gillI~DEV~tG~gRtG~-~~~~e~~gi  308 (461)
T d1ohwa_         233 EEVEDLIVKYRKKK---KTVAGIIVEPIQSEGGDNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGSTGK-FWAHEHWGL  308 (461)
T ss_dssp             HHHHHHHHHHHHTT---CCEEEEEECSSBCTTTCBCCCHHHHHHHHHHHHHTTCEEEEECTTTCSSTTSS-SSGGGGGCC
T ss_pred             HHHHHHHHHHHhCC---CccceeeeccccccccccCchhhHHHHHHHHHHhhCcceeccccccccccccc-ccccccccc
Confidence            34555554322233   89999999999999999999999999999999999999999999999999998 999999993


Q ss_pred             CCCcCEEEeecC
Q psy1628         103 DIIPDIVTVVWN  114 (114)
Q Consensus       103 ~v~PDivt~gK~  114 (114)
                      +..||++|+||+
T Consensus       309 ~~~PDiv~~gK~  320 (461)
T d1ohwa_         309 DDPADVMTFSKK  320 (461)
T ss_dssp             SSCCSEEEECGG
T ss_pred             ccCchhhhhhhc
Confidence            336999999996



>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure