Psyllid ID: psy16294

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MEDGEEGVKDNESLGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKQNRKRALSASPYSDSIADIHTMIRFSPNSLVNSLVNSTASSRSGGSYGHLSAGALSPALHPSMTPHLQQLQAHLLRSGGLLPPQPPFYHPHALSPLNSDLHSTKLGDKEAKVRAEADTSSMGGGASWKPMKIKRETKQHSPESPAGDKYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNWVSSSTQPAPAGPPSAATGNMVINDRNTSLSSLLEENRFFQMSQMIHSSF
ccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccc
cccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHccccEccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHEHcccccccccccccccccccccHHHHHHcccccccccccccccccccccccccEccccHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEEcccccccEcccccccccccEEccccHHEEEEHccccccccEcccccccccEccccHHHHHHHHcccccccccccccccEcccccccHHHEHEHHcccccccEccHccccEccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHccc
medgeegvkdneslgltseylgsrglsdlpppptatssigsaefpfpldgsrllasprshlkqnrkralsaspysdsiaDIHTMirfspnslVNSLVNstassrsggsyghlsagalspalhpsmtpHLQQLQAHLLrsggllppqppfyhphalsplnsdlhstklgdkEAKVRaeadtssmgggaswkpmkikretkqhspespagdkyepgdfvetnchwkdcglefgtqDILVKHINNDHIHANKKSficrwedctrdekpfKAQYMLVVHMRrhtgekphkctdleafdtSSRVAARRIRGWKISRRisdlipvrnrtRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEilsrpklkpyvcgeenctkrytdpsslrkhiktvhapaslnpvpqhkdmqdiqsnevtqsnmrqSTYQRTLEYVEQCQNwvssstqpapagppsaatgnmvindrntsLSSLLEENRFFQMSQMIHSSF
medgeegvkdneslGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKqnrkralsaspysDSIADIHTMIRFSPNSLVNSLVNSTASSRSGGSYGHLSAGALSPALHPSMTPHLQQLQAHLLRSGGLLPPQPPFYHPHALSPLNSDLHSTKLGDKEAKVRaeadtssmgggaswkpmkIKRETkqhspespagdkyepgdFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRhtgekphkctdleafdtssrvaarrirgwkisrrisdlipvrnrtrvniLAVVKRLVMRRIELnirteltlmslNVQFEilsrpklkpyvcgeenctkrytdpsslrKHIKTVhapaslnpvpqHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNWVSSSTQPAPAGPPSAATGNMVINDRNTSLSSLLEENRFFQMSQMIHSSF
MEDGEEGVKDNESLGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKQNRKRALSASPYSDSIADIHTMIRFspnslvnslvnstassRSGGSYGHLSAGALSPALHPSMTPHLQQLQAHLLRSGGLLPPQPPFYHPHALSPLNSDLHSTKLGDKEAKVRAEADTSSMGGGASWKPMKIKRETKQHSPESPAGDKYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNWVssstqpapagppsaatgNMVINDRNTSLSSLLEENRFFQMSQMIHSSF
*******************************************************************************DIHTMIRF*******************************************************************************************************************************DFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRY*************************************************LEYVEQCQNW*************************************************
**************GL***********************************************************************************************************************************************************************************************************NCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLN****************************************************************************FFQMSQMI****
***********ESLGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPR**************PYSDSIADIHTMIRFSPNSLVNSLVN***********GHLSAGALSPALHPSMTPHLQQLQAHLLRSGGLLPPQPPFYHPHALSPLNSDLHSTKL********************SWKPMKIK**************KYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNW**************AATGNMVINDRNTSLSSLLEENRFFQMSQMIHSSF
****************TSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKQNRKRALSASPYSDSIADIHTMIRFSPN***************************************************************************************************KPMKIKRETKQHSPESPAGDKYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNWV*************************TSLSSLLEENRFFQMSQMI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDGEEGVKDNESLGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKQNRKRALSASPYSDSIADIHTMIRFSPNSLVNSLVNSTASSRSGGSYGHLSAGALSPALHPSMTPHLQQLQAHLLRSGGLLPPQPPFYHPHALSPLNSDLHSTKLGDKEAKVRAEADTSSMGGGASWKPMKIKRETKQHSPESPAGDKYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTLEYVEQCQNWVSSSTQPAPAGPPSAATGNMVINDRNTSLSSLLEENRFFQMSQMIHSSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query486 2.2.26 [Sep-21-2011]
Q9IA31 1544 Transcriptional activator yes N/A 0.689 0.216 0.391 1e-60
Q61602 1583 Transcriptional activator yes N/A 0.726 0.222 0.414 4e-60
Q91660 1569 Zinc finger protein GLI3 N/A N/A 0.707 0.219 0.406 2e-59
P10071 1580 Transcriptional activator yes N/A 0.697 0.214 0.406 7e-59
Q91690 1360 Zinc finger protein GLI1 N/A N/A 0.648 0.231 0.411 1e-58
Q5IS56 1580 Transcriptional activator yes N/A 0.697 0.214 0.406 1e-58
Q91661 1361 Zinc finger protein GLI4 N/A N/A 0.679 0.242 0.421 4e-58
P55879 663 Zinc finger protein GLI2 no N/A 0.676 0.496 0.396 3e-57
Q0VGT2 1544 Zinc finger protein GLI2 no N/A 0.670 0.211 0.411 7e-57
P55878556 Zinc finger protein GLI1 no N/A 0.639 0.559 0.392 5e-56
>sp|Q9IA31|GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus GN=GLI3 PE=1 SV=1 Back     alignment and function desciption
 Score =  234 bits (596), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 160/409 (39%), Positives = 208/409 (50%), Gaps = 74/409 (18%)

Query: 32  PPTATSSIGS--AEFPFPLDGSRLLASPRSHLKQNRKRALSASPYSDSIADIHTMIRFSP 89
           P  AT+  G+   E+   +D +R   SPR   + +RKR LS SP SD   D+ TMIR SP
Sbjct: 256 PSAATAGAGALHMEYLHAMDSTRF-PSPRLSARPSRKRTLSISPLSDHSFDLQTMIRTSP 314

Query: 90  NSLVNSLVNSTASSRSGGSYGHLSAGALSPAL---HPSMTPHLQQLQAHLLRS----GGL 142
           NSLV  L NS +S  + GSYGHLSA A+SPAL   +P     LQQ+   ++      G  
Sbjct: 315 NSLVTILNNSCSSWSASGSYGHLSASAISPALSFTYPPTPVSLQQMHQQIISRQQTLGSA 374

Query: 143 LPPQPPFYHP--------------HALSPL---------------NSDLHSTKLGD---- 169
               PP  HP                L+P+                S+   +  GD    
Sbjct: 375 FGHSPPLIHPAPTFPTQRPIPGIPSVLNPVQVSSGPSESTQHNKPTSESAVSSTGDPMHN 434

Query: 170 KEAKVRAEADTSSMGGGASWKPMKIKRETKQHSPESPAGDK----YEPGDFVETNCHWKD 225
           K +K++ + D  S G G+      ++ + +  +P    GDK     EP    ETNCHW+ 
Sbjct: 435 KRSKIKPDEDLPSPGAGS------VQEQPEGMTPVKEEGDKDESKQEPEVVYETNCHWEG 488

Query: 226 CGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPH 285
           C  EF TQ+ LV HINNDHIH  KK F+CRW DC+R++KPFKAQYMLVVHMRRHTGEKPH
Sbjct: 489 CSREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGEKPH 548

Query: 286 KCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRT 345
           KCT    F+  ++  +          R+ +L     +T +      K  V      N   
Sbjct: 549 KCT----FEGCTKAYS----------RLENL-----KTHLRSHTGEKPYVCEHEGCN--K 587

Query: 346 ELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHAP 394
             +  S   + +  +    KPYVC    CTKRYTDPSSLRKH+KTVH P
Sbjct: 588 AFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGP 636
Has a dual function as a transcriptional activator and a repressor of the sonic hedgehog (Shh) pathway, and plays a role in limb development. The full-length GLI3 form (GLI3FL) acts as an activator (GLI3A) while GLI3R, its C-terminally truncated form, acts as a repressor.
Gallus gallus (taxid: 9031)
>sp|Q61602|GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus GN=Gli3 PE=1 SV=2 Back     alignment and function description
>sp|Q91660|GLI3_XENLA Zinc finger protein GLI3 OS=Xenopus laevis GN=gli3 PE=2 SV=1 Back     alignment and function description
>sp|P10071|GLI3_HUMAN Transcriptional activator GLI3 OS=Homo sapiens GN=GLI3 PE=1 SV=6 Back     alignment and function description
>sp|Q91690|GLI1_XENLA Zinc finger protein GLI1 (Fragment) OS=Xenopus laevis GN=gli1 PE=2 SV=2 Back     alignment and function description
>sp|Q5IS56|GLI3_PANTR Transcriptional activator GLI3 OS=Pan troglodytes GN=GLI3 PE=2 SV=1 Back     alignment and function description
>sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis GN=gli4 PE=2 SV=1 Back     alignment and function description
>sp|P55879|GLI2_CHICK Zinc finger protein GLI2 (Fragment) OS=Gallus gallus GN=GLI2 PE=2 SV=1 Back     alignment and function description
>sp|Q0VGT2|GLI2_MOUSE Zinc finger protein GLI2 OS=Mus musculus GN=Gli2 PE=1 SV=2 Back     alignment and function description
>sp|P55878|GLI1_CHICK Zinc finger protein GLI1 (Fragment) OS=Gallus gallus GN=GLI1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
189235243 1259 PREDICTED: similar to zinc finger protei 0.705 0.272 0.496 2e-81
270004843 1247 cubitus interruptus [Tribolium castaneum 0.705 0.275 0.496 2e-81
242016987 1377 protein cubitus interruptus, putative [P 0.701 0.247 0.450 1e-75
332020505 1369 Protein cubitus interruptus [Acromyrmex 0.672 0.238 0.442 6e-71
380020862 1385 PREDICTED: transcriptional activator cub 0.670 0.235 0.459 2e-68
383855083 1445 PREDICTED: transcriptional activator cub 0.670 0.225 0.445 5e-68
350420960 1428 PREDICTED: transcriptional activator cub 0.670 0.228 0.445 5e-68
340713212 1450 PREDICTED: transcriptional activator cub 0.670 0.224 0.445 7e-68
328776907 1445 PREDICTED: transcriptional activator cub 0.670 0.225 0.448 1e-67
242002200 990 zinc finger protein, putative [Ixodes sc 0.683 0.335 0.448 3e-61
>gi|189235243|ref|XP_970110.2| PREDICTED: similar to zinc finger protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 200/403 (49%), Positives = 243/403 (60%), Gaps = 60/403 (14%)

Query: 14  LGLTSEYLGSRGLSDLPPPPTATSSIGSAEFPFPLDGSRLLASPRSHLKQNRKRALSASP 73
           LGL+ EYL +RGLSDL P    +S++ S+EFPF +DGSRL +     ++Q+RKRALS+SP
Sbjct: 117 LGLSPEYLSARGLSDLHP----SSALASSEFPFSIDGSRLNSPRPGSIRQSRKRALSSSP 172

Query: 74  YSDSIADIHTMIRFSPNSLVNSLVNSTASSRSGGSYGHLSAGALSPA--LHPSMTPHLQQ 131
           YSDS  DI++ IR+SPNSLV  LVN + SS + GSYGHLSAGA+SPA  +HP +  HLQQ
Sbjct: 173 YSDSF-DINS-IRYSPNSLV--LVNGSRSSSASGSYGHLSAGAISPAFNMHPEL--HLQQ 226

Query: 132 LQAHLLRSGGLLPPQPPF----------YHP-HALSPLNSDLHSTKLGDKEAKVRAEADT 180
           LQAHL+RS G L P PP           +HP H  SP N    +  L DK+   ++E  T
Sbjct: 227 LQAHLMRSAGSLLPLPPATPTHSMYSLGHHPLHVSSPHNIS-KTDALNDKK---KSETGT 282

Query: 181 -SSMGGGASWKPMKIKRE-------TKQHSPESPAGDKYEPGDFVETNCHWKDCGLEFGT 232
            + +   A  + +KIK+E       T           K EPGDF+ETNCHWKDCG EF T
Sbjct: 283 LTHLDSDAQARKIKIKKEPSNAVSGTINEGQNDQTDLKDEPGDFIETNCHWKDCGTEFQT 342

Query: 233 QDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEA 292
           QD LVKHINNDHIHANKKSF+CRW+ C+R EKPFKAQYMLVVHMRRHTGEKPHKCT    
Sbjct: 343 QDELVKHINNDHIHANKKSFVCRWDGCSRAEKPFKAQYMLVVHMRRHTGEKPHKCTFEGC 402

Query: 293 FDTSSRVAARR--IRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLM 350
               SR+   +  +R     +  +   P  ++   N     K     R   N        
Sbjct: 403 VKAYSRLENLKTHLRSHTGEKPYTCEYPGCSKAFSNASDRAKH--QNRTHSN-------- 452

Query: 351 SLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHA 393
                         KPYVC    CTKRYTDPSSLRKH+KTVH 
Sbjct: 453 -------------EKPYVCKAPGCTKRYTDPSSLRKHVKTVHG 482

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270004843|gb|EFA01291.1| cubitus interruptus [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242016987|ref|XP_002428976.1| protein cubitus interruptus, putative [Pediculus humanus corporis] gi|212513805|gb|EEB16238.1| protein cubitus interruptus, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332020505|gb|EGI60920.1| Protein cubitus interruptus [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380020862|ref|XP_003694296.1| PREDICTED: transcriptional activator cubitus interruptus-like [Apis florea] Back     alignment and taxonomy information
>gi|383855083|ref|XP_003703048.1| PREDICTED: transcriptional activator cubitus interruptus-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350420960|ref|XP_003492685.1| PREDICTED: transcriptional activator cubitus interruptus-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340713212|ref|XP_003395140.1| PREDICTED: transcriptional activator cubitus interruptus-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328776907|ref|XP_624136.3| PREDICTED: transcriptional activator cubitus interruptus [Apis mellifera] Back     alignment and taxonomy information
>gi|242002200|ref|XP_002435743.1| zinc finger protein, putative [Ixodes scapularis] gi|215499079|gb|EEC08573.1| zinc finger protein, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query486
FB|FBgn0004859 1397 ci "cubitus interruptus" [Dros 0.185 0.064 0.766 1.6e-79
UNIPROTKB|P10070 1586 GLI2 "Zinc finger protein GLI2 0.146 0.044 0.760 1.3e-60
UNIPROTKB|F1MCY1 1548 GLI2 "Uncharacterized protein" 0.146 0.045 0.760 7.5e-58
UNIPROTKB|F1NMS7 1537 GLI3 "Transcriptional activato 0.234 0.074 0.540 1.6e-57
UNIPROTKB|Q91690 1360 gli1 "Zinc finger protein GLI1 0.481 0.172 0.431 5.1e-57
UNIPROTKB|H9L0M4542 GLI1 "Zinc finger protein GLI1 0.481 0.431 0.414 2e-53
UNIPROTKB|P55878556 GLI1 "Zinc finger protein GLI1 0.481 0.420 0.414 2e-53
ZFIN|ZDB-GENE-030321-1 1404 gli1 "GLI-Kruppel family membe 0.473 0.163 0.404 1.3e-51
UNIPROTKB|A6H727 1105 GLI1 "GLI1 protein" [Bos tauru 0.534 0.235 0.381 1.6e-50
ZFIN|ZDB-GENE-990706-8 1439 gli2a "GLI-Kruppel family memb 0.232 0.078 0.529 5.4e-50
FB|FBgn0004859 ci "cubitus interruptus" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 1.6e-79, Sum P(4) = 1.6e-79
 Identities = 69/90 (76%), Positives = 75/90 (83%)

Query:   210 KYEPGDFVETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQ 269
             K EPGDF+ETNCHW+ C +EF TQD LVKHINNDHI  NKK+F+CRWEDCTR EKPFKAQ
Sbjct:   442 KDEPGDFIETNCHWRSCRIEFITQDELVKHINNDHIQTNKKAFVCRWEDCTRGEKPFKAQ 501

Query:   270 YMLVVHMRRHTGEKPHKCTDLEAFDTSSRV 299
             YMLVVHMRRHTGEKPHKCT    F   SR+
Sbjct:   502 YMLVVHMRRHTGEKPHKCTFEGCFKAYSRL 531
GO:0007367 "segment polarity determination" evidence=IMP
GO:0035224 "genital disc anterior/posterior pattern formation" evidence=IEP
GO:0060914 "heart formation" evidence=IMP
GO:0007224 "smoothened signaling pathway" evidence=IEP;NAS;IMP;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0048477 "oogenesis" evidence=IEP
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IGI;IMP;IDA;TAS
GO:0043234 "protein complex" evidence=IPI
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=TAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS
GO:0005634 "nucleus" evidence=IDA;NAS
GO:0005515 "protein binding" evidence=IPI
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IGI
GO:0030707 "ovarian follicle cell development" evidence=TAS
GO:0035301 "Hedgehog signaling complex" evidence=IPI
GO:0007346 "regulation of mitotic cell cycle" evidence=IMP
GO:0007350 "blastoderm segmentation" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016020 "membrane" evidence=IDA
GO:0035217 "labial disc development" evidence=IMP
GO:0048100 "wing disc anterior/posterior pattern formation" evidence=IMP
GO:0045750 "positive regulation of S phase of mitotic cell cycle" evidence=IMP
GO:0035277 "spiracle morphogenesis, open tracheal system" evidence=IMP
GO:0035017 "cuticle pattern formation" evidence=IMP
GO:0048666 "neuron development" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0008544 "epidermis development" evidence=IMP
GO:0048592 "eye morphogenesis" evidence=IMP
GO:0030858 "positive regulation of epithelial cell differentiation" evidence=IMP
GO:0044212 "transcription regulatory region DNA binding" evidence=IDA
UNIPROTKB|P10070 GLI2 "Zinc finger protein GLI2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCY1 GLI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMS7 GLI3 "Transcriptional activator GLI3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q91690 gli1 "Zinc finger protein GLI1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0M4 GLI1 "Zinc finger protein GLI1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P55878 GLI1 "Zinc finger protein GLI1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030321-1 gli1 "GLI-Kruppel family member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A6H727 GLI1 "GLI1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990706-8 gli2a "GLI-Kruppel family member GLI2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information 
 Score = 35.8 bits (83), Expect = 0.002
 Identities = 12/18 (66%), Positives = 13/18 (72%)

Query: 271 MLVVHMRRHTGEKPHKCT 288
            L  HMR HTGEKP+KC 
Sbjct: 1   NLRRHMRTHTGEKPYKCP 18

Length = 26

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 486
KOG2462|consensus279 99.89
KOG2462|consensus279 99.88
KOG3608|consensus467 99.74
KOG1074|consensus 958 99.73
KOG3623|consensus1007 99.73
KOG3608|consensus467 99.7
KOG1074|consensus958 99.64
KOG3576|consensus267 99.55
KOG3623|consensus 1007 99.37
KOG3576|consensus267 99.36
PLN03086567 PRLI-interacting factor K; Provisional 98.87
PLN03086567 PRLI-interacting factor K; Provisional 98.7
PHA00733128 hypothetical protein 98.68
PHA0276855 hypothetical protein; Provisional 98.64
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.38
PHA00733128 hypothetical protein 98.27
PHA0276855 hypothetical protein; Provisional 98.11
PHA0061644 hypothetical protein 98.04
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.02
PHA0061644 hypothetical protein 97.93
KOG3993|consensus500 97.9
KOG3993|consensus500 97.8
PHA0073279 hypothetical protein 97.73
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.64
COG5189423 SFP1 Putative transcriptional repressor regulating 97.48
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.32
COG5189423 SFP1 Putative transcriptional repressor regulating 97.2
PHA0073279 hypothetical protein 97.11
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.11
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.02
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.86
COG5048467 FOG: Zn-finger [General function prediction only] 96.76
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.71
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.22
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.21
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.95
KOG2231|consensus 669 95.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.79
COG5048467 FOG: Zn-finger [General function prediction only] 95.75
smart0035526 ZnF_C2H2 zinc finger. 95.61
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.47
PRK04860160 hypothetical protein; Provisional 95.13
smart0035526 ZnF_C2H2 zinc finger. 94.87
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.78
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.13
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 93.42
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.39
PRK04860160 hypothetical protein; Provisional 92.39
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.33
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 91.32
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 89.99
KOG4377|consensus480 87.91
KOG2231|consensus 669 86.72
KOG1146|consensus 1406 86.43
COG5236493 Uncharacterized conserved protein, contains RING Z 86.23
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 84.54
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.73
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 83.07
KOG4173|consensus253 81.65
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 81.46
KOG2482|consensus423 80.14
>KOG2462|consensus Back     alignment and domain information 
Probab=99.89  E-value=7.9e-24  Score=199.79  Aligned_cols=135  Identities=24%  Similarity=0.303  Sum_probs=118.4

Q ss_pred             ccceecCCCCCCCCCHHHHHHhhhcccccC---CCCcccccCCCCCCCCCcCCChHHHHHHhhhhcCCCCccCCCCCCCC
Q psy16294        218 ETNCHWKDCGLEFGTQDILVKHINNDHIHA---NKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFD  294 (486)
Q Consensus       218 ~~~~~C~~C~k~F~~~~~L~~H~~~~~~H~---~ek~~~C~~~~C~~C~k~F~~~~~L~~H~r~Htgekpy~C~~C~c~~  294 (486)
                      ...|+|.+|||.|.+..+|.+|..   +|-   ..+.+.|     .+|+|.|..-..|..|+|+|+  -+++|.+||   
T Consensus       128 ~~r~~c~eCgk~ysT~snLsrHkQ---~H~~~~s~ka~~C-----~~C~K~YvSmpALkMHirTH~--l~c~C~iCG---  194 (279)
T KOG2462|consen  128 HPRYKCPECGKSYSTSSNLSRHKQ---THRSLDSKKAFSC-----KYCGKVYVSMPALKMHIRTHT--LPCECGICG---  194 (279)
T ss_pred             CCceeccccccccccccccchhhc---ccccccccccccC-----CCCCceeeehHHHhhHhhccC--CCccccccc---
Confidence            457999999999999999999998   564   4566777     555999999999999999998  689999988   


Q ss_pred             cchhhhhceecCccccCCccccccccccccchhhhhhhhccccccccccccccccChhhHHHHHhhcCCCCccccCcccc
Q psy16294        295 TSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENC  374 (486)
Q Consensus       295 ~~~~~~~~~H~~ek~F~~~~~L~~H~~~~H~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~ekpy~C~~~gC  374 (486)
                                   |.|....-|+.|+ |+|         .+||||.|+.|+|.|..+++|+.||++|.+.|+|+|..  |
T Consensus       195 -------------KaFSRPWLLQGHi-RTH---------TGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~--C  249 (279)
T KOG2462|consen  195 -------------KAFSRPWLLQGHI-RTH---------TGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPR--C  249 (279)
T ss_pred             -------------ccccchHHhhccc-ccc---------cCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcc--h
Confidence                         5777888888888 888         88999999999999999999999999999999999988  9


Q ss_pred             cccccChhhHHHHHHh
Q psy16294        375 TKRYTDPSSLRKHIKT  390 (486)
Q Consensus       375 gK~F~~~s~L~~H~k~  390 (486)
                      +|+|..++.|.+|...
T Consensus       250 ~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  250 GKSFALKSYLNKHSES  265 (279)
T ss_pred             hhHHHHHHHHHHhhhh
Confidence            9999999999998865

>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG4377|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-32
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-10
2ej4_A95 Functional And Structural Basis Of Nuclear Localiza 5e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-04
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure 
Iteration: 1

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 99/176 (56%), Gaps = 21/176 (11%)
Query: 218 ETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMR 277
           ET+C W  C  EF +Q+ LV HIN++HIH  +K F+C W  C+R+ +PFKAQYMLVVHMR
Sbjct: 1   ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMR 60
Query: 278 RHTGEKPHKCTDLEAFDTSSRVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMR 337
           RHTGEKPHKCT    F+   +  +R             L  ++   R +     ++  M 
Sbjct: 61  RHTGEKPHKCT----FEGCRKSYSR-------------LENLKTHLRSH---TGEKPYMC 100
Query: 338 RIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTVHA 393
             E       +  S   + +  +    KPYVC    CTKRYTDPSSLRKH+KTVH 
Sbjct: 101 EHE-GCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHG 155
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EJ4|A Chain A, Functional And Structural Basis Of Nuclear Localization Signal In Zic3 Zinc Finger Domain: A Role Of Conserved Tryptophan Residue In The Zinc Finger Domain Length = 95 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query486
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-25
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-09
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 1e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-09
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-06
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
 Score =  113 bits (286), Expect = 4e-30
 Identities = 46/83 (55%), Positives = 58/83 (69%), Gaps = 3/83 (3%)

Query: 218 ETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMR 277
           ET+C W  C  EF +Q+ LV HIN++HIH  +K F+C W  C+R+ +PFKAQYMLVVHMR
Sbjct: 1   ETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMR 60

Query: 278 RHTGEKPHKCTDLE---AFDTSS 297
           RHTGEKPHKCT      ++    
Sbjct: 61  RHTGEKPHKCTFEGCRKSYSRLE 83
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Length = 64 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.95
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.83
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.83
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.79
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.78
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.77
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.76
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.72
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.69
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.68
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.66
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.62
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.61
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.6
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.59
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.59
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.59
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.55
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.55
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.53
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.52
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.51
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.5
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.5
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.49
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.48
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.47
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.45
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.44
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.44
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.43
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.4
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.39
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.37
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.37
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.34
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.34
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.33
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.33
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.32
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.3
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.26
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.25
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.21
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.19
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.17
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.17
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.14
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.1
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.02
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.02
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.0
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.0
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 98.97
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.96
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.95
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.94
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 98.93
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.93
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.93
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 98.92
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.92
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.91
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.91
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.91
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.88
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.87
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.86
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.86
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.86
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.85
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.82
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.82
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.79
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.78
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.77
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.76
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.76
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.76
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.75
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.75
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.75
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.74
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.74
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.72
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.72
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.72
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.71
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.7
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.7
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.69
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.69
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.69
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.68
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.67
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.67
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.67
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.64
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.64
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.64
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.63
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.62
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.6
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.58
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.55
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.52
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.5
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.49
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.42
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.41
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.41
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.41
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.34
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.31
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.28
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.28
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.25
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.19
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.13
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.13
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.13
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.1
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.1
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.08
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.05
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.04
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.04
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.03
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.0
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.0
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.97
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.97
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.97
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.96
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.18
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.16
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.9
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.9
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.86
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.76
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.76
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.75
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.94
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.74
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.74
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.73
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.68
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.66
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.62
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.78
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.61
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.73
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.57
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.53
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.52
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.52
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.5
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.42
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.3
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.38
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.08
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.07
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.09
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.42
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.15
2e72_A49 POGO transposable element with ZNF domain; zinc fi 91.04
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 87.56
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 83.92
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 83.56
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=7.3e-31  Score=243.50  Aligned_cols=172  Identities=24%  Similarity=0.363  Sum_probs=139.0

Q ss_pred             ccceecCCCCCCCCCHHHHHHhhhcccccCCCCcccccCCCCCCCCCcCCChHHHHHHhhhhcCCCCccCCCCCCCCcch
Q psy16294        218 ETNCHWKDCGLEFGTQDILVKHINNDHIHANKKSFICRWEDCTRDEKPFKAQYMLVVHMRRHTGEKPHKCTDLEAFDTSS  297 (486)
Q Consensus       218 ~~~~~C~~C~k~F~~~~~L~~H~~~~~~H~~ek~~~C~~~~C~~C~k~F~~~~~L~~H~r~Htgekpy~C~~C~c~~~~~  297 (486)
                      +++|.|+.|++.|.....|..|++   +|.++++|.|  ..|   ++.|.....|..|+++|.++++|+|++|+      
T Consensus        19 ~~~~~C~~C~~~f~~~~~l~~H~~---~h~~~~~~~C--~~C---~~~f~~~~~l~~H~~~h~~~~~~~C~~C~------   84 (190)
T 2i13_A           19 EKPYACPECGKSFSRSDHLAEHQR---THTGEKPYKC--PEC---GKSFSDKKDLTRHQRTHTGEKPYKCPECG------   84 (190)
T ss_dssp             ------------CCSSHHHHHGGG---CC---CCEEC--TTT---CCEESSHHHHHHHHHHHHCCCCEECTTTC------
T ss_pred             CCCCcCCCCccccCCHHHHHHHHH---HcCCCCCccC--CCc---CchhCCHHHHHHHHHhcCCCCCccCcccC------
Confidence            567999999999999999999998   8999999999  555   99999999999999999999999999997      


Q ss_pred             hhhhceecCccccCCccccccccccccchhhhhhhhccccccccccccccccChhhHHHHHhhcCCCCccccCccccccc
Q psy16294        298 RVAARRIRGWKISRRISDLIPVRNRTRVNILAVVKRLVMRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKR  377 (486)
Q Consensus       298 ~~~~~~H~~ek~F~~~~~L~~H~~~~H~~~~~~~~~~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~ekpy~C~~~gCgK~  377 (486)
                                +.|.....|..|+ ++|         .++++|.|++|++.|.....|..|+++|.++++|.|++  |++.
T Consensus        85 ----------~~f~~~~~l~~H~-~~h---------~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~  142 (190)
T 2i13_A           85 ----------KSFSQRANLRAHQ-RTH---------TGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPE--CGKS  142 (190)
T ss_dssp             ----------CEESCHHHHHHHH-HHH---------HTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTT--TCCE
T ss_pred             ----------CccCCHHHHHHHH-Hhc---------CCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCC--CCcc
Confidence                      5788888999999 666         56789999999999999999999999999999999999  9999


Q ss_pred             ccChhhHHHHHHhhcCCCCCCCCCCCCcchhchhhhhhccccccccccccc
Q psy16294        378 YTDPSSLRKHIKTVHAPASLNPVPQHKDMQDIQSNEVTQSNMRQSTYQRTL  428 (486)
Q Consensus       378 F~~~s~L~~H~k~hh~~~~~~c~~c~~~~~~~~~~~~~~~h~~~h~~~~~~  428 (486)
                      |.+...|..|+++|+++++|.|..|.+.|.....   ++.|++.|+++++|
T Consensus       143 f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~---L~~H~~~H~~~k~~  190 (190)
T 2i13_A          143 FSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDA---LNVHQRTHTGKKTS  190 (190)
T ss_dssp             ESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHH---HHHHHTTC------
T ss_pred             cCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHH---HHHHHHhcCCCCCC
Confidence            9999999999999999999999999888765554   55688999988874
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 486
d2glia132 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo 5e-17
d2glia233 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo 8e-17
d2glia529 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo 2e-11
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 8e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.001
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.003
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d2dlqa427 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 0.004
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Five-finger GLI1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 72.2 bits (177), Expect = 5e-17
 Identities = 16/32 (50%), Positives = 22/32 (68%)

Query: 218 ETNCHWKDCGLEFGTQDILVKHINNDHIHANK 249
           ET+C W  C  EF +Q+ LV HIN++HIH  +
Sbjct: 1   ETDCRWDGCSQEFDSQEQLVHHINSEHIHGER 32
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 27 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query486
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.51
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.31
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.14
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.09
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.08
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.05
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.02
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.01
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.0
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.93
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.92
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.83
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.82
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.79
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.76
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.71
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.7
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.68
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.67
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.59
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.58
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.58
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.57
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.57
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.5
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.48
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.47
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.31
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.3
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.22
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 98.1
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 97.99
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.93
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.88
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.79
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.79
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.63
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.5
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.49
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.43
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.42
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.36
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.36
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.24
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.17
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.11
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.02
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.95
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.93
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.59
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.5
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.49
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.43
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.16
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.11
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.0
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.97
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.91
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.87
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.85
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.84
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.69
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.63
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.48
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.18
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 95.17
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.02
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.6
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.75
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 93.61
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.58
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.49
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.24
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.07
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.96
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.83
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 92.51
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.48
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.28
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.74
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.93
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.9
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.42
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.32
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.11
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.96
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 89.95
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 88.12
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.51  E-value=2.7e-15  Score=107.57  Aligned_cols=53  Identities=19%  Similarity=0.253  Sum_probs=51.1

Q ss_pred             ccccccccccccccChhhHHHHHhhcCCCCccccCcccccccccChhhHHHHHHhh
Q psy16294        336 MRRIELNIRTELTLMSLNVQFEILSRPKLKPYVCGEENCTKRYTDPSSLRKHIKTV  391 (486)
Q Consensus       336 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~ekpy~C~~~gCgK~F~~~s~L~~H~k~h  391 (486)
                      +++|+|+ ||+.|..+..|..|+++|+|++||.|++  ||++|.+.+.|.+|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCC--cCCEecCHHHHHHHHhcC
Confidence            5899995 9999999999999999999999999999  999999999999999987
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure