Psyllid ID: psy16323


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MIAPFDKHVFTEADYLPSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGHQKSPKGLEPKPAQISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGLLDEDTDEEDL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHccccccccccccHHHHHHHHHHHHHHHcccHHccccccccccccccccHHHHHHccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEEccHHHHHHHccccEEccEEEEEcccccEEEEEcccEEEccHHHccEEcEcccccccccEEEEEEEEcHcccccccccccccccccccccccHHHHHHccccccccHccc
miapfdkhvfteadylpstvterplepdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpssapdlpgpsstvlgsylgeaghqkspkglepkpaqISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQlpqqayttnsfapmdpskddTVILLFIKTCIqlpqqayttnsfapmdrwthpskaatflglldedtdeedl
miapfdkhvfteadylpstvTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGHQKSPKGLEPKPAQISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAAtflglldedtdeedl
MIAPFDKHVFTEADYLPSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGHQKSPKGLEPKPAQISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFlglldedtdeedl
*******************************************************************************************************************************************************************************************************************************************************************************************************************************QISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPM***KDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGL**********
**APF*********************************************************************************************************************************************************************************************************************************************************************************************************************************************HFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGLLD********
MIAPFDKHVFTEADYLPSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEA********LEPKPAQISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGLLDEDTDEEDL
*********************************************************************************************************************************************************************************************************************************************************************************************************************************SFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGLLD********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIAPFDKHVFTEADYLPSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGHQKSPKGLEPKPAQISFVLNIFANFHQTLRFLHFSCTSLVVTRATVVKLPLYILTVEDDTVILLFIETFIQLPQQAYTTNSFAPMDPSKDDTVILLFIKTCIQLPQQAYTTNSFAPMDRWTHPSKAATFLGLLDEDTDEEDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query448 2.2.26 [Sep-21-2011]
Q9GLP1 2258 Coagulation factor V OS=S yes N/A 0.631 0.125 0.311 2e-26
Q28107 2211 Coagulation factor V OS=B yes N/A 0.569 0.115 0.389 2e-19
P27393 1763 Collagen alpha-2(IV) chai N/A N/A 0.600 0.152 0.353 1e-16
Q6UXY8 1006 Transmembrane channel-lik no N/A 0.5 0.222 0.327 6e-16
Q06852 2313 Cell surface glycoprotein yes N/A 0.600 0.116 0.421 6e-13
P02462 1669 Collagen alpha-1(IV) chai yes N/A 0.564 0.151 0.294 2e-09
Q96P44957 Collagen alpha-1(XXI) cha no N/A 0.604 0.283 0.278 5e-09
P02463 1669 Collagen alpha-1(IV) chai yes N/A 0.620 0.166 0.295 1e-07
O42854 1611 SH3 domain-containing pro yes N/A 0.305 0.085 0.468 2e-07
P18583 2426 Protein SON OS=Homo sapie no N/A 0.493 0.091 0.317 2e-07
>sp|Q9GLP1|FA5_PIG Coagulation factor V OS=Sus scrofa GN=F5 PE=2 SV=1 Back     alignment and function desciption
 Score =  120 bits (301), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 89/286 (31%), Positives = 151/286 (52%), Gaps = 3/286 (1%)

Query: 20   VTERPLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSS 79
            +++  L PDL   + +PDL   + +PDL   + +PDL   + +PDL   + +PDL   + 
Sbjct: 1200 LSQTTLSPDLSHTTLSPDLGHTTLSPDLSHTTLSPDLSQTTLSPDLSHTTLSPDLGHTTL 1259

Query: 80   APDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPG 139
            +PDL   + +PDL   + +PDL   + +PDL   + +PDL   + +PD    + +PDL  
Sbjct: 1260 SPDLSHTTLSPDLGHATLSPDLSHTTLSPDLGHTTLSPDLGHTTLSPDFSQTTLSPDLGH 1319

Query: 140  PSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPD 199
             + + D+   + +PDL   + +PDL   + +PDL   + +PDL   + +PDL   + +PD
Sbjct: 1320 TTLSSDVSHTTLSPDLSHTTLSPDLSHTTLSPDLGHTTLSPDLSQTTLSPDLGHMTLSPD 1379

Query: 200  LPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSS 259
            L   + +PDL   + +PDL   + +PDL   + +PDL   + + D    + +PDL   + 
Sbjct: 1380 LSHTTLSPDLGHTTLSPDLSHTTLSPDLGHMTLSPDLGQTTLSLDFGQTTLSPDLSHMTL 1439

Query: 260  APDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEA 305
            + +L   + +PDL   + +PDL     +PDL     T L S L E 
Sbjct: 1440 SSELSHETLSPDLSQVTLSPDLSEIPFSPDLW---QTTLSSDLNET 1482




Coagulation factor V is a cofactor that participates with factor Xa to activate prothrombin to thrombin.
Sus scrofa (taxid: 9823)
>sp|Q28107|FA5_BOVIN Coagulation factor V OS=Bos taurus GN=F5 PE=1 SV=1 Back     alignment and function description
>sp|P27393|CO4A2_ASCSU Collagen alpha-2(IV) chain OS=Ascaris suum PE=2 SV=1 Back     alignment and function description
>sp|Q6UXY8|TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens GN=TMC5 PE=2 SV=3 Back     alignment and function description
>sp|Q06852|SLAP1_CLOTH Cell surface glycoprotein 1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237) GN=olpB PE=4 SV=2 Back     alignment and function description
>sp|P02462|CO4A1_HUMAN Collagen alpha-1(IV) chain OS=Homo sapiens GN=COL4A1 PE=1 SV=3 Back     alignment and function description
>sp|Q96P44|COLA1_HUMAN Collagen alpha-1(XXI) chain OS=Homo sapiens GN=COL21A1 PE=2 SV=1 Back     alignment and function description
>sp|P02463|CO4A1_MOUSE Collagen alpha-1(IV) chain OS=Mus musculus GN=Col4a1 PE=2 SV=4 Back     alignment and function description
>sp|O42854|YFHH_SCHPO SH3 domain-containing protein C23A1.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23A1.17 PE=1 SV=1 Back     alignment and function description
>sp|P18583|SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
156375703268 predicted protein [Nematostella vectensi 0.558 0.932 0.407 2e-32
61652784405 circumsporozoite protein [Plasmodium viv 0.522 0.577 0.348 1e-30
326677446 1720 PREDICTED: hypothetical protein LOC10033 0.613 0.159 0.312 9e-30
396480997513 predicted protein [Leptosphaeria maculan 0.502 0.438 0.396 1e-28
350633524166 hypothetical protein ASPNIDRAFT_183966 [ 0.366 0.987 0.451 2e-28
260796019 1602 hypothetical protein BRAFLDRAFT_117784 [ 0.529 0.147 0.298 4e-25
328701310 869 PREDICTED: hypothetical protein LOC10016 0.332 0.171 0.487 4e-25
160165396 circumsporozoite protein [Plasmodium sim 0.421 0.477 0.361 1e-24
47523048 2258 coagulation factor V precursor [Sus scro 0.631 0.125 0.311 1e-24
163637044213 circumsporozoite protein variant VK247 [ 0.399 0.840 0.362 1e-24
>gi|156375703|ref|XP_001630219.1| predicted protein [Nematostella vectensis] gi|156217235|gb|EDO38156.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 108/265 (40%), Positives = 122/265 (46%), Gaps = 15/265 (5%)

Query: 16  LPSTVTERPL--EPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPD------LPG 67
           LP   T R +     + GPS    LPGPS+   LPGP     LPG  +  +      + G
Sbjct: 3   LPGQCTRREVLTRYVMVGPSVYMVLPGPSAYMVLPGPLVCMVLPGQCTRREVLARYVMVG 62

Query: 68  PSSAPDLPGPSSAPDLPGPSSAPDLPGPSSA-PDLPGPSSAPDLPGPSSAPDLPGPSSAP 126
           PS    LPG S    LP PS    LPG       LPGPS    LPGPS    LPGP    
Sbjct: 63  PSVYMVLPGASVCMVLPEPSVCMVLPGQEVCGMVLPGPSVCMVLPGPSVCMVLPGPLVCM 122

Query: 127 DLPGPSSAPD---LPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLP 183
            LPG  +      +PGP     LPGPS    L GPS    LPGPS    LPGP     LP
Sbjct: 123 VLPGQCTRRGFVWMPGPLVCMVLPGPSVCMVLAGPSVCMVLPGPSVCMVLPGPLVCMVLP 182

Query: 184 GPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAP 243
           G  +  ++    +   + GPS    LPG S    LPGPS    LPGPS    LPGPS   
Sbjct: 183 GQCTRREV---LTRYVVVGPSVYMVLPGASVCMVLPGPSVCMVLPGPSVCMVLPGPSVCM 239

Query: 244 DLPGPSSAPDLPGPSSAPDLPGPSS 268
            LPGPS    LPGP     LPG  +
Sbjct: 240 VLPGPSVCMVLPGPLVCMVLPGQCT 264




Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota

>gi|61652784|gb|AAX47962.1| circumsporozoite protein [Plasmodium vivax] Back     alignment and taxonomy information
>gi|326677446|ref|XP_002661995.2| PREDICTED: hypothetical protein LOC100334539 [Danio rerio] Back     alignment and taxonomy information
>gi|396480997|ref|XP_003841132.1| predicted protein [Leptosphaeria maculans JN3] gi|312217706|emb|CBX97653.1| predicted protein [Leptosphaeria maculans JN3] Back     alignment and taxonomy information
>gi|350633524|gb|EHA21889.1| hypothetical protein ASPNIDRAFT_183966 [Aspergillus niger ATCC 1015] Back     alignment and taxonomy information
>gi|260796019|ref|XP_002593002.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae] gi|229278226|gb|EEN49013.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|328701310|ref|XP_001950899.2| PREDICTED: hypothetical protein LOC100165925 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|160165|gb|AAA70381.1| circumsporozoite protein [Plasmodium simium] Back     alignment and taxonomy information
>gi|47523048|ref|NP_999285.1| coagulation factor V precursor [Sus scrofa] gi|18202922|sp|Q9GLP1.1|FA5_PIG RecName: Full=Coagulation factor V; AltName: Full=Activated protein C cofactor; Contains: RecName: Full=Coagulation factor V heavy chain; Contains: RecName: Full=Coagulation factor V light chain; Flags: Precursor gi|11065896|gb|AAG28381.1|AF191308_1 coagulation factor V [Sus scrofa] Back     alignment and taxonomy information
>gi|163637044|gb|ABY27340.1| circumsporozoite protein variant VK247 [Plasmodium vivax] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
POMBASE|SPAC23A1.17 1611 SPAC23A1.17 "WIP family cytosk 0.613 0.170 0.451 4.8e-52
UNIPROTKB|P15941 1255 MUC1 "Mucin-1" [Homo sapiens ( 0.587 0.209 0.501 1.2e-45
UNIPROTKB|F1RXI2425 LOC100737091 "Uncharacterized 0.620 0.654 0.381 5.2e-42
UNIPROTKB|D2CFI5508 TPRX1 "CRX like homeobox 2" [H 0.540 0.476 0.438 1.7e-41
UNIPROTKB|Q8N7U7411 TPRX1 "Tetra-peptide repeat ho 0.540 0.588 0.438 1.7e-41
UNIPROTKB|F1NDF5 1658 COL4A5 "Uncharacterized protei 0.642 0.173 0.375 3.7e-41
UNIPROTKB|F1LUN5 799 Col4a5 "Protein Col4a5" [Rattu 0.656 0.367 0.367 1.1e-40
UNIPROTKB|F1N474 1688 COL4A5 "Uncharacterized protei 0.649 0.172 0.371 1.3e-40
UNIPROTKB|J9P9L4 1691 COL4A5 "Collagen alpha-5(IV) c 0.629 0.166 0.372 2.7e-40
UNIPROTKB|F1PH05 1693 COL4A5 "Collagen alpha-5(IV) c 0.629 0.166 0.372 2.8e-40
POMBASE|SPAC23A1.17 SPAC23A1.17 "WIP family cytoskeletal protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
 Score = 553 (199.7 bits), Expect = 4.8e-52, P = 4.8e-52
 Identities = 135/299 (45%), Positives = 181/299 (60%)

Query:    17 PSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGP-SSAPDLPGPSSAPDLPGPSS-APDL 74
             PS     P+   L  P+S P    P SAP L  P S++P  P  +  P +P  SS AP +
Sbjct:   967 PSIPPPLPVSNILSSPTSEPPKDHPPSAP-LSKPVSTSPAAP-LARVPPVPKLSSKAPPV 1024

Query:    75 PGPSS-APDLPGPSSAPDLPGPSSAPDLP-----GPSSAPDLPGPSSA-PDLPGPSSAPD 127
             P PS+ AP +P PS+AP +P P+S P +P      PS+ P +P PSS  P +P PS AP 
Sbjct:  1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084

Query:   128 LPGPSSAPDLPGPS-SAPDLPGPSSA-PDLPGPSSAPDLPGPS-SAPDLPGPSSAPDLPG 184
             +P PS  P +P PS +AP +P PS A P +P PS AP +P PS +AP +P PS AP +P 
Sbjct:  1085 VPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPK 1144

Query:   185 PS-SAPDLPGPSSAPDLPGPS-SAPDLPGPSSA-PDLPGPSSA-PDLPGPSSAPDLPGPS 240
             PS +AP +P PS AP +P PS +AP +P PSS  P +P P++  P +P PS AP +P PS
Sbjct:  1145 PSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPS 1204

Query:   241 -SAPDLPGPSSAPDLPGPSSA-PDLPGPSS-APDLPGPSS-APDLPGPSSAPDLPGPSS 295
                P +P PS+AP +P PS+  P +P P++ AP +P PSS AP +  P S+  +P P S
Sbjct:  1205 VGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSS--VPSPHS 1261


GO:0005829 "cytosol" evidence=IDA
GO:0017024 "myosin I binding" evidence=ISO
GO:0030036 "actin cytoskeleton organization" evidence=ISO
GO:0030479 "actin cortical patch" evidence=ISO
GO:0032153 "cell division site" evidence=IDA
GO:0051286 "cell tip" evidence=IDA
UNIPROTKB|P15941 MUC1 "Mucin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXI2 LOC100737091 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D2CFI5 TPRX1 "CRX like homeobox 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N7U7 TPRX1 "Tetra-peptide repeat homeobox protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDF5 COL4A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LUN5 Col4a5 "Protein Col4a5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N474 COL4A5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9L4 COL4A5 "Collagen alpha-5(IV) chain" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PH05 COL4A5 "Collagen alpha-5(IV) chain" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 2e-15
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 4e-15
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-14
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-13
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 2e-13
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 6e-13
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 9e-13
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-12
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-12
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 4e-12
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 5e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 9e-12
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-11
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 1e-11
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-11
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-11
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 3e-11
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 1e-10
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-10
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-10
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-09
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-09
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 2e-09
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 4e-09
PRK12323700 PRK12323, PRK12323, DNA polymerase III subunits ga 1e-08
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-08
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 6e-08
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 2e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 2e-07
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 3e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 4e-07
PRK14086 617 PRK14086, dnaA, chromosomal replication initiation 5e-07
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 1e-06
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 2e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 3e-06
PRK14086617 PRK14086, dnaA, chromosomal replication initiation 5e-06
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 6e-06
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 7e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 8e-06
pfam04652315 pfam04652, DUF605, Vta1 like 1e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PHA03307 1352 PHA03307, PHA03307, transcriptional regulator ICP4 2e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
pfam04652315 pfam04652, DUF605, Vta1 like 2e-05
PRK07003830 PRK07003, PRK07003, DNA polymerase III subunits ga 3e-05
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 8e-05
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 1e-04
pfam04652315 pfam04652, DUF605, Vta1 like 1e-04
pfam04652315 pfam04652, DUF605, Vta1 like 1e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 2e-04
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 4e-04
PRK07764824 PRK07764, PRK07764, DNA polymerase III subunits ga 6e-04
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 6e-04
pfam04652315 pfam04652, DUF605, Vta1 like 7e-04
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.001
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
PHA03247 3151 PHA03247, PHA03247, large tegument protein UL36; P 0.002
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.002
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK14959624 PRK14959, PRK14959, DNA polymerase III subunits ga 0.002
PRK07764 824 PRK07764, PRK07764, DNA polymerase III subunits ga 0.003
PRK07003 830 PRK07003, PRK07003, DNA polymerase III subunits ga 0.003
pfam03154 979 pfam03154, Atrophin-1, Atrophin-1 family 0.003
PRK14951618 PRK14951, PRK14951, DNA polymerase III subunits ga 0.003
pfam05518753 pfam05518, Totivirus_coat, Totivirus coat protein 0.003
PRK14950585 PRK14950, PRK14950, DNA polymerase III subunits ga 0.003
pfam04484313 pfam04484, DUF566, Family of unknown function (DUF 0.003
PHA032473151 PHA03247, PHA03247, large tegument protein UL36; P 0.004
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
 Score = 79.6 bits (196), Expect = 1e-15
 Identities = 81/314 (25%), Positives = 104/314 (33%), Gaps = 11/314 (3%)

Query: 17   PSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPG-PSSAPDLPGPSSAPDLPGPSSAPDLP 75
            P     RP EP +   +  PD P  S+ P  P      P  P P S       +  P  P
Sbjct: 2570 PPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPP 2629

Query: 76   GPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAP 135
             PS A + P P   P +P P    D P P                  SS P  P   +A 
Sbjct: 2630 SPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAAR 2689

Query: 136  DLPGP-SSAPDLPGPSSAPDLPGPSSAPDLPGP----SSAPDLPGPSSAPDLPGPSSAPD 190
               G  +S  D P P   P+    +     P P    ++    P   +AP  P   + P 
Sbjct: 2690 PTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPA 2749

Query: 191  LPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPS---SAPDLPGPSSAPDLPG 247
             PG  + P  P  ++ P  P P +AP    P         S   S   LP P    D P 
Sbjct: 2750 TPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPA 2809

Query: 248  PSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGH 307
               AP    P +A   P     P      +AP  P     P LP   S   G  +     
Sbjct: 2810 AVLAPAAALPPAAS--PAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPP 2867

Query: 308  QKSPKGLEPKPAQI 321
             +SP      PA+ 
Sbjct: 2868 SRSPAAKPAAPARP 2881


Length = 3151

>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|218191 pfam04652, DUF605, Vta1 like Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family Back     alignment and domain information
>gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein Back     alignment and domain information
>gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>gnl|CDD|218107 pfam04484, DUF566, Family of unknown function (DUF566) Back     alignment and domain information
>gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 448
KOG3546|consensus1167 99.95
KOG3546|consensus 1167 99.93
smart00038232 COLFI Fibrillar collagens C-terminal domain. Found 99.87
PF01410214 COLFI: Fibrillar collagen C-terminal domain; Inter 99.83
>KOG3546|consensus Back     alignment and domain information
Probab=99.95  E-value=2e-25  Score=234.92  Aligned_cols=15  Identities=20%  Similarity=0.239  Sum_probs=7.8

Q ss_pred             eeeeEeccCCceeeh
Q psy16323        357 LYILTVEDDTVILLF  371 (448)
Q Consensus       357 ~~~~~vrkDqk~~WF  371 (448)
                      +-.++.+|+|.-+.|
T Consensus       984 ypmllaek~~pllhl  998 (1167)
T KOG3546|consen  984 YPMLLAEKPQPLLHL  998 (1167)
T ss_pred             ccccCCCCcchhhhh
Confidence            344455555555554



>KOG3546|consensus Back     alignment and domain information
>smart00038 COLFI Fibrillar collagens C-terminal domain Back     alignment and domain information
>PF01410 COLFI: Fibrillar collagen C-terminal domain; InterPro: IPR000885 Collagens contain a large number of globular domains in between the regions of triple helical repeats IPR008160 from INTERPRO Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-14
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 8e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-13
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-13
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 7e-12
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 9e-12
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-11
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-11
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-11
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-11
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-11
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 3e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 4e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 6e-11
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-10
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-10
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 5e-08
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 1e-06
1y0f_A1054 Collagen I alpha 1; native, in SITU, triple-helix, 2e-04
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-14
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-13
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-13
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 5e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 6e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 9e-12
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 3e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 7e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-11
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 1e-10
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-10
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 8e-08
1y0f_B 1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-07
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 4e-07
1y0f_B1026 Collagen I alpha 2; native, in SITU, triple-helix, 2e-04
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-13
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 4e-11
1twf_A1733 B220, DNA-directed RNA polymerase II largest subun 6e-11
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 2e-10
3h0g_A1752 DNA-directed RNA polymerase II subunit RPB1; trans 1e-08
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 3e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-06
1m2v_B 926 SEC24, protein transport protein SEC24, SEC24P, SE 8e-05
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 3e-06
3dzy_A 467 Retinoic acid receptor RXR-alpha; DNA-binding, HOS 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 1e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 3e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3v1v_A 433 2-MIB synthase, 2-methylisoborneol synthase; class 7e-04
3nwa_A 703 GB, GB-1, GB1, envelope glycoprotein B; coiled-coi 7e-04
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 7e-04
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
 Score = 73.2 bits (180), Expect = 7e-14
 Identities = 71/270 (26%), Positives = 88/270 (32%)

Query: 24  PLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDL 83
           P E   PG +  P   G + +P  PGP      PGP+     PGP+  P   G +     
Sbjct: 361 PGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGEDGRPGPAGPPGARGQAGVMGF 420

Query: 84  PGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSA 143
           PGP  A   PG +    +PGP  A    G        GP       G        G    
Sbjct: 421 PGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGF 480

Query: 144 PDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGP 203
             LPGP+  P   G      +PG   AP   G       PG       PGP+      G 
Sbjct: 481 QGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVEGPPGPAGPRGANGA 540

Query: 204 SSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDL 263
                  G + AP  PG   AP L G        G        G +      G      +
Sbjct: 541 PGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGV 600

Query: 264 PGPSSAPDLPGPSSAPDLPGPSSAPDLPGP 293
            G +     PGP+ AP   G +      GP
Sbjct: 601 RGLTGPIGPPGPAGAPGDKGEAGPSGPAGP 630


>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 Back     alignment and structure
>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
3hqv_A 1056 Collagen alpha-1(I) chain; native, in SITU, molecu 99.96
3hqv_A 1056 Collagen alpha-1(I) chain; native, in SITU, molecu 99.96
1y0f_A 1054 Collagen I alpha 1; native, in SITU, triple-helix, 99.95
3hqv_B 1028 Collagen alpha-2(I) chain; native, in SITU, molecu 99.95
4ae2_A256 Procollagen III, collagen alpha-1(III) chain; stru 99.84
>3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A Back     alignment and structure
Probab=99.96  E-value=8.7e-27  Score=265.34  Aligned_cols=7  Identities=14%  Similarity=0.320  Sum_probs=3.1

Q ss_pred             Cccccce
Q psy16323          4 PFDKHVF   10 (448)
Q Consensus         4 ~~~~~~~   10 (448)
                      =||.+..
T Consensus         5 g~~~~~~   11 (1056)
T 3hqv_A            5 GYDEKSA   11 (1056)
T ss_pred             CcCCCcC
Confidence            3444443



>3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A Back     alignment and structure
>1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 1ygv_A 3hqv_A 3hr2_A Back     alignment and structure
>3hqv_B Collagen alpha-2(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_B Back     alignment and structure
>4ae2_A Procollagen III, collagen alpha-1(III) chain; structural protein, fibrillar collagen, extracellular matrix fibrosis; 1.68A {Homo sapiens} PDB: 4aej_A* 4ak3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

No hit with probability above 80.00