Psyllid ID: psy16323
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| 156375703 | 268 | predicted protein [Nematostella vectensi | 0.558 | 0.932 | 0.407 | 2e-32 | |
| 61652784 | 405 | circumsporozoite protein [Plasmodium viv | 0.522 | 0.577 | 0.348 | 1e-30 | |
| 326677446 | 1720 | PREDICTED: hypothetical protein LOC10033 | 0.613 | 0.159 | 0.312 | 9e-30 | |
| 396480997 | 513 | predicted protein [Leptosphaeria maculan | 0.502 | 0.438 | 0.396 | 1e-28 | |
| 350633524 | 166 | hypothetical protein ASPNIDRAFT_183966 [ | 0.366 | 0.987 | 0.451 | 2e-28 | |
| 260796019 | 1602 | hypothetical protein BRAFLDRAFT_117784 [ | 0.529 | 0.147 | 0.298 | 4e-25 | |
| 328701310 | 869 | PREDICTED: hypothetical protein LOC10016 | 0.332 | 0.171 | 0.487 | 4e-25 | |
| 160165 | 396 | circumsporozoite protein [Plasmodium sim | 0.421 | 0.477 | 0.361 | 1e-24 | |
| 47523048 | 2258 | coagulation factor V precursor [Sus scro | 0.631 | 0.125 | 0.311 | 1e-24 | |
| 163637044 | 213 | circumsporozoite protein variant VK247 [ | 0.399 | 0.840 | 0.362 | 1e-24 |
| >gi|156375703|ref|XP_001630219.1| predicted protein [Nematostella vectensis] gi|156217235|gb|EDO38156.1| predicted protein [Nematostella vectensis] | Back alignment and taxonomy information |
|---|
Score = 146 bits (369), Expect = 2e-32, Method: Compositional matrix adjust.
Identities = 108/265 (40%), Positives = 122/265 (46%), Gaps = 15/265 (5%)
Query: 16 LPSTVTERPL--EPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPD------LPG 67
LP T R + + GPS LPGPS+ LPGP LPG + + + G
Sbjct: 3 LPGQCTRREVLTRYVMVGPSVYMVLPGPSAYMVLPGPLVCMVLPGQCTRREVLARYVMVG 62
Query: 68 PSSAPDLPGPSSAPDLPGPSSAPDLPGPSSA-PDLPGPSSAPDLPGPSSAPDLPGPSSAP 126
PS LPG S LP PS LPG LPGPS LPGPS LPGP
Sbjct: 63 PSVYMVLPGASVCMVLPEPSVCMVLPGQEVCGMVLPGPSVCMVLPGPSVCMVLPGPLVCM 122
Query: 127 DLPGPSSAPD---LPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLP 183
LPG + +PGP LPGPS L GPS LPGPS LPGP LP
Sbjct: 123 VLPGQCTRRGFVWMPGPLVCMVLPGPSVCMVLAGPSVCMVLPGPSVCMVLPGPLVCMVLP 182
Query: 184 GPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAP 243
G + ++ + + GPS LPG S LPGPS LPGPS LPGPS
Sbjct: 183 GQCTRREV---LTRYVVVGPSVYMVLPGASVCMVLPGPSVCMVLPGPSVCMVLPGPSVCM 239
Query: 244 DLPGPSSAPDLPGPSSAPDLPGPSS 268
LPGPS LPGP LPG +
Sbjct: 240 VLPGPSVCMVLPGPLVCMVLPGQCT 264
|
Source: Nematostella vectensis Species: Nematostella vectensis Genus: Nematostella Family: Edwardsiidae Order: Actiniaria Class: Anthozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|61652784|gb|AAX47962.1| circumsporozoite protein [Plasmodium vivax] | Back alignment and taxonomy information |
|---|
| >gi|326677446|ref|XP_002661995.2| PREDICTED: hypothetical protein LOC100334539 [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|396480997|ref|XP_003841132.1| predicted protein [Leptosphaeria maculans JN3] gi|312217706|emb|CBX97653.1| predicted protein [Leptosphaeria maculans JN3] | Back alignment and taxonomy information |
|---|
| >gi|350633524|gb|EHA21889.1| hypothetical protein ASPNIDRAFT_183966 [Aspergillus niger ATCC 1015] | Back alignment and taxonomy information |
|---|
| >gi|260796019|ref|XP_002593002.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae] gi|229278226|gb|EEN49013.1| hypothetical protein BRAFLDRAFT_117784 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|328701310|ref|XP_001950899.2| PREDICTED: hypothetical protein LOC100165925 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|160165|gb|AAA70381.1| circumsporozoite protein [Plasmodium simium] | Back alignment and taxonomy information |
|---|
| >gi|47523048|ref|NP_999285.1| coagulation factor V precursor [Sus scrofa] gi|18202922|sp|Q9GLP1.1|FA5_PIG RecName: Full=Coagulation factor V; AltName: Full=Activated protein C cofactor; Contains: RecName: Full=Coagulation factor V heavy chain; Contains: RecName: Full=Coagulation factor V light chain; Flags: Precursor gi|11065896|gb|AAG28381.1|AF191308_1 coagulation factor V [Sus scrofa] | Back alignment and taxonomy information |
|---|
| >gi|163637044|gb|ABY27340.1| circumsporozoite protein variant VK247 [Plasmodium vivax] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 448 | ||||||
| POMBASE|SPAC23A1.17 | 1611 | SPAC23A1.17 "WIP family cytosk | 0.613 | 0.170 | 0.451 | 4.8e-52 | |
| UNIPROTKB|P15941 | 1255 | MUC1 "Mucin-1" [Homo sapiens ( | 0.587 | 0.209 | 0.501 | 1.2e-45 | |
| UNIPROTKB|F1RXI2 | 425 | LOC100737091 "Uncharacterized | 0.620 | 0.654 | 0.381 | 5.2e-42 | |
| UNIPROTKB|D2CFI5 | 508 | TPRX1 "CRX like homeobox 2" [H | 0.540 | 0.476 | 0.438 | 1.7e-41 | |
| UNIPROTKB|Q8N7U7 | 411 | TPRX1 "Tetra-peptide repeat ho | 0.540 | 0.588 | 0.438 | 1.7e-41 | |
| UNIPROTKB|F1NDF5 | 1658 | COL4A5 "Uncharacterized protei | 0.642 | 0.173 | 0.375 | 3.7e-41 | |
| UNIPROTKB|F1LUN5 | 799 | Col4a5 "Protein Col4a5" [Rattu | 0.656 | 0.367 | 0.367 | 1.1e-40 | |
| UNIPROTKB|F1N474 | 1688 | COL4A5 "Uncharacterized protei | 0.649 | 0.172 | 0.371 | 1.3e-40 | |
| UNIPROTKB|J9P9L4 | 1691 | COL4A5 "Collagen alpha-5(IV) c | 0.629 | 0.166 | 0.372 | 2.7e-40 | |
| UNIPROTKB|F1PH05 | 1693 | COL4A5 "Collagen alpha-5(IV) c | 0.629 | 0.166 | 0.372 | 2.8e-40 |
| POMBASE|SPAC23A1.17 SPAC23A1.17 "WIP family cytoskeletal protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Score = 553 (199.7 bits), Expect = 4.8e-52, P = 4.8e-52
Identities = 135/299 (45%), Positives = 181/299 (60%)
Query: 17 PSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPGP-SSAPDLPGPSSAPDLPGPSS-APDL 74
PS P+ L P+S P P SAP L P S++P P + P +P SS AP +
Sbjct: 967 PSIPPPLPVSNILSSPTSEPPKDHPPSAP-LSKPVSTSPAAP-LARVPPVPKLSSKAPPV 1024
Query: 75 PGPSS-APDLPGPSSAPDLPGPSSAPDLP-----GPSSAPDLPGPSSA-PDLPGPSSAPD 127
P PS+ AP +P PS+AP +P P+S P +P PS+ P +P PSS P +P PS AP
Sbjct: 1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084
Query: 128 LPGPSSAPDLPGPS-SAPDLPGPSSA-PDLPGPSSAPDLPGPS-SAPDLPGPSSAPDLPG 184
+P PS P +P PS +AP +P PS A P +P PS AP +P PS +AP +P PS AP +P
Sbjct: 1085 VPAPSGIPPVPKPSVAAPPVPKPSVAVPPVPAPSGAPPVPKPSVAAPPVPVPSGAPPVPK 1144
Query: 185 PS-SAPDLPGPSSAPDLPGPS-SAPDLPGPSSA-PDLPGPSSA-PDLPGPSSAPDLPGPS 240
PS +AP +P PS AP +P PS +AP +P PSS P +P P++ P +P PS AP +P PS
Sbjct: 1145 PSVAAPPVPAPSGAPPVPKPSVAAPPVPAPSSGIPPVPKPAAGVPPVPPPSEAPPVPKPS 1204
Query: 241 -SAPDLPGPSSAPDLPGPSSA-PDLPGPSS-APDLPGPSS-APDLPGPSSAPDLPGPSS 295
P +P PS+AP +P PS+ P +P P++ AP +P PSS AP + P S+ +P P S
Sbjct: 1205 VGVPPVPPPSTAPPVPTPSAGLPPVPVPTAKAPPVPAPSSEAPSVSTPRSS--VPSPHS 1261
|
|
| UNIPROTKB|P15941 MUC1 "Mucin-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RXI2 LOC100737091 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D2CFI5 TPRX1 "CRX like homeobox 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N7U7 TPRX1 "Tetra-peptide repeat homeobox protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDF5 COL4A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LUN5 Col4a5 "Protein Col4a5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N474 COL4A5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P9L4 COL4A5 "Collagen alpha-5(IV) chain" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PH05 COL4A5 "Collagen alpha-5(IV) chain" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-15 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-15 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-15 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-13 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-13 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-13 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-13 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-12 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-12 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-12 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-12 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-11 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-11 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-10 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-09 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-09 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-09 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-08 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 2e-07 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 4e-07 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 5e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-06 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-06 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 5e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 7e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 8e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 8e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 6e-04 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 7e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.001 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.003 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.003 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.003 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.003 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 0.003 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.003 | |
| pfam04484 | 313 | pfam04484, DUF566, Family of unknown function (DUF | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Score = 79.6 bits (196), Expect = 1e-15
Identities = 81/314 (25%), Positives = 104/314 (33%), Gaps = 11/314 (3%)
Query: 17 PSTVTERPLEPDLPGPSSAPDLPGPSSAPDLPG-PSSAPDLPGPSSAPDLPGPSSAPDLP 75
P RP EP + + PD P S+ P P P P P S + P P
Sbjct: 2570 PPRPAPRPSEPAVTSRARRPDAPPQSARPRAPVDDRGDPRGPAPPSPLPPDTHAPDPPPP 2629
Query: 76 GPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAP 135
PS A + P P P +P P D P P SS P P +A
Sbjct: 2630 SPSPAANEPDPHPPPTVPPPERPRDDPAPGRVSRPRRARRLGRAAQASSPPQRPRRRAAR 2689
Query: 136 DLPGP-SSAPDLPGPSSAPDLPGPSSAPDLPGP----SSAPDLPGPSSAPDLPGPSSAPD 190
G +S D P P P+ + P P ++ P +AP P + P
Sbjct: 2690 PTVGSLTSLADPPPPPPTPEPAPHALVSATPLPPGPAAARQASPALPAAPAPPAVPAGPA 2749
Query: 191 LPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPS---SAPDLPGPSSAPDLPG 247
PG + P P ++ P P P +AP P S S LP P D P
Sbjct: 2750 TPGGPARPARPPTTAGPPAPAPPAAPAAGPPRRLTRPAVASLSESRESLPSPWDPADPPA 2809
Query: 248 PSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSTVLGSYLGEAGH 307
AP P +A P P +AP P P LP S G +
Sbjct: 2810 AVLAPAAALPPAAS--PAGPLPPPTSAQPTAPPPPPGPPPPSLPLGGSVAPGGDVRRRPP 2867
Query: 308 QKSPKGLEPKPAQI 321
+SP PA+
Sbjct: 2868 SRSPAAKPAAPARP 2881
|
Length = 3151 |
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218107 pfam04484, DUF566, Family of unknown function (DUF566) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| KOG3546|consensus | 1167 | 99.95 | ||
| KOG3546|consensus | 1167 | 99.93 | ||
| smart00038 | 232 | COLFI Fibrillar collagens C-terminal domain. Found | 99.87 | |
| PF01410 | 214 | COLFI: Fibrillar collagen C-terminal domain; Inter | 99.83 |
| >KOG3546|consensus | Back alignment and domain information |
|---|
Probab=99.95 E-value=2e-25 Score=234.92 Aligned_cols=15 Identities=20% Similarity=0.239 Sum_probs=7.8
Q ss_pred eeeeEeccCCceeeh
Q psy16323 357 LYILTVEDDTVILLF 371 (448)
Q Consensus 357 ~~~~~vrkDqk~~WF 371 (448)
+-.++.+|+|.-+.|
T Consensus 984 ypmllaek~~pllhl 998 (1167)
T KOG3546|consen 984 YPMLLAEKPQPLLHL 998 (1167)
T ss_pred ccccCCCCcchhhhh
Confidence 344455555555554
|
|
| >KOG3546|consensus | Back alignment and domain information |
|---|
| >smart00038 COLFI Fibrillar collagens C-terminal domain | Back alignment and domain information |
|---|
| >PF01410 COLFI: Fibrillar collagen C-terminal domain; InterPro: IPR000885 Collagens contain a large number of globular domains in between the regions of triple helical repeats IPR008160 from INTERPRO | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 448 | |||
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-14 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 9e-12 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 6e-11 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-10 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-10 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-08 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-14 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-13 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 5e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 9e-12 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-11 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 1e-10 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-10 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 8e-08 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-13 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-11 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 6e-11 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-10 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-06 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 7e-04 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 7e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 7e-04 |
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
Score = 73.2 bits (180), Expect = 7e-14
Identities = 71/270 (26%), Positives = 88/270 (32%)
Query: 24 PLEPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDL 83
P E PG + P G + +P PGP PGP+ PGP+ P G +
Sbjct: 361 PGEAGRPGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGEDGRPGPAGPPGARGQAGVMGF 420
Query: 84 PGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSA 143
PGP A PG + +PGP A G GP G G
Sbjct: 421 PGPKGAAGEPGKAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGF 480
Query: 144 PDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGP 203
LPGP+ P G +PG AP G PG PGP+ G
Sbjct: 481 QGLPGPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVEGPPGPAGPRGANGA 540
Query: 204 SSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDLPGPSSAPDL 263
G + AP PG AP L G G G + G +
Sbjct: 541 PGNDGAKGDAGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGV 600
Query: 264 PGPSSAPDLPGPSSAPDLPGPSSAPDLPGP 293
G + PGP+ AP G + GP
Sbjct: 601 RGLTGPIGPPGPAGAPGDKGEAGPSGPAGP 630
|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 448 | |||
| 3hqv_A | 1056 | Collagen alpha-1(I) chain; native, in SITU, molecu | 99.96 | |
| 3hqv_A | 1056 | Collagen alpha-1(I) chain; native, in SITU, molecu | 99.96 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 99.95 | |
| 3hqv_B | 1028 | Collagen alpha-2(I) chain; native, in SITU, molecu | 99.95 | |
| 4ae2_A | 256 | Procollagen III, collagen alpha-1(III) chain; stru | 99.84 |
| >3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A | Back alignment and structure |
|---|
Probab=99.96 E-value=8.7e-27 Score=265.34 Aligned_cols=7 Identities=14% Similarity=0.320 Sum_probs=3.1
Q ss_pred Cccccce
Q psy16323 4 PFDKHVF 10 (448)
Q Consensus 4 ~~~~~~~ 10 (448)
=||.+..
T Consensus 5 g~~~~~~ 11 (1056)
T 3hqv_A 5 GYDEKSA 11 (1056)
T ss_pred CcCCCcC
Confidence 3444443
|
| >3hqv_A Collagen alpha-1(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_A | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 1ygv_A 3hqv_A 3hr2_A | Back alignment and structure |
|---|
| >3hqv_B Collagen alpha-2(I) chain; native, in SITU, molecular envelope, triple-helical, supermolecular, supramolecular, packing structure; 5.16A {Rattus norvegicus} PDB: 3hr2_B | Back alignment and structure |
|---|
| >4ae2_A Procollagen III, collagen alpha-1(III) chain; structural protein, fibrillar collagen, extracellular matrix fibrosis; 1.68A {Homo sapiens} PDB: 4aej_A* 4ak3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00