Psyllid ID: psy16333

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190--
MVLELLRSQSDLKKCHPSLPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR
cEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEEcccccccccccEEEEEEEEEccEEEEEcccccccccccEEEEEEEccccccccEEEccEEEEEEEccccccEEEEEEEEEEEEEEEEccccccHHccccccccccccccccccccc
cHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccEEEEEEEEcccccccccccccccEEEEEEccccEEEccEEEccccccccEEEEEEEcccccccccccEEEEEEEccccccccEEEEEEEEcccccccHHHHHHHHHcHHcHHHcccccccccccc
MVLELLRSqsdlkkchpslpytgvmvsspmnrpfidnifpiatppltLYVDYFSGLLSAnirinsaplyLTHVTvlgapsfdrcgggchAFLKIYEGLVCVYtsgvhgvgsearQFTVNVAGERQRRGLQLRGDILLKCyhrgnkdrIGVVVSAYMHYSNICGTADQALDRFAMKRFlddkigdldfpsykr
MVLELLrsqsdlkkchpslPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVnvagerqrrglqLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLddkigdldfpsykr
MVLELLRSQSDLKKCHPSLPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGErqrrglqlrgDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR
******************LPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDL*******
*VLEL**SQS**************MVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTS***********FTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPS***
MVLELLRSQSDLKKCHPSLPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR
*VLELLRSQSDLKKCHPSLPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLELLRSQSDLKKCHPSLPYTGVMVSSPMNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIGVVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query192 2.2.26 [Sep-21-2011]
Q9HBL0 1735 Tensin-1 OS=Homo sapiens yes N/A 0.802 0.088 0.398 6e-22
Q04205 1744 Tensin OS=Gallus gallus G yes N/A 0.802 0.088 0.386 7e-22
Q9GLM4 1715 Tensin-1 OS=Bos taurus GN yes N/A 0.796 0.089 0.402 1e-21
Q5SSZ5 1440 Tensin-3 OS=Mus musculus no N/A 0.802 0.106 0.349 1e-17
Q68CZ2 1445 Tensin-3 OS=Homo sapiens no N/A 0.802 0.106 0.325 4e-16
Q8CGB6 1400 Tensin-like C1 domain-con no N/A 0.640 0.087 0.382 2e-15
Q63HR2 1409 Tensin-like C1 domain-con no N/A 0.5 0.068 0.417 7e-15
P91301332 Putative protein phosphat no N/A 0.437 0.253 0.356 1e-06
>sp|Q9HBL0|TENS1_HUMAN Tensin-1 OS=Homo sapiens GN=TNS1 PE=1 SV=2 Back     alignment and function desciption
 Score =  103 bits (257), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 65/163 (39%), Positives = 91/163 (55%), Gaps = 9/163 (5%)

Query: 30  MNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCH 89
           M R + D I PI  P    YV YFSGLLS +I++N+ PL+L HV + G P+F+   GGC 
Sbjct: 146 MKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFES-KGGCR 204

Query: 90  AFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIG 149
            FL+IY+ +  VYTSG++ +  ++ Q +V +  E    GL L+GDILLKCYH+  +    
Sbjct: 205 PFLRIYQAMQPVYTSGIYNIPGDS-QTSVCITIE---PGLLLKGDILLKCYHKKFRSPAR 260

Query: 150 VVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSYKR 192
            V+     ++  C   D  L     K  LDD   D  FP Y +
Sbjct: 261 DVIFRVQFHT--CAIHD--LGVVFGKEDLDDAFKDDRFPEYGK 299
May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
Homo sapiens (taxid: 9606)
>sp|Q04205|TENS_CHICK Tensin OS=Gallus gallus GN=TNS PE=1 SV=2 Back     alignment and function description
>sp|Q9GLM4|TENS1_BOVIN Tensin-1 OS=Bos taurus GN=TNS1 PE=2 SV=1 Back     alignment and function description
>sp|Q5SSZ5|TENS3_MOUSE Tensin-3 OS=Mus musculus GN=Tns3 PE=1 SV=1 Back     alignment and function description
>sp|Q68CZ2|TENS3_HUMAN Tensin-3 OS=Homo sapiens GN=TNS3 PE=1 SV=2 Back     alignment and function description
>sp|Q8CGB6|TENC1_MOUSE Tensin-like C1 domain-containing phosphatase OS=Mus musculus GN=Tenc1 PE=1 SV=1 Back     alignment and function description
>sp|Q63HR2|TENC1_HUMAN Tensin-like C1 domain-containing phosphatase OS=Homo sapiens GN=TENC1 PE=1 SV=2 Back     alignment and function description
>sp|P91301|TAG83_CAEEL Putative protein phosphatase tag-83 OS=Caenorhabditis elegans GN=tag-83 PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
189237851 1398 PREDICTED: similar to tensin [Tribolium 0.781 0.107 0.559 2e-37
270006735 1389 hypothetical protein TcasGA2_TC013103 [T 0.781 0.107 0.559 2e-37
242007688 1186 tens, putative [Pediculus humanus corpor 0.796 0.129 0.534 7e-36
321467996 334 hypothetical protein DAPPUDRAFT_2528 [Da 0.854 0.491 0.403 6e-24
340723449 1406 PREDICTED: hypothetical protein LOC10064 0.541 0.073 0.539 1e-23
307191831 470 Tensin [Harpegnathos saltator] 0.541 0.221 0.539 2e-23
350427112 1660 PREDICTED: hypothetical protein LOC10074 0.541 0.062 0.539 2e-23
307172057 464 Tensin [Camponotus floridanus] 0.541 0.224 0.539 2e-23
340723447 1645 PREDICTED: hypothetical protein LOC10064 0.541 0.063 0.539 2e-23
332019538 552 Tensin [Acromyrmex echinatior] 0.541 0.188 0.539 2e-23
>gi|189237851|ref|XP_974917.2| PREDICTED: similar to tensin [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/159 (55%), Positives = 104/159 (65%), Gaps = 9/159 (5%)

Query: 30  MNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCH 89
           M R   DN+ P+A P    YVDYF+GLLS NI+IN+ PLYLTHVTVLGAPSF R  GGC 
Sbjct: 265 MRRFLDDNVGPLALPSNKRYVDYFAGLLSHNIKINANPLYLTHVTVLGAPSFQR--GGCR 322

Query: 90  AFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHRGNKDRIG 149
           AFLK+Y+G   VYTSGV+ V S   QFTVNV GER RRGLQLRGDIL+KCYHRG+  R  
Sbjct: 323 AFLKLYQGQTPVYTSGVYNVSSGVSQFTVNVVGER-RRGLQLRGDILIKCYHRGDVGRET 381

Query: 150 VVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFP 188
           +    +    + C  AD  L     ++ LD    D  FP
Sbjct: 382 IFACQF----HTCAVADYTLS--FTRQELDVACNDSRFP 414

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270006735|gb|EFA03183.1| hypothetical protein TcasGA2_TC013103 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007688|ref|XP_002424660.1| tens, putative [Pediculus humanus corporis] gi|212508153|gb|EEB11922.1| tens, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321467996|gb|EFX78983.1| hypothetical protein DAPPUDRAFT_2528 [Daphnia pulex] Back     alignment and taxonomy information
>gi|340723449|ref|XP_003400102.1| PREDICTED: hypothetical protein LOC100644032 isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307191831|gb|EFN75257.1| Tensin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350427112|ref|XP_003494656.1| PREDICTED: hypothetical protein LOC100746638 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307172057|gb|EFN63651.1| Tensin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340723447|ref|XP_003400101.1| PREDICTED: hypothetical protein LOC100644032 isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332019538|gb|EGI60017.1| Tensin [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query192
UNIPROTKB|E7ERH1 780 TNS1 "Tensin-1" [Homo sapiens 0.791 0.194 0.378 6.1e-19
ZFIN|ZDB-GENE-030131-6933 1769 tns1 "tensin 1" [Danio rerio ( 0.791 0.085 0.372 1.2e-18
ZFIN|ZDB-GENE-120215-32 1678 si:dkey-257h21.2 "si:dkey-257h 0.781 0.089 0.386 1.4e-18
UNIPROTKB|F1P1J0 1744 TNS1 "Uncharacterized protein" 0.791 0.087 0.366 1.5e-18
UNIPROTKB|Q04205 1744 TNS "Tensin" [Gallus gallus (t 0.791 0.087 0.366 1.5e-18
UNIPROTKB|E9PGF5 1714 TNS1 "Tensin-1" [Homo sapiens 0.791 0.088 0.378 1.9e-18
UNIPROTKB|Q9GLM4 1715 TNS1 "Tensin-1" [Bos taurus (t 0.791 0.088 0.378 1.9e-18
UNIPROTKB|E9PF55 1721 TNS1 "Tensin-1" [Homo sapiens 0.791 0.088 0.378 1.9e-18
UNIPROTKB|Q9HBL0 1735 TNS1 "Tensin-1" [Homo sapiens 0.791 0.087 0.378 1.9e-18
UNIPROTKB|E1BNT5 1767 TNS1 "Tensin-1" [Bos taurus (t 0.791 0.086 0.378 1.9e-18
UNIPROTKB|E7ERH1 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 6.1e-19, P = 6.1e-19
 Identities = 61/161 (37%), Positives = 86/161 (53%)

Query:    30 MNRPFIDNIFPIATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCH 89
             M R + D I PI  P    YV YFSGLLS +I++N+ PL+L HV + G P+F+   GGC 
Sbjct:   271 MKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFES-KGGCR 329

Query:    90 AFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGEXXXXXXXXXXDILLKCYHRGNKDRIG 149
              FL+IY+ +  VYTSG++ +  ++ Q +V +  E          DILLKCYH+  +    
Sbjct:   330 PFLRIYQAMQPVYTSGIYNIPGDS-QTSVCITIEPGLLLKG---DILLKCYHKKFRSPAR 385

Query:   150 VVVSAYMHYSNICGTADQALDRFAMKRFLDDKIGDLDFPSY 190
              V+     ++  C   D  +  F  K  LDD   D  FP Y
Sbjct:   386 DVIFRVQFHT--CAIHDLGVV-FG-KEDLDDAFKDDRFPEY 422
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0005925 "focal adhesion" evidence=IDA
ZFIN|ZDB-GENE-030131-6933 tns1 "tensin 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120215-32 si:dkey-257h21.2 "si:dkey-257h21.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1J0 TNS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q04205 TNS "Tensin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PGF5 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GLM4 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E9PF55 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9HBL0 TNS1 "Tensin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNT5 TNS1 "Tensin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
pfam10409129 pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppr 5e-10
>gnl|CDD|220736 pfam10409, PTEN_C2, C2 domain of PTEN tumour-suppressor protein Back     alignment and domain information 
 Score = 54.6 bits (132), Expect = 5e-10
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 63  INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGV--HGVGSEARQFTVNV 120
               PL+L  + + G P+F   GGGC  +++IY     V TS         + +   +  
Sbjct: 1   PPPKPLFLKSIILHGIPNFKS-GGGCRPYIRIYNNDKKVSTSKKYEILKKYQQKDCIILF 59

Query: 121 AGERQRRGLQLRGDILLKCYHRGNKDR 147
                  GL ++GD+L++ YH+G K  
Sbjct: 60  PK-----GLPVQGDVLIEFYHKGLKLS 81

This is the C2 domain-like domain, in greek key form, of the PTEN protein, phosphatidyl-inositol triphosphate phosphatase, and it is the C-terminus. This domain may well include a CBR3 loop which means it plays a central role in membrane binding. This domain associates across an extensive interface with the N-terminal phosphatase domain DSPc (pfam00782) suggesting that the C2 domain productively positions the catalytic part of the protein onto the membrane. Length = 129

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 192
PF10409134 PTEN_C2: C2 domain of PTEN tumour-suppressor prote 99.96
KOG2283|consensus 434 99.95
PTZ00393241 protein tyrosine phosphatase; Provisional 98.55
PTZ00242166 protein tyrosine phosphatase; Provisional 98.51
KOG1720|consensus225 98.41
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.33
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 98.17
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.01
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 97.97
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 97.97
KOG1719|consensus183 97.56
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 97.51
PRK12361 547 hypothetical protein; Provisional 97.38
PHA02747312 protein tyrosine phosphatase; Provisional 96.69
PHA02740298 protein tyrosine phosphatase; Provisional 96.59
PHA02742303 protein tyrosine phosphatase; Provisional 96.55
PHA02746323 protein tyrosine phosphatase; Provisional 96.52
PHA02738320 hypothetical protein; Provisional 96.45
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 96.09
KOG0792|consensus1144 96.06
KOG0790|consensus600 95.81
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 95.79
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 95.75
KOG0789|consensus415 95.51
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 95.45
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 95.09
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 94.04
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 93.87
KOG2836|consensus173 92.6
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 91.86
KOG1716|consensus285 91.25
KOG2283|consensus 434 90.61
KOG4228|consensus 1087 90.2
KOG2386|consensus393 90.03
KOG0793|consensus1004 90.01
KOG0791|consensus374 89.44
PLN02727 986 NAD kinase 87.12
KOG1572|consensus249 85.86
KOG4471|consensus 717 85.34
>PF10409 PTEN_C2: C2 domain of PTEN tumour-suppressor protein; InterPro: IPR014020 Tensins constitute an eukaryotic family of lipid phosphatases that are defined by the presence of two adjacent domains: a lipid phosphatase domain and a C2-like domain Back     alignment and domain information 
Probab=99.96  E-value=4.5e-29  Score=192.63  Aligned_cols=118  Identities=27%  Similarity=0.428  Sum_probs=91.8

Q ss_pred             CCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEecceeEee-ccccccCCCc-ceeEEEEeccccccCceEecCeEEEEE
Q psy16333         63 INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYT-SGVHGVGSEA-RQFTVNVAGERQRRGLQLRGDILLKCY  140 (192)
Q Consensus        63 ~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~t-S~~~~~~~~~-~~~~~~~~~~~~~~~~~l~GDI~V~~y  140 (192)
                      |++++|.|++|+|+++|.|+. ++||+||++||++.+.+++ +..++..... .....+.+..    +++|+|||+|+||
T Consensus         1 ~~~~~l~L~~I~l~~iP~f~~-~~gc~p~i~I~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~----~~~l~GDV~i~~~   75 (134)
T PF10409_consen    1 PPPRPLFLKSIILHGIPNFNS-GGGCRPYIEIYNGGKKVFSTSKSYEDPKSYEQDSVIIELPK----NLPLRGDVLIKFY   75 (134)
T ss_dssp             -S--EEEEEEEEEES-TTSTT-SSCCTEEEEEEETTEEEEETCCTCCCCCEEETTCEEEEEEE----EEEEESEEEEEEE
T ss_pred             CCCeeEEEEEEEEECCCccCC-CCCEEEEEEEECCCccEEEeccceeccccccceeEEEEeCC----CCeEeCCEEEEEE
Confidence            578899999999999999976 5899999999999999964 4444432211 1222333322    7899999999999


Q ss_pred             EcC--CCceeEEEEeeeeeeeccccCc--CccccchhchhhhccccCC--CCCCCCC
Q psy16333        141 HRG--NKDRIGVVVSAYMHYSNICGTA--DQALDRFAMKRFLDDKIGD--LDFPSYK  191 (192)
Q Consensus       141 h~~--~~~~~~mF~~~~F~~~hT~fi~--~~~L~~~~~K~eLD~a~kd--~rfp~~~  191 (192)
                      |++  ...++.||++| |   |||||+  ++.|.|  .|+|||+|+||  ++||++.
T Consensus        76 ~~~~~~~~~~~~f~~~-F---nT~Fi~~~~~~l~~--~k~eLD~~~kdk~k~f~~~f  126 (134)
T PF10409_consen   76 HKRSSSMSKEKMFRFW-F---NTGFIEPNNNVLRF--TKSELDKAHKDKHKRFPPDF  126 (134)
T ss_dssp             ECETTECCCEEEEEEE-E---EGGGSBTTTCEEEE--EGGGSBTCCCGCTCCS-TT-
T ss_pred             eCCCcccccCeEEEEE-E---eeeeeeccccEEEc--CHHHCCCcccCcccccCCCe
Confidence            998  55678899999 9   999999  899999  99999999999  9999985

The tensin-type C2 domain has a structure similar to the classical C2 domain (see IPR000008 from INTERPRO) that mediates the Ca2+-dependent membrane recruitment of several signalling proteins. However the tensin-type C2 domain lacks two of the three conserved loops that bind Ca2+, and in this respect it is similar to the C2 domains of PKC-type [, ]. The tensin-type C2 domain can bind phopholipid membranes in a Ca2+ independent manner []. In the tumour suppressor protein PTEN, the best characterised member of the family, the lipid phosphatase domain was shown to specifically dephosphorylate the D3 position of the inositol ring of the lipid second messenger, phosphatydilinositol-3-4-5-triphosphate (PIP3). The lipid phosphatase domain contains the signature motif HCXXGXXR present in the active sites of protein tyrosine phosphatases (PTPs) and dual specificity phosphatases (DSPs). Furthermore, two invariant lysines are found only in the tensin-type phosphatase motif (HCKXGKXR) and are suspected to interact with the phosphate group at position D1 and D5 of the inositol ring [, ]. The C2 domain is found at the C terminus of the tumour suppressor protein PTEN (phosphatidyl-inositol triphosphate phosphatase). This domain may include a CBR3 loop, indicating a central role in membrane binding. This domain associates across an extensive interface with the N-terminal phosphatase domain DSPc suggesting that the C2 domain productively positions the catalytic part of the protein on the membrane. The crystal structure of the PTEN tumour suppressor has been solved []. The lipid phosphatase domain has a structure similar to the dual specificity phosphatase (see IPR000387 from INTERPRO). However, PTEN has a larger active site pocket that could be important to accommodate PI(3,4,5)P3. Proteins known to contain a phosphatase and a C2 tensin-type domain are listed below: Tensin, a focal-adhesion molecule that binds to actin filaments. It may be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton. Phosphatase and tensin homologue deleted on chromosome 10 protein (PTEN). It antagonizes PI 3-kinase signalling by dephosphorylating the 3-position of the inositol ring of PI(3,4,5)P3 and thus inactivates downstream signalling. It plays major roles both during development and in the adult to control cell size, growth, and survival. Auxilin. It binds clathrin heavy chain and promotes its assembly into regular cages. Cyclin G-associated kinase or auxilin-2. It is a potential regulator of clathrin-mediated membrane trafficking. ; GO: 0005515 protein binding; PDB: 3N0A_A 1D5R_A 3V0D_B 3V0H_B 3V0G_A 3V0F_B 3V0J_A 3V0I_A 3AWE_B 3AWG_C ....
>KOG2283|consensus Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query192
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 1e-08
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 1e-08
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 5e-04
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Length = 324 Back     alignment and structure
 Score = 53.0 bits (126), Expect = 1e-08
 Identities = 29/147 (19%), Positives = 54/147 (36%), Gaps = 10/147 (6%)

Query: 41  IATPPLTLYVDYFSGLLSANIRINSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVC 100
           +  P    YV Y+S LL  ++      L    +     P F   GG C+    + +  V 
Sbjct: 160 VTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFS--GGTCNPQFVVCQLKVK 217

Query: 101 VYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYH-RGNKDRIGVVVSAYMHYS 159
           +Y+S       E +            + L + GDI ++ +H +    +   +   +++  
Sbjct: 218 IYSSNSGPTRREDKFMYFEF-----PQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTF 272

Query: 160 NICGTADQALDRFAMKRFLDDKIGDLD 186
            I G  +   D+  +   L     DLD
Sbjct: 273 FIPGPEEVDNDKEYLVLTLTKN--DLD 297
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 100.0
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 100.0
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 100.0
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 98.86
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 98.76
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 98.69
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 98.68
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 98.63
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 98.6
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 98.51
2hcm_A164 Dual specificity protein phosphatase; structural g 98.49
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.39
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.23
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 98.22
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.22
2oud_A177 Dual specificity protein phosphatase 10; A central 98.22
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.21
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 98.17
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.14
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.13
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 98.13
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 98.1
2hxp_A155 Dual specificity protein phosphatase 9; human phos 98.05
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.04
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 98.03
2q05_A195 Late protein H1, dual specificity protein phosphat 97.98
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 97.97
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 97.96
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 97.96
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 97.95
3emu_A161 Leucine rich repeat and phosphatase domain contain 97.91
1xri_A151 AT1G05000; structural genomics, protein structure 97.87
3cm3_A176 Late protein H1, dual specificity protein phosphat 97.85
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 97.81
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.75
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 97.69
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 97.64
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 97.63
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 97.61
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 97.6
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 97.6
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 97.6
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 97.58
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 97.58
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 97.57
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 97.56
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 97.53
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 97.51
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 97.51
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 97.48
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 97.47
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 97.47
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 97.45
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 97.44
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 97.4
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 97.39
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 97.39
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 97.38
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 97.38
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 97.37
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 97.33
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 97.31
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 97.26
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 97.2
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.12
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 97.07
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 97.06
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 97.04
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 97.03
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 97.01
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 97.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 96.97
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 96.94
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 96.88
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 96.86
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 96.76
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 96.71
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 96.71
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 96.13
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 95.95
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 93.65
2f46_A156 Hypothetical protein; structural genomics, joint c 93.45
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=3.6e-45  Score=323.87  Aligned_cols=173  Identities=17%  Similarity=0.236  Sum_probs=145.9

Q ss_pred             CCeEEEEcCCCCCceeeeecc-------------ccccccccCCCCCcCcchhhHHHHHHhhhcCc-ccCCCCCeEEEEE
Q psy16333          8 SQSDLKKCHPSLPYTGVMVSS-------------PMNRPFIDNIFPIATPPLTLYVDYFSGLLSAN-IRINSAPLYLTHV   73 (192)
Q Consensus         8 ~nv~vihC~~G~grtg~~i~~-------------a~~~~~~~~~~~~~~PSq~RYv~Y~~~ll~~~-~~~~~~~l~L~~I   73 (192)
                      +|+++|||+||+||||++|||             |++.|..+|..+.++|||+|||+||+.++++. +.++.+||.|++|
T Consensus       115 ~~~v~VHC~aG~GRtg~~ia~~Li~~~~~~~~~eAl~~~~~~R~~~~~~psQ~ryv~yf~~ll~~~~~~P~~~~L~L~~i  194 (361)
T 3n0a_A          115 KNVCVVHCLDGRAASSILVGAMFIFCNLYSTPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSI  194 (361)
T ss_dssp             TCEEEEEECSCTHHHHHHHHHHHHHTTSCSSHHHHHHHHHHHSTTCCCCHHHHHHHHHHHHHHSSSCCCCCCCCEEEEEE
T ss_pred             CCeEEEEeCCCCccHHHHHHHHHHHhcCCCCHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHhcCCcCCCCceeEEEEE
Confidence            489999999999999999999             67778888988889999999999999999875 4567899999999


Q ss_pred             EEecCCCCCCCCCceeEEEEEEecceeEeecc-ccccCCC---cceeEEEEeccccccCceEecCeEEEEEEcCC----C
Q psy16333         74 TVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSG-VHGVGSE---ARQFTVNVAGERQRRGLQLRGDILLKCYHRGN----K  145 (192)
Q Consensus        74 ~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~-~~~~~~~---~~~~~~~~~~~~~~~~~~l~GDI~V~~yh~~~----~  145 (192)
                      +|++||.|++.++||+||++||+++++||||. .|+..+.   ....+.  +..    +++|+|||+|+|||++.    +
T Consensus       195 ~l~~iP~f~~~~~GCrP~~~Iy~~~~~v~ss~~~~~~~r~~~~~~~~i~--i~~----~~~l~GDV~v~~~h~~~~~g~~  268 (361)
T 3n0a_A          195 TVSPVPFFNKQRNGCRPYCDVLIGETKIYTTCADFERMKEYRVQDGKIF--IPL----SITVQGDVVVSMYHLRSTIGSR  268 (361)
T ss_dssp             EEESCCCCSTTSSEECEEEEEEETTEEEEECCCCGGGSCCEEGGGCCEE--EEE----EEEECSEEEEEEEEEEEEECTT
T ss_pred             EEecCCcccCCCCCcceEEEEEeCCeEEEecCchhhccccccccCceEE--eCC----CCeEECCEEEEEEeCCCccccc
Confidence            99999999986689999999999999999986 3443211   112232  222    78999999999999861    1


Q ss_pred             -----ceeEEEEeeeeeeeccccCcCc--cccchhchhhhccccCCCCCCCCCC
Q psy16333        146 -----DRIGVVVSAYMHYSNICGTADQ--ALDRFAMKRFLDDKIGDLDFPSYKR  192 (192)
Q Consensus       146 -----~~~~mF~~~~F~~~hT~fi~~~--~L~~~~~K~eLD~a~kd~rfp~~~~  192 (192)
                           .++.||++| |   |||||+++  .|.|  +|+|||.++.|++||++.+
T Consensus       269 l~~k~~~~~mFr~~-F---hT~FI~~~~~~l~~--~k~eLD~~~~~~rfp~~f~  316 (361)
T 3n0a_A          269 LQAKVTNTQIFQLQ-F---HTGFIPLDTTVLKF--TKPELDACDVPEKYPQLFQ  316 (361)
T ss_dssp             SCEEEEEEEEEEEE-E---EGGGSCTTCCEEEE--EGGGCBSCCCGGGSCTTCE
T ss_pred             cccccccceEEEEE-e---eeeEeeCCceEEEe--EhhhcccccccccCCCCeE
Confidence                 246899999 9   99999987  6888  9999999999999999874
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 192
d1d5ra1141 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshph 2e-13
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 0.004
>d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.3 bits (151), Expect = 2e-13
 Identities = 17/79 (21%), Positives = 29/79 (36%), Gaps = 7/79 (8%)

Query: 67  PLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQR 126
            L    +     P F   GG C+    + +  V +Y+S       E +            
Sbjct: 5   ALLFHKMMFETIPMFS--GGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQ---- 58

Query: 127 RGLQLRGDILLKCYHRGNK 145
             L + GDI ++ +H+ NK
Sbjct: 59  -PLPVCGDIKVEFFHKQNK 76
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query192
d1d5ra1141 Pten tumor suppressor (Phoshphoinositide phosphata 99.97
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.52
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.2
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 98.8
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.74
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 98.67
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 98.11
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.52
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 97.29
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 97.21
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 96.98
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 96.94
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 96.92
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 96.9
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 96.85
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 96.81
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 96.8
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 96.68
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 96.68
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 96.59
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 96.36
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 96.33
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 96.24
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 94.93
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 93.82
>d1d5ra1 b.7.1.1 (A:188-351) Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Pten tumor suppressor (Phoshphoinositide phosphatase), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=8.2e-32  Score=208.33  Aligned_cols=117  Identities=19%  Similarity=0.207  Sum_probs=96.0

Q ss_pred             CCCCCeEEEEEEEecCCCCCCCCCceeEEEEEEecceeEeeccccccCCCcceeEEEEeccccccCceEecCeEEEEEEc
Q psy16333         63 INSAPLYLTHVTVLGAPSFDRCGGGCHAFLKIYEGLVCVYTSGVHGVGSEARQFTVNVAGERQRRGLQLRGDILLKCYHR  142 (192)
Q Consensus        63 ~~~~~l~L~~I~l~~iP~f~~~~~gC~p~i~I~~~~~~v~tS~~~~~~~~~~~~~~~~~~~~~~~~~~l~GDI~V~~yh~  142 (192)
                      +.|.||+|++|+|+|||+|++  |||+||++||++.+++|||..+....+. ....+.+..    +++|+|||+|+|||+
T Consensus         1 y~P~~L~L~~I~l~~vP~f~~--ggCrP~~~I~~~~~~v~ts~~~~~~~~~-~~~~i~l~~----~~~v~GDV~v~~yh~   73 (141)
T d1d5ra1           1 YRPVALLFHKMMFETIPMFSG--GTCNPQFVVCQLKVKIYSSNSGPTRRED-KFMYFEFPQ----PLPVCGDIKVEFFHK   73 (141)
T ss_dssp             CCCCEEEEEEEEESSCCCSBT--TBCCEEEEEEETTEEEEECCSSCSEEET-TEEEEEEEE----EEEEESEEEEEEEEC
T ss_pred             CCCEeEEEEEEEEECCCccCC--CeeEEEEEEEcCCeEEEecCcEeEeccc-cEEEEEeCC----CCEEECCEEEEEEEC
Confidence            467899999999999999986  8999999999999999999887654322 233343322    789999999999998


Q ss_pred             C--CCceeEEEEeeeeeeeccccCcCcc----------ccchhchhhhccccCCCC---CCCCCC
Q psy16333        143 G--NKDRIGVVVSAYMHYSNICGTADQA----------LDRFAMKRFLDDKIGDLD---FPSYKR  192 (192)
Q Consensus       143 ~--~~~~~~mF~~~~F~~~hT~fi~~~~----------L~~~~~K~eLD~a~kd~r---fp~~~~  192 (192)
                      +  ..+++.||++| |   ||+||+++.          |.|  .|+|||.|+||++   ||++.+
T Consensus        74 ~~~~~~~~~mF~~~-F---nT~FI~~~~~~~~~~~~~~L~l--~k~eLD~a~kDk~~k~F~~~F~  132 (141)
T d1d5ra1          74 QNKMLKKDKMFHFW-V---NTFFIPGPEEVDNDKEYLVLTL--TKNDLDKANKDKANRYFSPNFK  132 (141)
T ss_dssp             CTTCSSCEEEEEEE-E---EGGGCC--------CCSEEEEE--EGGGSTTGGGCTTCSSSCTTCE
T ss_pred             CCCccCceEEEEEE-E---EeeeccCccccccCCceEEEEE--ecccccccccccccCCCCCCeE
Confidence            7  34678999999 9   999998763          777  9999999999987   999864
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure