Psyllid ID: psy16401


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
cccccEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEEccEEEEEEcEEEccccHHHHHHcccccccccEEEcccccHHHHHHHHHHHccccc
cccccccEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHEEHcccHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHcc
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSacspyfavslpipkrgmpetfspdlrfyetdgilpfaREDLL
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
******HFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPF******
****DQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
****DQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESGDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGILPFAREDLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query94 2.2.26 [Sep-21-2011]
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.893 0.106 0.547 4e-21
Q9V5M6 963 Longitudinals lacking pro no N/A 0.893 0.087 0.547 4e-21
P42284 549 Longitudinals lacking pro no N/A 0.893 0.153 0.547 6e-21
P42283 891 Longitudinals lacking pro no N/A 0.893 0.094 0.547 6e-21
Q867Z4 970 Longitudinals lacking pro no N/A 0.893 0.086 0.547 1e-20
Q9V5M3 878 Longitudinals lacking pro no N/A 0.893 0.095 0.547 1e-20
P42282 813 Protein tramtrack, alpha no N/A 0.617 0.071 0.568 5e-15
P17789 643 Protein tramtrack, beta i no N/A 0.617 0.090 0.568 7e-15
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.595 0.052 0.614 1e-14
Q01295 727 Broad-complex core protei no N/A 0.882 0.114 0.433 2e-14
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function desciption
 Score = 99.8 bits (247), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 46/84 (54%), Positives = 58/84 (69%)

Query: 5  DQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPI 64
          DQ FCLRWNNHQ+TLISVF  LL + TLVDC L+AEGK ++AHKV+LSACSPYFA  L  
Sbjct: 4  DQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFATLLQE 63

Query: 65 PKRGMPETFSPDLRFYETDGILPF 88
               P     D+++ E   ++ +
Sbjct: 64 QYDKHPIFILKDVKYQELRAMMDY 87




Putative transcription factor required for axon growth and guidance in the central and peripheral nervous systems. Repels CNS axons away from the midline by promoting the expression of the midline repellent sli and its receptor robo.
Drosophila melanogaster (taxid: 7227)
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q01295|BRC1_DROME Broad-complex core protein isoforms 1/2/3/4/5 OS=Drosophila melanogaster GN=br PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
158292857 911 AGAP005245-PA [Anopheles gambiae str. PE 0.893 0.092 0.559 7e-20
158292859 548 AGAP005245-PL [Anopheles gambiae str. PE 0.893 0.153 0.559 8e-20
158292843 550 AGAP005245-PK [Anopheles gambiae str. PE 0.893 0.152 0.559 1e-19
158292861 616 AGAP005245-PE [Anopheles gambiae str. PE 0.893 0.136 0.559 1e-19
158292845 502 AGAP005245-PD [Anopheles gambiae str. PE 0.893 0.167 0.559 1e-19
28573897 603 longitudinals lacking, isoform Q [Drosop 0.893 0.139 0.547 1e-19
198460523 609 GA25026 [Drosophila pseudoobscura pseudo 0.893 0.137 0.547 1e-19
195333183 612 GM20503 [Drosophila sechellia] gi|194125 0.893 0.137 0.547 1e-19
195153485 680 GL17189 [Drosophila persimilis] gi|19411 0.893 0.123 0.547 1e-19
29539391 603 Lola protein isoform B [Drosophila melan 0.893 0.139 0.547 1e-19
>gi|158292857|ref|XP_001688538.1| AGAP005245-PA [Anopheles gambiae str. PEST] gi|157017190|gb|EDO64121.1| AGAP005245-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  101 bits (251), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 47/84 (55%), Positives = 58/84 (69%)

Query: 5  DQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPI 64
          DQ FCLRWNNHQ+TLISVF  LL + TLVDC L+AEGK ++AHKV+LSACSPYFA  L  
Sbjct: 4  DQQFCLRWNNHQSTLISVFDTLLENGTLVDCTLAAEGKLLKAHKVVLSACSPYFATILSQ 63

Query: 65 PKRGMPETFSPDLRFYETDGILPF 88
               P     D++F E   ++ +
Sbjct: 64 QYDKHPIFILKDVKFQELRAMMDY 87




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158292859|ref|XP_001688539.1| AGAP005245-PL [Anopheles gambiae str. PEST] gi|157017191|gb|EDO64122.1| AGAP005245-PL [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292843|ref|XP_001688534.1| AGAP005245-PK [Anopheles gambiae str. PEST] gi|157017183|gb|EDO64117.1| AGAP005245-PK [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292861|ref|XP_001688540.1| AGAP005245-PE [Anopheles gambiae str. PEST] gi|157017192|gb|EDO64123.1| AGAP005245-PE [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292845|ref|XP_001230985.2| AGAP005245-PD [Anopheles gambiae str. PEST] gi|157017184|gb|EAU76838.2| AGAP005245-PD [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|28573897|ref|NP_788319.1| longitudinals lacking, isoform Q [Drosophila melanogaster] gi|28380930|gb|AAM68768.2| longitudinals lacking, isoform Q [Drosophila melanogaster] gi|281183401|gb|ADA53569.1| FI13033p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198460523|ref|XP_002138845.1| GA25026 [Drosophila pseudoobscura pseudoobscura] gi|198137044|gb|EDY69403.1| GA25026 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195333183|ref|XP_002033271.1| GM20503 [Drosophila sechellia] gi|194125241|gb|EDW47284.1| GM20503 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195153485|ref|XP_002017656.1| GL17189 [Drosophila persimilis] gi|194113452|gb|EDW35495.1| GL17189 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|29539391|dbj|BAC67578.1| Lola protein isoform B [Drosophila melanogaster] gi|29539431|dbj|BAC67598.1| Lola protein isoform B [Drosophila melanogaster] gi|29539471|dbj|BAC67618.1| Lola protein isoform B [Drosophila melanogaster] gi|29539511|dbj|BAC67638.1| Lola protein isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query94
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.893 0.086 0.547 8.6e-19
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.925 0.107 0.426 2.1e-14
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.595 0.052 0.614 3.2e-14
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.882 0.094 0.433 3.8e-14
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.563 0.066 0.641 1.8e-13
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.893 0.087 0.428 2.4e-13
FB|FBgn0264981 1089 mamo "maternal gene required f 0.893 0.077 0.459 3.6e-13
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.914 0.088 0.395 1.7e-12
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.936 0.692 0.375 2.4e-12
FB|FBgn0263102 1085 psq "pipsqueak" [Drosophila me 0.893 0.077 0.448 3.8e-11
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 238 (88.8 bits), Expect = 8.6e-19, P = 8.6e-19
 Identities = 46/84 (54%), Positives = 58/84 (69%)

Query:     5 DQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPI 64
             DQ FCLRWNNHQ+TLISVF  LL + TLVDC L+AEGK ++AHKV+LSACSPYFA  L  
Sbjct:     4 DQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFATLLQE 63

Query:    65 PKRGMPETFSPDLRFYETDGILPF 88
                  P     D+++ E   ++ +
Sbjct:    64 QYDKHPIFILKDVKYQELRAMMDY 87




GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS
GO:0007411 "axon guidance" evidence=IGI;NAS;IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007409 "axonogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0016199 "axon midline choice point recognition" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0007464 "R3/R4 cell fate commitment" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0001964 "startle response" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0264981 mamo "maternal gene required for meiosis" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263102 psq "pipsqueak" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
pfam00651101 pfam00651, BTB, BTB/POZ domain 3e-09
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 1e-05
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 0.003
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 49.2 bits (118), Expect = 3e-09
 Identities = 15/36 (41%), Positives = 19/36 (52%)

Query: 23 FHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYF 58
           + L  +  L D  L    K   AHK +L+ACSPYF
Sbjct: 1  LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYF 36


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 94
PHA02713 557 hypothetical protein; Provisional 99.86
KOG4441|consensus 571 99.85
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.75
PHA02790 480 Kelch-like protein; Provisional 99.73
KOG4350|consensus 620 99.72
PHA03098 534 kelch-like protein; Provisional 99.69
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.63
KOG4591|consensus 280 99.37
KOG2075|consensus 521 99.35
KOG0783|consensus 1267 99.12
KOG2838|consensus 401 98.87
KOG4682|consensus 488 98.46
KOG0783|consensus 1267 98.4
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 97.6
KOG2838|consensus401 97.47
KOG0511|consensus 516 96.84
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 96.65
KOG0511|consensus 516 96.62
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.53
KOG2716|consensus 230 95.8
KOG3473|consensus112 93.74
KOG1987|consensus 297 93.61
KOG2714|consensus 465 92.52
KOG1724|consensus162 83.37
PF09593117 Pathogen_betaC1: Beta-satellite pathogenicity beta 80.08
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.86  E-value=6.7e-22  Score=142.64  Aligned_cols=84  Identities=23%  Similarity=0.292  Sum_probs=76.4

Q ss_pred             eeCCcHHHHHHHHHHHHhCCCcccEEEEeC-CeEEEhhHHHhhccCHHHHhhCCC--CCC-CCCeEEcCCCCHHHHHHhh
Q psy16401         11 RWNNHQNTLISVFHNLLNSSTLVDCALSAE-GKTIQAHKVLLSACSPYFAVSLPI--PKR-GMPETFSPDLRFYETDGIL   86 (94)
Q Consensus        11 ~~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~-~~~~~~Hk~vL~a~S~~f~~~f~~--~~~-~~~~i~l~~~~~~~~~~lL   86 (94)
                      ..+.|+..+++.|+++|.++.+|||+|.++ |+.|+|||.||||+|+||++||++  .+. .+.+|.|+++++++++.+|
T Consensus         4 ~~~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~~e~~~~~~v~l~~v~~~~~~~ll   83 (557)
T PHA02713          4 DDIKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPMIIRDLVTRVNLQMFDKDAVKNIV   83 (557)
T ss_pred             chhhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCchhhccCceEEeccCCHHHHHHHH
Confidence            346889999999999999999999999997 899999999999999999999965  433 4788999999999999999


Q ss_pred             cccccCCC
Q psy16401         87 PFAREDLL   94 (94)
Q Consensus        87 ~f~Ytg~l   94 (94)
                      +|+|||+|
T Consensus        84 ~y~Yt~~i   91 (557)
T PHA02713         84 QYLYNRHI   91 (557)
T ss_pred             HHhcCCCC
Confidence            99999974



>KOG4441|consensus Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>PF09593 Pathogen_betaC1: Beta-satellite pathogenicity beta C1 protein; InterPro: IPR018583 Cotton leaf-curl disease - CLCuD - is of major economic importance in cotton-growing areas of the far-east Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query94
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 1e-12
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 1e-12
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 8e-12
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 1e-11
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 3e-11
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 3e-11
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 3e-11
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 7e-11
2vpk_A116 Myoneurin; transcription regulation, transcription 7e-11
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 8e-11
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 2e-10
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-10
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 2e-10
3b84_A119 Zinc finger and BTB domain-containing protein 48; 3e-10
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 4e-10
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 6e-10
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 1e-09
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 7e-09
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 9e-09
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 3e-08
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
 Score = 58.0 bits (141), Expect = 1e-12
 Identities = 13/55 (23%), Positives = 25/55 (45%)

Query: 4  GDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYF 58
          G     +++  H + ++   + L +   L D  +    +  +AHK +L ACS  F
Sbjct: 1  GSADSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLF 55


>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.94
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.93
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.93
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.93
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.93
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.93
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.93
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.93
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.93
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.92
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.92
2vpk_A116 Myoneurin; transcription regulation, transcription 99.91
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.91
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.9
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.88
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.87
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.87
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.85
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.85
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.82
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.12
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.04
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.51
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.39
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.37
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.36
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.75
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.52
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 97.47
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.28
3drx_A 202 BTB/POZ domain-containing protein KCTD5; golgi, gr 94.2
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 93.79
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 92.06
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 90.49
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 90.17
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
Probab=99.94  E-value=1.7e-26  Score=137.35  Aligned_cols=91  Identities=23%  Similarity=0.313  Sum_probs=84.4

Q ss_pred             CCcceEEeeCCcHHHHHHHHHHHHhCCCcccEEEEeCCeEEEhhHHHhhccCHHHHhhCCCCCCCCCeEEcCC-CCHHHH
Q psy16401          4 GDQHFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPD-LRFYET   82 (94)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~Hk~vL~a~S~~f~~~f~~~~~~~~~i~l~~-~~~~~~   82 (94)
                      +.....+.++.|+..+++.++++++++.+|||++.++|+.|+|||.||+++|+||+++|.........|.+++ ++++.|
T Consensus         4 ~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~~~~f~aHk~vLaa~S~yF~~~f~~~~~e~~~i~l~~~~~~~~f   83 (125)
T 3ohu_A            4 GSPMYVYESTVHCTNILLGLNDQRKKDILCDVTLIVERKEFRAHRAVLAACSEYFWQALVGQTKNDLVVSLPEEVTARGF   83 (125)
T ss_dssp             SCCCEEEECSSHHHHHHHHHHHHHHHTCSCCEEEEETTEEEEECHHHHHHHBHHHHHHHTTCCCSSCEEECCTTCCHHHH
T ss_pred             CCcceeeecHHHHHHHHHHHHHHHhcCCccceEEEECCEEEechHHHHHHcCHHHHHHhcCCCCCCcEEEeCCCCCHHHH
Confidence            4556788999999999999999999999999999999999999999999999999999987666688999998 999999


Q ss_pred             HHhhcccccCCC
Q psy16401         83 DGILPFAREDLL   94 (94)
Q Consensus        83 ~~lL~f~Ytg~l   94 (94)
                      +.+|+|+|||++
T Consensus        84 ~~~l~~iYtg~~   95 (125)
T 3ohu_A           84 GPLLQFAYTAKL   95 (125)
T ss_dssp             HHHHHHHTTSEE
T ss_pred             HHHHHhHcCCce
Confidence            999999999964



>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 94
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 8e-10
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-09
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 49.3 bits (117), Expect = 8e-10
 Identities = 12/49 (24%), Positives = 24/49 (48%)

Query: 10 LRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYF 58
          +++  H + ++   + L +   L D  +    +  +AHK +L ACS  F
Sbjct: 3  IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLF 51


>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query94
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.94
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.93
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.64
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 97.15
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 97.13
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.55
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.38
d1t1da_100 Shaker potassium channel {California sea hare (Apl 95.28
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=4.5e-27  Score=138.38  Aligned_cols=85  Identities=19%  Similarity=0.208  Sum_probs=78.9

Q ss_pred             ceEEeeCCcHHHHHHHHHHHHhCCCcccEEEEeCCeEEEhhHHHhhccCHHHHhhCCCCCCCCCeEEcCCCCHHHHHHhh
Q psy16401          7 HFCLRWNNHQNTLISVFHNLLNSSTLVDCALSAEGKTIQAHKVLLSACSPYFAVSLPIPKRGMPETFSPDLRFYETDGIL   86 (94)
Q Consensus         7 ~~~~~~~~~~~~~~~~l~~~~~~~~~~Dv~~~~~~~~~~~Hk~vL~a~S~~f~~~f~~~~~~~~~i~l~~~~~~~~~~lL   86 (94)
                      .+.+.+++|+..+++.|+++|.++.+||++|.++|++|+|||+|||++|+||+++|..   +..++.++++++++|+.+|
T Consensus         3 ~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~lf~~---~~~~i~~~~v~~~~f~~ll   79 (121)
T d1buoa_           3 MIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHR---NSQHYTLDFLSPKTFQQIL   79 (121)
T ss_dssp             CCCCCCTTHHHHHHHHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHHTTS---CCSEEEECSSCHHHHHHHH
T ss_pred             eEEEcCCchHHHHHHHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhhccC---ccceeecCCCCHHHHHHHH
Confidence            3567789999999999999999999999999999999999999999999999999954   3468999999999999999


Q ss_pred             cccccCCC
Q psy16401         87 PFAREDLL   94 (94)
Q Consensus        87 ~f~Ytg~l   94 (94)
                      +|+|||++
T Consensus        80 ~~~Ytg~i   87 (121)
T d1buoa_          80 EYAYTATL   87 (121)
T ss_dssp             HHHHHSCC
T ss_pred             HheEcccc
Confidence            99999985



>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure