Psyllid ID: psy1644
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 923 | ||||||
| 195394067 | 1427 | GJ19488 [Drosophila virilis] gi|19415017 | 0.306 | 0.198 | 0.652 | 1e-107 | |
| 328711155 | 1700 | PREDICTED: clathrin heavy chain-like iso | 0.213 | 0.115 | 0.818 | 1e-90 | |
| 357631594 | 1681 | clathrin heavy chain [Danaus plexippus] | 0.216 | 0.118 | 0.799 | 1e-90 | |
| 219362829 | 1681 | clathrin heavy chain [Bombyx mori] gi|21 | 0.216 | 0.118 | 0.803 | 3e-90 | |
| 242006398 | 1680 | clathrin heavy chain, putative [Pediculu | 0.202 | 0.111 | 0.837 | 8e-89 | |
| 91085095 | 1684 | PREDICTED: similar to AGAP003021-PA [Tri | 0.216 | 0.118 | 0.784 | 1e-88 | |
| 328711157 | 1693 | PREDICTED: clathrin heavy chain-like iso | 0.206 | 0.112 | 0.818 | 2e-88 | |
| 307200331 | 1678 | Clathrin heavy chain [Harpegnathos salta | 0.210 | 0.115 | 0.799 | 3e-88 | |
| 380013532 | 1635 | PREDICTED: LOW QUALITY PROTEIN: clathrin | 0.210 | 0.118 | 0.799 | 4e-88 | |
| 307168135 | 1676 | Clathrin heavy chain [Camponotus florida | 0.210 | 0.115 | 0.799 | 4e-88 |
| >gi|195394067|ref|XP_002055667.1| GJ19488 [Drosophila virilis] gi|194150177|gb|EDW65868.1| GJ19488 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Score = 397 bits (1019), Expect = e-107, Method: Compositional matrix adjust.
Identities = 207/317 (65%), Positives = 231/317 (72%), Gaps = 34/317 (10%)
Query: 210 LTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISADSAIMN 269
LTNVGIN S SF+TLTMESDKFICVREK ++AQVVIIDMND +NP RRPISADSAIMN
Sbjct: 15 LTNVGINPNSFSFSTLTMESDKFICVREKTNDTAQVVIIDMNDSSNPTRRPISADSAIMN 74
Query: 270 PASKVIALKGKAGNDNNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTLALVTE 329
PASKVIALK A KTLQIFNIEMKSKMKAH M +DVVFWKWIS NTLALVTE
Sbjct: 75 PASKVIALK----------AQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLALVTE 124
Query: 330 TSVYHWSMEGDSTPEKMFDRHSTLNGCQIINYRTDPKQTWLLLIGISAVSNRVVGAMQLY 389
TSV+HWSMEGDS P+KMFDRHS+LNGCQIINYR + Q WLLL+GISA+ +RV GAMQLY
Sbjct: 125 TSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGAMQLY 184
Query: 390 SVERKCSQPIEEKKSRVAANAPKGILRTPQTIVKFQQVPTPAGQTSPLLQYFGILLDHGK 449
SVERK SQ IE + A + R + +V +TS L I +
Sbjct: 185 SVERKVSQAIEGHAASFATSRS----RCSENLVDL-------VKTSDLTLALSIYMRANV 233
Query: 450 LNKHESLELCRPVLAQVIQSFAETGQFQKIVLYAKKVGYSPDYVFLLRNVMRVNPDQGVG 509
NK VIQ FAETGQFQKIVLYAKKV Y+PDY+FLLR+VMR NP+QG G
Sbjct: 234 PNK-------------VIQCFAETGQFQKIVLYAKKVNYTPDYIFLLRSVMRSNPEQGAG 280
Query: 510 FAQMLVQDDEPLADINQ 526
FA MLV ++EPLADINQ
Sbjct: 281 FASMLVAEEEPLADINQ 297
|
Source: Drosophila virilis Species: Drosophila virilis Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328711155|ref|XP_003244459.1| PREDICTED: clathrin heavy chain-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|357631594|gb|EHJ79063.1| clathrin heavy chain [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|219362829|ref|NP_001136443.1| clathrin heavy chain [Bombyx mori] gi|218563475|dbj|BAH03459.1| clathrin [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|242006398|ref|XP_002424037.1| clathrin heavy chain, putative [Pediculus humanus corporis] gi|212507343|gb|EEB11299.1| clathrin heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|91085095|ref|XP_967829.1| PREDICTED: similar to AGAP003021-PA [Tribolium castaneum] gi|270008499|gb|EFA04947.1| hypothetical protein TcasGA2_TC015014 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328711157|ref|XP_001945333.2| PREDICTED: clathrin heavy chain-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307200331|gb|EFN80585.1| Clathrin heavy chain [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|380013532|ref|XP_003690808.1| PREDICTED: LOW QUALITY PROTEIN: clathrin heavy chain-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307168135|gb|EFN61414.1| Clathrin heavy chain [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 923 | ||||||
| FB|FBgn0000319 | 1678 | Chc "Clathrin heavy chain" [Dr | 0.196 | 0.107 | 0.785 | 5.2e-157 | |
| UNIPROTKB|F1MPU0 | 1661 | CLTC "Clathrin heavy chain 1" | 0.196 | 0.108 | 0.780 | 1.8e-153 | |
| UNIPROTKB|Q00610 | 1675 | CLTC "Clathrin heavy chain 1" | 0.196 | 0.108 | 0.780 | 1.9e-153 | |
| MGI|MGI:2388633 | 1675 | Cltc "clathrin, heavy polypept | 0.196 | 0.108 | 0.780 | 1.9e-153 | |
| UNIPROTKB|F1PHQ0 | 1675 | CLTC "Uncharacterized protein" | 0.196 | 0.108 | 0.780 | 1.9e-153 | |
| UNIPROTKB|P49951 | 1675 | CLTC "Clathrin heavy chain 1" | 0.196 | 0.108 | 0.780 | 1.9e-153 | |
| UNIPROTKB|D4AD25 | 1679 | Cltc "Clathrin heavy chain 1" | 0.200 | 0.110 | 0.769 | 2.5e-153 | |
| ZFIN|ZDB-GENE-050227-12 | 1683 | cltcb "clathrin, heavy polypep | 0.201 | 0.110 | 0.764 | 2.6e-153 | |
| RGD|2364 | 1675 | Cltc "clathrin, heavy chain (H | 0.196 | 0.108 | 0.780 | 6.5e-153 | |
| UNIPROTKB|P11442 | 1675 | Cltc "Clathrin heavy chain 1" | 0.196 | 0.108 | 0.780 | 6.5e-153 |
| FB|FBgn0000319 Chc "Clathrin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 745 (267.3 bits), Expect = 5.2e-157, Sum P(3) = 5.2e-157
Identities = 150/191 (78%), Positives = 162/191 (84%)
Query: 210 LTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISADSAIMN 269
LTNVGIN S SF+TLTMESDKFICVREK+ ++AQVVIIDMND TNP RRPISADSAIMN
Sbjct: 15 LTNVGINANSFSFSTLTMESDKFICVREKVNDTAQVVIIDMNDATNPTRRPISADSAIMN 74
Query: 270 PASKVIALKGKAGNDNNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTLALVTE 329
PASKVIALK A KTLQIFNIEMKSKMKAH M +DVVFWKWIS NTLALVTE
Sbjct: 75 PASKVIALK----------AQKTLQIFNIEMKSKMKAHTMNEDVVFWKWISLNTLALVTE 124
Query: 330 TSVYHWSMEGDSTPEKMFDRHSTLNGCQIINYRTDPKQTWLLLIGISAVSNRVVGAMQLY 389
TSV+HWSMEGDS P+KMFDRHS+LNGCQIINYR + Q WLLL+GISA+ +RV GAMQLY
Sbjct: 125 TSVFHWSMEGDSMPQKMFDRHSSLNGCQIINYRCNASQQWLLLVGISALPSRVAGAMQLY 184
Query: 390 SVERKCSQPIE 400
SVERK SQ IE
Sbjct: 185 SVERKVSQAIE 195
|
|
| UNIPROTKB|F1MPU0 CLTC "Clathrin heavy chain 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q00610 CLTC "Clathrin heavy chain 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2388633 Cltc "clathrin, heavy polypeptide (Hc)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PHQ0 CLTC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49951 CLTC "Clathrin heavy chain 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AD25 Cltc "Clathrin heavy chain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050227-12 cltcb "clathrin, heavy polypeptide b (Hc)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|2364 Cltc "clathrin, heavy chain (Hc)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11442 Cltc "Clathrin heavy chain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 923 | |||
| smart00299 | 140 | smart00299, CLH, Clathrin heavy chain repeat homol | 3e-22 | |
| pfam13838 | 66 | pfam13838, Clathrin_H_link, Clathrin-H-link | 2e-19 | |
| pfam00637 | 143 | pfam00637, Clathrin, Region in Clathrin and VPS | 2e-17 | |
| smart00299 | 140 | smart00299, CLH, Clathrin heavy chain repeat homol | 2e-12 | |
| pfam00637 | 143 | pfam00637, Clathrin, Region in Clathrin and VPS | 3e-09 | |
| pfam13838 | 66 | pfam13838, Clathrin_H_link, Clathrin-H-link | 3e-08 | |
| pfam09268 | 24 | pfam09268, Clathrin-link, Clathrin, heavy-chain li | 2e-07 | |
| pfam01394 | 37 | pfam01394, Clathrin_propel, Clathrin propeller rep | 0.004 |
| >gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
Score = 93.1 bits (232), Expect = 3e-22
Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 6/112 (5%)
Query: 528 YEGLFYFLGSIVN-YSQDQEVHFKYIQAACKTGQIKEVERICRESNCYNAERVKNFLKEA 586
E L +L S + S++ + K I+ K KE+ER+ +SN Y+ E+V ++A
Sbjct: 23 LEELIPYLESALKLNSENPALQTKLIELYAKYDPQKEIERLDNKSNHYDIEKVGKLCEKA 82
Query: 587 KLTDQLPLIIVCDRFDFVHDLVLYLYR-NNLQKYIEIYVQKGRKHLLEKWLK 637
KL ++ + D +F +V + N +K IE +V++ E W +
Sbjct: 83 KLYEEAVELYKKD-GNFKDAIVTLIEHLGNYEKAIEYFVKQNNP---ELWAE 130
|
Length = 140 |
| >gnl|CDD|206009 pfam13838, Clathrin_H_link, Clathrin-H-link | Back alignment and domain information |
|---|
| >gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS | Back alignment and domain information |
|---|
| >gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS | Back alignment and domain information |
|---|
| >gnl|CDD|206009 pfam13838, Clathrin_H_link, Clathrin-H-link | Back alignment and domain information |
|---|
| >gnl|CDD|150065 pfam09268, Clathrin-link, Clathrin, heavy-chain linker | Back alignment and domain information |
|---|
| >gnl|CDD|216475 pfam01394, Clathrin_propel, Clathrin propeller repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 923 | |||
| KOG0985|consensus | 1666 | 100.0 | ||
| KOG0985|consensus | 1666 | 100.0 | ||
| PF13838 | 66 | Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1 | 99.65 | |
| PF13838 | 66 | Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1 | 99.17 | |
| PF01394 | 37 | Clathrin_propel: Clathrin propeller repeat; InterP | 98.56 | |
| PF09268 | 24 | Clathrin-link: Clathrin, heavy-chain linker; Inter | 98.35 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.88 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 96.96 | |
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 95.99 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 95.86 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 95.65 | |
| PF02239 | 369 | Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO | 95.64 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 95.07 | |
| PF01394 | 37 | Clathrin_propel: Clathrin propeller repeat; InterP | 94.7 | |
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 94.55 | |
| PF00637 | 143 | Clathrin: Region in Clathrin and VPS; InterPro: IP | 92.01 | |
| KOG0279|consensus | 315 | 90.88 | ||
| PF04841 | 410 | Vps16_N: Vps16, N-terminal region; InterPro: IPR00 | 90.13 | |
| KOG1645|consensus | 463 | 88.25 | ||
| PF10282 | 345 | Lactonase: Lactonase, 7-bladed beta-propeller; Int | 87.82 | |
| TIGR03300 | 377 | assembly_YfgL outer membrane assembly lipoprotein | 87.44 | |
| PRK11138 | 394 | outer membrane biogenesis protein BamB; Provisiona | 87.41 | |
| TIGR02658 | 352 | TTQ_MADH_Hv methylamine dehydrogenase heavy chain. | 86.25 | |
| PF13360 | 238 | PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A | 86.15 | |
| PRK11028 | 330 | 6-phosphogluconolactonase; Provisional | 85.64 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 83.58 | |
| KOG0650|consensus | 733 | 83.3 | ||
| PF07569 | 219 | Hira: TUP1-like enhancer of split; InterPro: IPR01 | 83.21 | |
| KOG0292|consensus | 1202 | 82.97 | ||
| KOG2315|consensus | 566 | 82.92 | ||
| PRK03629 | 429 | tolB translocation protein TolB; Provisional | 82.18 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 80.65 |
| >KOG0985|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-190 Score=1620.80 Aligned_cols=499 Identities=66% Similarity=1.036 Sum_probs=488.8
Q ss_pred ccceeeeccccccccCCcccccceeeecceEEEEEeccCCCceEEEEECCCCCCCcccccCccccccCCCccEEEEeccC
Q psy1644 202 EFKNRIYLLTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISADSAIMNPASKVIALKGKA 281 (923)
Q Consensus 202 ~~~~e~~~Lt~lGI~~~si~F~~lTmESDkyICVRE~~~~~~qVvIVDL~n~~~v~Rrpi~ADSAIMnP~~~IIALra~~ 281 (923)
.|. ||+||+|+||+|++|+|+++||||||||||||+.|+++|||||||+++.+|+||||+||||||||+++|||||
T Consensus 7 ~f~-E~lqL~~~GI~~~~~~F~~~TmESDk~icvRe~~~~~~qVvIiDm~d~~~piRRpisadSaIm~P~kkvialk--- 82 (1666)
T KOG0985|consen 7 RFQ-EHLQLQNLGINPQNIGFSNVTMESDKFICVREKVGGQNQVVIIDMADPVNPIRRPISADSAIMNPDKKVIALK--- 82 (1666)
T ss_pred eHH-HHhcccccCcCccccccceeeeecCceEEEeccCCCcceEEEEEcCCCcccccCCCCCCchhhCchHHHHHHh---
Confidence 455 9999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCeEEEEecccccccccccCCCceeEEEeccCCeEEEEecCeEEEEeccCCCCchhhhhcccCCCCCeeEee
Q psy1644 282 GNDNNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTLALVTETSVYHWSMEGDSTPEKMFDRHSTLNGCQIINY 361 (923)
Q Consensus 282 ~~~n~~~~g~~LQIFNle~K~KLKs~~m~E~VvfWkWis~~tLglVT~taVYHWsi~g~s~P~K~FdR~~~L~~~QIInY 361 (923)
+|++|||||+|+|+|+|+|+|+|+|+||||||+++||+||+||||||+++|+++|+||||||++|+|||||||
T Consensus 83 -------a~~~lQIFniE~KsK~ksh~m~E~VifWkWIs~kti~lVT~tsV~hws~egds~PvkmfdRh~sL~gcQiIny 155 (1666)
T KOG0985|consen 83 -------AGKTLQIFNIERKSKSKAHTMDEDVIFWKWISDKTIALVTATSVYHWSKEGDSAPVKMFDRHRSLNGCQIINY 155 (1666)
T ss_pred -------hCCeEEEEehhhhhhhccCCCCCceEEEEecchhHHHHhhhhheeeecccccchHHHHHHhhhccccceEEEe
Confidence 6889999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeCCCCCeEEEEeeecccccccceeeecccccccccccccce--------------------------------------
Q psy1644 362 RTDPKQTWLLLIGISAVSNRVVGAMQLYSVERKCSQPIEEKK-------------------------------------- 403 (923)
Q Consensus 362 r~d~~~kW~~LvGI~~~~~~i~G~mQLYS~er~~SQ~iEGk~-------------------------------------- 403 (923)
++|..++|++|+||+++++||+|+|||||++|++||+|||++
T Consensus 156 k~~~~~eWl~LVGIs~r~~rv~G~MQLyS~~rkvSQ~iegHaa~Fa~fk~egne~p~~lF~fa~r~~~~GkLhiiEvg~~ 235 (1666)
T KOG0985|consen 156 KGNLNAEWLALVGISARTNRVAGKMQLYSVDRKVSQPIEGHAASFAAFKDEGNEVPSCLFSFAVRKPTGGKLHIIEVGDP 235 (1666)
T ss_pred ccccccCceeEEeeecccchhheeeeeeeeccchhhhhHHHHHHHHHhcccCCCCceEEEEecCCCCCCCeeEEEecCCC
Confidence 999999999999999999999999999999999999999900
Q ss_pred --------------------------------------------------------------------------------
Q psy1644 404 -------------------------------------------------------------------------------- 403 (923)
Q Consensus 404 -------------------------------------------------------------------------------- 403 (923)
T Consensus 236 ~tg~~~f~kk~vDvffppda~nDFPvamqvs~k~~vIyLiTKyG~ihlYdlEt~tciy~NRIs~dtIFvta~~~~s~Gi~ 315 (1666)
T KOG0985|consen 236 PTGNMPFLKKKVDVFFPPDAINDFPVAMQVSAKYGVIYLITKYGYIHLYDLETGTCIYRNRISADTIFVTAPHDSSSGIQ 315 (1666)
T ss_pred ccCCCcchhhhhhccCChhhccccchheeeccccCeEEEEeecchhhhhhhhhhhhhhhhhccccceeEecccccCcchh
Confidence
Q ss_pred ----------------------------------------------------------------eEEeccCCCccccCHH
Q psy1644 404 ----------------------------------------------------------------SRVAANAPKGILRTPQ 419 (923)
Q Consensus 404 ----------------------------------------------------------------AkvAA~SP~giLRt~e 419 (923)
||+||+||+||||||+
T Consensus 316 ~iNrKGQVLsv~v~e~~IVpyi~~~LqnpeLal~~A~R~nLaGAe~Lfv~rFneLfaqG~Y~eAAkvAAsSPrgILRt~~ 395 (1666)
T KOG0985|consen 316 GINRKGQVLSVLVNEQNIVPYITNVLQNPELALRLAVRANLAGAENLFVRRFNELFAQGEYEEAAKVAASSPRGILRTPG 395 (1666)
T ss_pred hhhhcceEEEEEecCcceehhhhccccChHHHHHhhhhcCCccHHHHHHHHHHHHHhCccHHHHHHHHHhCchhhhcCHH
Confidence 9999999999999999
Q ss_pred HHHhhhcCCCCCCCCchHHHHHHHHHhcCCCCcccccccchhhHHH----------------------------------
Q psy1644 420 TIVKFQQVPTPAGQTSPLLQYFGILLDHGKLNKHESLELCRPVLAQ---------------------------------- 465 (923)
Q Consensus 420 TI~rFK~vp~~pGq~sPLL~YF~~LL~~g~LN~~ESlEL~rpVL~Q---------------------------------- 465 (923)
||+|||++|++|||++|||||||+||++|+||++||||||||||+|
T Consensus 396 Ti~kFq~V~a~~Gq~sPLLqYFg~LLdqGkLNk~ETLEL~RpVL~Q~RkqLlekWl~EdKLeCSEELGDlVK~~d~~lAL 475 (1666)
T KOG0985|consen 396 TINKFQSVPAQPGQPSPLLQYFGTLLDQGKLNKYETLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKPYDTTLAL 475 (1666)
T ss_pred HHHHHHcCCCCCCCCCcHHHHHHHHHhcccccHHHHHHHHHHHHhhhHHHHHHHHhhhhhhhhhHHhcCccccCCchHHH
Confidence 9999999999999999999999999999999999999999999999
Q ss_pred -----------HHHHHHHhcChhHHHHHHHHhCCCccHHHHHHHHHhcCCchhhHHHHhhhcCCCCCcCccc--------
Q psy1644 466 -----------VIQSFAETGQFQKIVLYAKKVGYSPDYVFLLRNVMRVNPDQGVGFAQMLVQDDEPLADINQ-------- 526 (923)
Q Consensus 466 -----------Vi~clae~Gqfdkiv~Y~~~vgytpDy~~LL~~i~~~nP~~a~efA~~L~~~~~pl~di~~-------- 526 (923)
|++||||+|||+||+.||+|+||||||+++||+++|++||+|++||.||.++++|++|+++
T Consensus 476 ~iYlrAnvp~KVi~cfAE~Gqf~KiilY~kKvGyTPdymflLq~l~r~sPD~~~qFa~~l~Q~~~~~~die~I~DlFme~ 555 (1666)
T KOG0985|consen 476 SIYLRANVPAKVIQCFAETGQFKKIILYAKKVGYTPDYMFLLQQLKRSSPDQALQFAMMLVQDEEPLADIEQIVDLFMEL 555 (1666)
T ss_pred HHHHHcCCcHHHHHHHHHhcchhHHHHHHHHcCCCccHHHHHHHHHccChhHHHHHHHHhhccCCCcccHHHHHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999998
Q ss_pred --------------------------------------------------------------------------------
Q psy1644 527 -------------------------------------------------------------------------------- 526 (923)
Q Consensus 527 -------------------------------------------------------------------------------- 526 (923)
T Consensus 556 N~iQq~TSFLLdaLK~~~Pd~g~LQTrLLE~NL~~aPqVADAILgN~mFtHyDra~IAqLCEKAGL~qraLehytDl~DI 635 (1666)
T KOG0985|consen 556 NLIQQCTSFLLDALKLNSPDEGHLQTRLLEMNLVHAPQVADAILGNDMFTHYDRAEIAQLCEKAGLLQRALEHYTDLYDI 635 (1666)
T ss_pred HhhhhhHHHHHHHhcCCChhhhhHHHHHHHHHhccchHHHHHHHhccccccccHHHHHHHHHhcchHHHHHHhcccHHHH
Confidence
Q ss_pred ----------------------------------------------------------------------cchhhhhhhc
Q psy1644 527 ----------------------------------------------------------------------SYEGLFYFLG 536 (923)
Q Consensus 527 ----------------------------------------------------------------------~~egLyy~Lg 536 (923)
+|||||||||
T Consensus 636 KR~vVhth~L~pEwLv~yFg~lsve~s~eclkaml~~NirqNlQi~VQvatky~eqlg~~~li~lFE~fks~eGL~yfLg 715 (1666)
T KOG0985|consen 636 KRVVVHTHLLNPEWLVNYFGSLSVEDSLECLKAMLSANIRQNLQIVVQVATKYHEQLGAQALIELFESFKSYEGLYYFLG 715 (1666)
T ss_pred HHHHHHhccCCHHHHHHHHHhcCHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHhCHHHHHHHHHhhccchhHHHHHH
Confidence 6999999999
Q ss_pred ccccccCCcchhhHHHHHHHhcCChhhhHHhhhcCCccChHHHHhHHhhccCCCCCceEEeeccccchhHHHHHHHhcCc
Q psy1644 537 SIVNYSQDQEVHFKYIQAACKTGQIKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNL 616 (923)
Q Consensus 537 sivn~s~d~dVhfKYIeAA~k~gq~~EvERicresn~YdpekvKnfLKeakL~d~~PLI~VCDrf~fV~dLv~YLY~n~~ 616 (923)
||||+|||||||||||||||||||+|||||||||||||||||||||||||||+||+||||||||||||||||+|||+||+
T Consensus 716 Sivn~seDpevh~KYIqAA~kt~QikEvERicresn~YdpErvKNfLkeAkL~DqlPLiiVCDRf~fVhdlvlYLyrnn~ 795 (1666)
T KOG0985|consen 716 SIVNFSEDPEVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNL 795 (1666)
T ss_pred HHhccccCchHHHHHHHHHHhhccHHHHHHHHhccccCCHHHHHHHHHhccccccCceEEEecccccHHHHHHHHHHhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hheehhhhhccCccccceeee-eccccCCHHHhhhhhccCcchhhhHHhhhccccccchhhHHHHH-hhcchhHHHHHHH
Q psy1644 617 QKYIEIYVQKGRKHLLEKWLK-EEKLECSEELGDLVKQSDPTLALSVYLRANIKQSRFVHDLVLYL-YRNNLQKYIEIYV 694 (923)
Q Consensus 617 ~k~IEvYvqkvNp~~tP~Vvg-LlD~dc~E~~Ik~LL~sv~~l~~~~~v~~~~~~~~pv~~Lv~ev-~RnrL~kll~p~L 694 (923)
+||||+|||||||+|||+||| |||+|||||+||+|++|| +|++|+||||+|| ||||| |||+|||
T Consensus 796 ~kyIE~yVQkvNps~~p~VvG~LLD~dC~E~~ik~Li~~v-------------~gq~~~deLv~EvEkRNRL-klLlp~L 861 (1666)
T KOG0985|consen 796 QKYIEIYVQKVNPSRTPQVVGALLDVDCSEDFIKNLILSV-------------RGQFPVDELVEEVEKRNRL-KLLLPWL 861 (1666)
T ss_pred HHHHHHHHhhcCCcccchhhhhhhcCCCcHHHHHHHHHHH-------------hccCChHHHHHHHHhhhhH-HHHHHHH
Confidence 999999999999999999999 999999999999999996 6777999999999 69999 9999999
Q ss_pred HHHHHhhcccchhhhHHHHhH---hcCccceeee
Q psy1644 695 QKIRIKIKQSRFVHDLVLYLY---RNNLQKYIEI 725 (923)
Q Consensus 695 E~~~~~g~q~~~v~nalakiy---~~~~~~~~~i 725 (923)
|++++||+||||+|||||||| +++|++|+.=
T Consensus 862 E~~i~eG~~d~a~hnAlaKIyIDSNNnPE~fLke 895 (1666)
T KOG0985|consen 862 ESLIQEGSQDPATHNALAKIYIDSNNNPERFLKE 895 (1666)
T ss_pred HHHHhccCcchHHHhhhhheeecCCCChHHhccc
Confidence 999999999999999999999 7779988753
|
|
| >KOG0985|consensus | Back alignment and domain information |
|---|
| >PF13838 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1_I 1BPO_C 1C9I_B 1C9L_A | Back alignment and domain information |
|---|
| >PF13838 Clathrin_H_link: Clathrin-H-link; PDB: 2XZG_A 3GD1_I 1BPO_C 1C9I_B 1C9L_A | Back alignment and domain information |
|---|
| >PF01394 Clathrin_propel: Clathrin propeller repeat; InterPro: IPR022365 This entry represents the propeller repeat found in clathrin heavy chains | Back alignment and domain information |
|---|
| >PF09268 Clathrin-link: Clathrin, heavy-chain linker; InterPro: IPR015348 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF01394 Clathrin_propel: Clathrin propeller repeat; InterPro: IPR022365 This entry represents the propeller repeat found in clathrin heavy chains | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 | Back alignment and domain information |
|---|
| >TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL | Back alignment and domain information |
|---|
| >PRK11138 outer membrane biogenesis protein BamB; Provisional | Back alignment and domain information |
|---|
| >TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain | Back alignment and domain information |
|---|
| >PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A | Back alignment and domain information |
|---|
| >PRK11028 6-phosphogluconolactonase; Provisional | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG0650|consensus | Back alignment and domain information |
|---|
| >PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin | Back alignment and domain information |
|---|
| >KOG0292|consensus | Back alignment and domain information |
|---|
| >KOG2315|consensus | Back alignment and domain information |
|---|
| >PRK03629 tolB translocation protein TolB; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 923 | ||||
| 1xi4_A | 1630 | Clathrin D6 Coat Length = 1630 | 6e-84 | ||
| 1xi4_A | 1630 | Clathrin D6 Coat Length = 1630 | 3e-52 | ||
| 1xi4_A | 1630 | Clathrin D6 Coat Length = 1630 | 3e-52 | ||
| 1xi4_A | 1630 | Clathrin D6 Coat Length = 1630 | 2e-31 | ||
| 1bpo_A | 494 | Clathrin Heavy-Chain Terminal Domain And Linker Len | 1e-83 | ||
| 1bpo_A | 494 | Clathrin Heavy-Chain Terminal Domain And Linker Len | 3e-52 | ||
| 1utc_A | 363 | Clathrin Terminal Domain Complexed With Tlpwdlwtt L | 1e-83 | ||
| 1utc_A | 363 | Clathrin Terminal Domain Complexed With Tlpwdlwtt L | 4e-43 | ||
| 2xzg_A | 365 | Clathrin Terminal Domain Complexed With Pitstop 1 L | 1e-83 | ||
| 2xzg_A | 365 | Clathrin Terminal Domain Complexed With Pitstop 1 L | 8e-44 | ||
| 4g55_A | 369 | Clathrin Terminal Domain Complexed With Pitstop 2 L | 1e-83 | ||
| 4g55_A | 369 | Clathrin Terminal Domain Complexed With Pitstop 2 L | 8e-44 | ||
| 1c9i_A | 359 | Peptide-In-Groove Interactions Link Target Proteins | 2e-83 | ||
| 1c9i_A | 359 | Peptide-In-Groove Interactions Link Target Proteins | 4e-41 | ||
| 1c9l_A | 357 | Peptide-In-Groove Interactions Link Target Proteins | 2e-83 | ||
| 1c9l_A | 357 | Peptide-In-Groove Interactions Link Target Proteins | 4e-41 |
| >pdb|1XI4|A Chain A, Clathrin D6 Coat Length = 1630 | Back alignment and structure |
|
| >pdb|1XI4|A Chain A, Clathrin D6 Coat Length = 1630 | Back alignment and structure |
| >pdb|1XI4|A Chain A, Clathrin D6 Coat Length = 1630 | Back alignment and structure |
| >pdb|1XI4|A Chain A, Clathrin D6 Coat Length = 1630 | Back alignment and structure |
| >pdb|1BPO|A Chain A, Clathrin Heavy-Chain Terminal Domain And Linker Length = 494 | Back alignment and structure |
| >pdb|1BPO|A Chain A, Clathrin Heavy-Chain Terminal Domain And Linker Length = 494 | Back alignment and structure |
| >pdb|1UTC|A Chain A, Clathrin Terminal Domain Complexed With Tlpwdlwtt Length = 363 | Back alignment and structure |
| >pdb|1UTC|A Chain A, Clathrin Terminal Domain Complexed With Tlpwdlwtt Length = 363 | Back alignment and structure |
| >pdb|2XZG|A Chain A, Clathrin Terminal Domain Complexed With Pitstop 1 Length = 365 | Back alignment and structure |
| >pdb|2XZG|A Chain A, Clathrin Terminal Domain Complexed With Pitstop 1 Length = 365 | Back alignment and structure |
| >pdb|4G55|A Chain A, Clathrin Terminal Domain Complexed With Pitstop 2 Length = 369 | Back alignment and structure |
| >pdb|4G55|A Chain A, Clathrin Terminal Domain Complexed With Pitstop 2 Length = 369 | Back alignment and structure |
| >pdb|1C9I|A Chain A, Peptide-In-Groove Interactions Link Target Proteins To The B-Propeller Of Clathrin Length = 359 | Back alignment and structure |
| >pdb|1C9I|A Chain A, Peptide-In-Groove Interactions Link Target Proteins To The B-Propeller Of Clathrin Length = 359 | Back alignment and structure |
| >pdb|1C9L|A Chain A, Peptide-In-Groove Interactions Link Target Proteins To The B-Propeller Of Clathrin Length = 357 | Back alignment and structure |
| >pdb|1C9L|A Chain A, Peptide-In-Groove Interactions Link Target Proteins To The B-Propeller Of Clathrin Length = 357 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 923 | |||
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 8e-88 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 2e-58 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 1e-45 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 1e-27 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 7e-87 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 1e-56 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 2e-48 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 3e-27 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 7e-25 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 2e-16 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 5e-79 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 3e-54 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 7e-53 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 1e-49 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 2e-44 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 2e-28 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 6e-26 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Length = 494 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 923 | |||
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 100.0 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 100.0 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 100.0 | |
| 1bpo_A | 494 | Protein (clathrin); clathrin endocytosis beta-prop | 100.0 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 100.0 | |
| 2xzh_A | 365 | Clathrin heavy chain 1; endocytosis, endocytosis i | 100.0 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 98.0 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.98 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.67 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.65 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.61 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.55 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 97.46 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.38 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 97.38 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.34 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.24 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.23 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 97.18 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.15 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.14 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.13 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.09 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.06 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.01 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 96.98 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 96.98 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 96.95 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 96.88 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 96.88 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 96.88 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.88 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.87 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 96.85 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 96.81 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 96.81 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 96.8 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 96.8 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 96.78 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 96.75 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.71 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 96.67 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 96.63 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 96.6 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.49 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 96.49 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 96.42 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 96.41 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 96.4 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.39 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 96.37 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 96.34 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 96.3 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 96.26 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 96.25 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 96.22 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 96.19 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 96.15 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 96.12 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 96.06 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 95.99 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 95.98 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 95.97 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 95.96 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 95.92 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 95.9 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 95.89 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 95.88 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 95.69 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 95.57 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 95.44 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 95.36 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 95.17 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 95.1 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 95.02 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 94.96 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 94.95 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 94.9 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 94.84 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 94.73 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 94.71 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 94.66 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 94.64 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 94.27 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 94.12 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 93.98 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 93.9 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 93.82 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 93.81 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 93.8 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 93.8 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 93.75 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 93.58 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 93.56 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 93.47 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 93.28 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 93.25 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 93.21 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 93.18 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 93.12 | |
| 1qks_A | 567 | Cytochrome CD1 nitrite reductase; enzyme, oxidored | 92.97 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 92.86 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 92.64 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 92.53 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 92.46 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 92.32 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 92.14 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 92.0 | |
| 3dsm_A | 328 | Uncharacterized protein bacuni_02894; seven_blated | 92.0 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 91.65 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 91.63 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 90.78 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 90.76 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 90.12 | |
| 3pe7_A | 388 | Oligogalacturonate lyase; seven-bladed beta-propel | 89.68 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 89.35 | |
| 4fhn_B | 1139 | Nucleoporin NUP120; protein complex,structural pro | 89.34 | |
| 2oiz_A | 361 | Aromatic amine dehydrogenase, large subunit; oxido | 89.29 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 89.19 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 88.81 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 88.81 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 88.37 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 88.26 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 88.23 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 88.07 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 87.84 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 87.7 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 87.11 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 87.04 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 86.52 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 86.39 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 85.6 | |
| 3c75_H | 426 | MADH, methylamine dehydrogenase heavy chain; coppe | 85.18 | |
| 3q7m_A | 376 | Lipoprotein YFGL, BAMB; beta-propeller, BAM comple | 85.18 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 84.64 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 84.56 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 83.45 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 83.43 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 83.4 | |
| 4gq2_M | 950 | Nucleoporin NUP120; beta propeller alpha helical, | 82.55 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 81.68 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 81.36 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 80.82 |
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-185 Score=1669.43 Aligned_cols=498 Identities=72% Similarity=1.095 Sum_probs=487.6
Q ss_pred ccceeeeccccccccCCcccccceeeecceEEEEEeccCCCceEEEEECCCCCCCcccccCccccccCCCccEEEEeccC
Q psy1644 202 EFKNRIYLLTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISADSAIMNPASKVIALKGKA 281 (923)
Q Consensus 202 ~~~~e~~~Lt~lGI~~~si~F~~lTmESDkyICVRE~~~~~~qVvIVDL~n~~~v~Rrpi~ADSAIMnP~~~IIALra~~ 281 (923)
.|+ |+++|+++||+|++|+|++|||||||||||||++|+++|||||||.||++|+||||+||||||||+++|||||
T Consensus 8 ~~~-e~~~L~~lGi~~~~i~f~~~T~eSDkyicvre~~~~~~~vvIidl~~~~~~~rrpi~AdsAIMnP~~~iiALr--- 83 (1630)
T 1xi4_A 8 RFQ-EHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALK--- 83 (1630)
T ss_pred ehh-hhhhhhhcCCCcccccccceeeecCceEEEEecCCCCceEEEEECCCCCCcccccccchhhccCCCcceEEEe---
Confidence 344 9999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCCCCeEEEEecccccccccccCCCceeEEEeccCCeEEEEecCeEEEEeccCCCCchhhhhcccCCCCCeeEee
Q psy1644 282 GNDNNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTLALVTETSVYHWSMEGDSTPEKMFDRHSTLNGCQIINY 361 (923)
Q Consensus 282 ~~~n~~~~g~~LQIFNle~K~KLKs~~m~E~VvfWkWis~~tLglVT~taVYHWsi~g~s~P~K~FdR~~~L~~~QIInY 361 (923)
+|++|||||||+|+|||+|+|+|+|+||||||+++|||||+|+||||+|+|+++|+||||||++|+|||||||
T Consensus 84 -------ag~~lQiFnl~~k~klks~~~~e~VvfWkWis~~~l~lVT~~aVyHW~~~~~s~P~k~fdR~~~L~~~QIinY 156 (1630)
T 1xi4_A 84 -------AGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINY 156 (1630)
T ss_pred -------cCCeEEEeehHHhhhhcccccCCCceEEEecCCCeeEEEcCCeEEEeccCCCCccHHHHhcchhcccCeeEEe
Confidence 6999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeCCCCCeEEEEeeecccccccceeeeccccccccccccc------------------------c---------------
Q psy1644 362 RTDPKQTWLLLIGISAVSNRVVGAMQLYSVERKCSQPIEE------------------------K--------------- 402 (923)
Q Consensus 362 r~d~~~kW~~LvGI~~~~~~i~G~mQLYS~er~~SQ~iEG------------------------k--------------- 402 (923)
|+|+++|||+|+||++++|+|+|+|||||+||++||+||| |
T Consensus 157 ~~d~~~kW~~l~gi~~~~~~v~G~mQLyS~er~~sQ~iegha~~F~~~~~~~~~~~~~l~~f~~~~~~g~kLhi~Ei~~~ 236 (1630)
T 1xi4_A 157 RTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTP 236 (1630)
T ss_pred eeCCCCCeEEEEeeccCCCcccceeeeeecccccchhhhHhHhhhheeccCCCCCCceEEEEEEecCCCceEEEEecCCC
Confidence 9999999999999999999999999999999999999999 0
Q ss_pred ---------e----------------------------------------------------------------------
Q psy1644 403 ---------K---------------------------------------------------------------------- 403 (923)
Q Consensus 403 ---------~---------------------------------------------------------------------- 403 (923)
|
T Consensus 237 ~~~~~~f~kk~~~~~~~~~~~~Dfpv~~~vs~k~g~iy~itk~G~~~~~d~~t~~~i~~~ris~~~iF~~~~~~~~~g~~ 316 (1630)
T 1xi4_A 237 PTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGII 316 (1630)
T ss_pred ccCCCCCccccccccCCcccccCcceEEEeccccCEEEEEecCceEEEEecccchhhhhccccCCceEEeccCCCCCceE
Confidence 0
Q ss_pred ----------------------------------------------------------------eEEeccCCCccccCHH
Q psy1644 404 ----------------------------------------------------------------SRVAANAPKGILRTPQ 419 (923)
Q Consensus 404 ----------------------------------------------------------------AkvAA~SP~giLRt~e 419 (923)
|++||+||+|+||||+
T Consensus 317 ~vnr~G~vl~v~v~~~~iv~yi~~~l~~~~la~~~a~r~~lpGad~l~~~~F~~l~~~g~y~~AA~~aa~sp~giLRt~~ 396 (1630)
T 1xi4_A 317 GVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPD 396 (1630)
T ss_pred EEcCCceEEEEEEccchhhhhHhhccCCHHHHHHHHHhcCCCCchhHHHHHHHHHHHcCCHHHHHHHHHhCccccccCHH
Confidence 9999999999999999
Q ss_pred HHHhhhcCCCCCCCCchHHHHHHHHHhcCCCCcccccccchhhHHH----------------------------------
Q psy1644 420 TIVKFQQVPTPAGQTSPLLQYFGILLDHGKLNKHESLELCRPVLAQ---------------------------------- 465 (923)
Q Consensus 420 TI~rFK~vp~~pGq~sPLL~YF~~LL~~g~LN~~ESlEL~rpVL~Q---------------------------------- 465 (923)
||+|||++|++|||+||||+||++||++|+||++||+||+||||+|
T Consensus 397 ti~rfk~~~~~pgq~~pll~YF~~ll~~g~Ln~~eSlEl~r~vl~q~r~~lle~Wl~e~KL~~SEeLGDlv~~~d~~lAl 476 (1630)
T 1xi4_A 397 TIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLAL 476 (1630)
T ss_pred HHHHHHcCCCCCCCCCHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhchHHHHHHHHHhCCccccHHHHHHHHhcChHHHH
Confidence 9999999999999999999999999999999999999999999999
Q ss_pred -----------HHHHHHHhcChhHHHHHHHHhCCCccHHHHHHHHHhcCCchhhHHHHhhhcCCCCCcCccc--------
Q psy1644 466 -----------VIQSFAETGQFQKIVLYAKKVGYSPDYVFLLRNVMRVNPDQGVGFAQMLVQDDEPLADINQ-------- 526 (923)
Q Consensus 466 -----------Vi~clae~Gqfdkiv~Y~~~vgytpDy~~LL~~i~~~nP~~a~efA~~L~~~~~pl~di~~-------- 526 (923)
||+||||+|||+||++||+++||||||++||++++|+||++|++||++|+++++|++|+++
T Consensus 477 ~iY~~a~~~~Kvi~~l~~~gq~~ki~~Y~~~~~~~pDy~~ll~~~~~~~P~~~~~fa~~L~~~~~p~~d~~~ivd~f~~~ 556 (1630)
T 1xi4_A 477 SVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEY 556 (1630)
T ss_pred HHHHhcCCcHHHHHHHHHhCCHHHHHHHHhccCCCccHHHHHHHHhhcChHHHHHHHHHHhcCCCCccCHHHHHHHHHhc
Confidence 9999999999999999999999999999999999999999999999999999889999987
Q ss_pred --------------------------------------------------------------------------------
Q psy1644 527 -------------------------------------------------------------------------------- 526 (923)
Q Consensus 527 -------------------------------------------------------------------------------- 526 (923)
T Consensus 557 ~~iq~~t~fLld~lk~n~~e~~~LQTrlle~Nl~~~pqvadail~~~~fthyd~~~IA~LCE~aGl~qrale~y~d~~di 636 (1630)
T 1xi4_A 557 NLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDI 636 (1630)
T ss_pred CcHHHHHHHHHHHHhCCChhhhhHhHHHHHHhhccchhHHHHHHhcCccccccHHHHHHHHHHcCcHHHHHHhcCCHHHH
Confidence
Q ss_pred ----------------------------------------------------------------------cchhhhhhhc
Q psy1644 527 ----------------------------------------------------------------------SYEGLFYFLG 536 (923)
Q Consensus 527 ----------------------------------------------------------------------~~egLyy~Lg 536 (923)
++||||||||
T Consensus 637 kR~~~~~~~~~~~~l~~~fg~l~~~~s~~~l~~~l~~n~~qnlq~vvqva~ky~~~lg~~~li~~fe~~~~~egl~y~l~ 716 (1630)
T 1xi4_A 637 KRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLG 716 (1630)
T ss_pred HHHhhccCcCCHHHHHHHHhcCCHHHHHHHHHHHHHHhHhhhhhhhhhHHHHHHhhcCHHHHHHHHHHhcchhhHHHHHH
Confidence 5899999999
Q ss_pred ccccccCCcchhhHHHHHHHhcCChhhhHHhhhcCCccChHHHHhHHhhccCCCCCceEEeeccccchhHHHHHHHhcCc
Q psy1644 537 SIVNYSQDQEVHFKYIQAACKTGQIKEVERICRESNCYNAERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNL 616 (923)
Q Consensus 537 sivn~s~d~dVhfKYIeAA~k~gq~~EvERicresn~YdpekvKnfLKeakL~d~~PLI~VCDrf~fV~dLv~YLY~n~~ 616 (923)
||||+|+||||||||||||+|+||++|||||||||||||||||||||||||||||+||||||||||||||||+|||+|++
T Consensus 717 siv~~s~d~~vhfkyi~aa~~~~q~~everi~res~~y~~e~vk~flk~~kl~d~~pli~vCdr~~~v~~l~~yLy~n~~ 796 (1630)
T 1xi4_A 717 SIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNL 796 (1630)
T ss_pred hhccccCChHHHHHHHHHHHHhCCchhhhHHhccCCCCCHHHHHHHHhhCCCCCCCCceeeccccccHHHHHHHHHhcCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hheehhhhhccCccccceeee-eccccCCHHHhhhhhccCcchhhhHHhhhccccccchhhHHHHH-hhcchhHHHHHHH
Q psy1644 617 QKYIEIYVQKGRKHLLEKWLK-EEKLECSEELGDLVKQSDPTLALSVYLRANIKQSRFVHDLVLYL-YRNNLQKYIEIYV 694 (923)
Q Consensus 617 ~k~IEvYvqkvNp~~tP~Vvg-LlD~dc~E~~Ik~LL~sv~~l~~~~~v~~~~~~~~pv~~Lv~ev-~RnrL~kll~p~L 694 (923)
+||||+|||||||++||+||| |||+|||||+||+||++| +++||++|||+|| ||||| |||+|||
T Consensus 797 ~~~ie~yv~~vnp~~~p~Vvg~lld~d~~e~~ik~ll~~v-------------~~~~~~~~lv~~~ekrnrL-kll~p~L 862 (1630)
T 1xi4_A 797 QKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVV-------------RGQFSTDELVAEVEKRNRL-KLLLPWL 862 (1630)
T ss_pred hhHHHHHHhccCCcccchhhhhhhcCCCCHHHHHHHHHHh-------------ccCCCHHHHHHHHHHHHHH-HHHHHHH
Confidence 999999999999999999999 999999999999999997 8999999999999 69999 9999999
Q ss_pred HHHHHhhcccchhhhHHHHhH---hcCccceee
Q psy1644 695 QKIRIKIKQSRFVHDLVLYLY---RNNLQKYIE 724 (923)
Q Consensus 695 E~~~~~g~q~~~v~nalakiy---~~~~~~~~~ 724 (923)
|+|++||+|||++|||||||| +++|++|+.
T Consensus 863 E~~~~~g~~~~~~hnalakiyid~n~npe~fL~ 895 (1630)
T 1xi4_A 863 EARIHEGCEEPATHNALAKIYIDSNNNPERFLR 895 (1630)
T ss_pred HHHHhCCCCCHHHHHHHHHHHhccCCCHHHHhh
Confidence 999999999999999999999 666888764
|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 | Back alignment and structure |
|---|
| >1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} | Back alignment and structure |
|---|
| >2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 923 | ||||
| d1utca2 | 327 | b.69.6.1 (A:4-330) Clathrin heavy-chain terminal d | 1e-101 | |
| d1utca2 | 327 | b.69.6.1 (A:4-330) Clathrin heavy-chain terminal d | 4e-66 | |
| d1utca2 | 327 | b.69.6.1 (A:4-330) Clathrin heavy-chain terminal d | 9e-32 | |
| d1utca2 | 327 | b.69.6.1 (A:4-330) Clathrin heavy-chain terminal d | 8e-31 | |
| d1bpoa1 | 157 | a.118.1.4 (A:331-487) Clathrin heavy-chain linker | 2e-29 | |
| d1bpoa1 | 157 | a.118.1.4 (A:331-487) Clathrin heavy-chain linker | 6e-22 | |
| d1bpoa1 | 157 | a.118.1.4 (A:331-487) Clathrin heavy-chain linker | 4e-19 | |
| d1b89a_ | 336 | a.118.1.3 (A:) Clathrin heavy chain proximal leg s | 1e-18 | |
| d1b89a_ | 336 | a.118.1.3 (A:) Clathrin heavy chain proximal leg s | 1e-07 | |
| d1utca1 | 26 | a.118.1.4 (A:331-355) Clathrin heavy-chain linker | 4e-09 |
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: Clathrin heavy-chain terminal domain family: Clathrin heavy-chain terminal domain domain: Clathrin heavy-chain terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 317 bits (813), Expect = e-101
Identities = 148/196 (75%), Positives = 161/196 (82%), Gaps = 10/196 (5%)
Query: 205 NRIYLLTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISAD 264
L N+GIN ++ F+TLTMESDKFIC+REK+ E AQVVIIDMNDP+NPIRRPISAD
Sbjct: 7 QEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISAD 66
Query: 265 SAIMNPASKVIALKGKAGNDNNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTL 324
SAIMNPASKVIALK A KTLQIFNIEMKSKMKAH MTDDV FWKWIS NT+
Sbjct: 67 SAIMNPASKVIALK----------AGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTV 116
Query: 325 ALVTETSVYHWSMEGDSTPEKMFDRHSTLNGCQIINYRTDPKQTWLLLIGISAVSNRVVG 384
ALVT+ +VYHWSMEG+S P KMFDRHS+L GCQIINYRTD KQ WLLL GISA NRVVG
Sbjct: 117 ALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVG 176
Query: 385 AMQLYSVERKCSQPIE 400
AMQLYSV+RK SQPIE
Sbjct: 177 AMQLYSVDRKVSQPIE 192
|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 | Back information, alignment and structure |
|---|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 | Back information, alignment and structure |
|---|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 | Back information, alignment and structure |
|---|
| >d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1utca1 a.118.1.4 (A:331-355) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 26 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 923 | |||
| d1utca2 | 327 | Clathrin heavy-chain terminal domain {Rat (Rattus | 100.0 | |
| d1utca2 | 327 | Clathrin heavy-chain terminal domain {Rat (Rattus | 100.0 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 99.94 | |
| d1bpoa1 | 157 | Clathrin heavy-chain linker domain {Rat (Rattus no | 99.88 | |
| d1bpoa1 | 157 | Clathrin heavy-chain linker domain {Rat (Rattus no | 99.87 | |
| d1utca1 | 26 | Clathrin heavy-chain linker domain {Rat (Rattus no | 97.88 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 97.34 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 97.09 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.86 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 96.71 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 96.61 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 96.44 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 96.36 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 96.15 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 95.43 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 95.19 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 94.83 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 94.75 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 94.63 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 94.26 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 93.6 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 92.81 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 92.68 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 92.29 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 91.51 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 90.09 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 89.71 | |
| d1mdah_ | 368 | Methylamine dehydrogenase, H-chain {Paracoccus den | 89.7 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 88.2 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 87.99 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 87.65 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 86.45 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 85.71 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 84.85 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 84.44 |
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: Clathrin heavy-chain terminal domain family: Clathrin heavy-chain terminal domain domain: Clathrin heavy-chain terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=1.4e-103 Score=837.20 Aligned_cols=194 Identities=77% Similarity=1.154 Sum_probs=190.7
Q ss_pred eeeeccccccccCCcccccceeeecceEEEEEeccCCCceEEEEECCCCCCCcccccCccccccCCCccEEEEeccCCCC
Q psy1644 205 NRIYLLTNVGINVGSVSFNTLTMESDKFICVREKIAESAQVVIIDMNDPTNPIRRPISADSAIMNPASKVIALKGKAGND 284 (923)
Q Consensus 205 ~e~~~Lt~lGI~~~si~F~~lTmESDkyICVRE~~~~~~qVvIVDL~n~~~v~Rrpi~ADSAIMnP~~~IIALra~~~~~ 284 (923)
+|+++|+++||+|++|+|+++||||||||||||+.++++||+||||.|+++|+||||+||||||||+++|||||
T Consensus 7 ~E~~~L~~~Gi~~~~i~f~~~T~ESDkyicVRe~~~~~~~VvIidl~n~~~~~Rrpi~AdsAIMhP~~~IiALr------ 80 (327)
T d1utca2 7 QEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALK------ 80 (327)
T ss_dssp EEEEEGGGGTCCGGGCSTTTEECSSSSEEEEEEEETTEEEEEEEETTSTTSCEEEECCCSEEEECSSSSEEEEE------
T ss_pred EeeeehhhcCCCccccccccEEEecCCEEEEEeccCCCceEEEEECCCCCcceecccchhhhhcCCCCcEEEEe------
Confidence 49999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCeEEEEecccccccccccCCCceeEEEeccCCeEEEEecCeEEEEeccCCCCchhhhhcccCCCCCeeEeeeeC
Q psy1644 285 NNPNAPKTLQIFNIEMKSKMKAHPMTDDVVFWKWISPNTLALVTETSVYHWSMEGDSTPEKMFDRHSTLNGCQIINYRTD 364 (923)
Q Consensus 285 n~~~~g~~LQIFNle~K~KLKs~~m~E~VvfWkWis~~tLglVT~taVYHWsi~g~s~P~K~FdR~~~L~~~QIInYr~d 364 (923)
+|++|||||||+|+|||+|+|+|+|+||||||+++|||||+++||||+|+|+++|+||||||++|+|||||||++|
T Consensus 81 ----ag~~LQiFnletK~klks~~~~e~VvfWkWis~~~L~lVT~taVYHW~~~g~s~P~k~fdR~~~L~~~QIInY~~d 156 (327)
T d1utca2 81 ----AGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTD 156 (327)
T ss_dssp ----ETTEEEEEETTTTEEEEEEECSSCCCEEEESSSSEEEEECSSEEEEEESSSSCCCEEEEECCGGGTTCEEEEEEEC
T ss_pred ----cCCeEEEEehhHhhhhceEEcCCCcEEEEecCCCEEEEEcCCceEEEcccCCCCchhhhhhcccccCceEEEEEEC
Confidence 6899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCeEEEEeeecccccccceeeecccccccccccccceeEEec
Q psy1644 365 PKQTWLLLIGISAVSNRVVGAMQLYSVERKCSQPIEEKKSRVAA 408 (923)
Q Consensus 365 ~~~kW~~LvGI~~~~~~i~G~mQLYS~er~~SQ~iEGk~AkvAA 408 (923)
+++|||+|+||++++++|+|+|||||+||++||+|||++|.+|-
T Consensus 157 ~~~kW~~l~GI~~~~~~i~G~mQLYS~er~~sQ~ieGhaa~F~~ 200 (327)
T d1utca2 157 AKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQ 200 (327)
T ss_dssp TTSCEEEEEEEEEETTEEEEEEEEEETTTTEEEEECCSEEEEEE
T ss_pred CCCCEEEEEeEecCCCceeEEEEEEEeccCcCccccceeeeeEE
Confidence 99999999999999999999999999999999999999988874
|
| >d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bpoa1 a.118.1.4 (A:331-487) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1utca1 a.118.1.4 (A:331-355) Clathrin heavy-chain linker domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|