Psyllid ID: psy16468

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460---
MNSVHRNSCPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTSTGRDRSARVHSANVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIIIEL
cccccccccccccccEEEcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHcccccccccccccccccccccccccccEEEEEEEEccEEEEEEEccccccccccccccccccEEcccccccccccccccccccccEEEEEEcccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHcccccccccccccccccccc
cccHHHHHHHHHHHHHHHEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHHHccHHHccccccHHHHHccHHHHHcccccccHHHHHHcccccccEEEEEEEEccEEEEEEEEcccHHHHHHHHHHcccccEEEEcccHHHHHHHHHHcccccEEEEEEEHHHHHcEcccccccEHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHcccccEEEEEEEHHHHHcEcHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHccHHHHHcccccccHHHHHHcccccccEEEEEEEEcccEHHHHHHHHHHHHHccHHHcccEEEEEEEcHHHHHHHcccccHHHccccccccccccc
mnsvhrnscpaleasndfvgtgesgkstFIKQMRiihgsgysdedkRGFIKLVYQNIFMAMQSMIRAMDLLKIqyadptceekAELIrsvdfetvttfeSPYVEAIKElwadpgiqecydrrreyqltdSAKYYLMEIdrvaapnylpteqdilrvrvpttgiieypfdLEEIRFRMVDvggqrserrkwihcfenvtmvdvggqrserRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIItypwfqhsmvdvggqrserrKWIHcfenvtfcnsvqLFSQYNVILNcmnytivpplhtgpqrDAIAAREFILRMTStgrdrsarvhsanvrrpqsglgenhLLALHVRHSYLgdlariedpgympteqdilrarqpttgiieypfdldginRMEESKALFKTIItypwfqhsSVILFLNKKDLLEEKIMYSHLvdyfpeyddhiiiel
mnsvhrnscpaleasndfvgtgesgkstfiKQMRIIHgsgysdedkrGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIkelwadpgiqecYDRRREYQLTDSAKYYLMEIDRVaapnylpteqdilrvrvpTTGIieypfdleeiRFRMVDVGGQrserrkwihcfenvtmvdvggqRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMtstgrdrsarvhsanvrrpqsglgenHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIIIEL
MNSVHRNSCPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTSTGRDRSARVHSANVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIIIEL
***************************TFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFE**********KALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRM************************ENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIII**
**************SNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTSTGRDRSARVHSANVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDH*****
*********PALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTST***********NVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIIIEL
MNSVHRNSCPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTSTGRDRSARVHSANVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSVHRNSCPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILRMTSTGRDRSARVHSANVRRPQSGLGENHLLALHVRHSYLGDLARIEDPGYMPTEQDILRARQPTTGIIEYPFDLDGINRMEESKALFKTIITYPWFQHSSVILFLNKKDLLEEKIMYSHLVDYFPEYDDHIIIEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query463 2.2.26 [Sep-21-2011]
P91950353 Guanine nucleotide-bindin N/A N/A 0.580 0.762 0.669 1e-114
P21279359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.637 1e-108
Q2PKF4359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.637 1e-108
P50148359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.637 1e-108
Q28294359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.637 1e-108
P82471359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.634 1e-108
P45645359 Guanine nucleotide-bindin yes N/A 0.580 0.749 0.644 1e-107
Q9JID2359 Guanine nucleotide-bindin no N/A 0.580 0.749 0.631 1e-106
P23625353 Guanine nucleotide-bindin no N/A 0.578 0.759 0.627 1e-106
P43444359 Guanine nucleotide-bindin N/A N/A 0.580 0.749 0.625 1e-106
>sp|P91950|GNAQ_HOMAM Guanine nucleotide-binding protein G(q) subunit alpha OS=Homarus americanus PE=2 SV=1 Back     alignment and function desciption
 Score =  411 bits (1057), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/312 (66%), Positives = 233/312 (74%), Gaps = 43/312 (13%)

Query: 18  FVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYAD 77
            +GTGESGKSTFIKQMRIIHG+GYSDEDKRGFIKLV+QNIFMAMQSMIRAMDLL+I Y D
Sbjct: 38  LLGTGESGKSTFIKQMRIIHGAGYSDEDKRGFIKLVFQNIFMAMQSMIRAMDLLQISYGD 97

Query: 78  PTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLME 137
               E A+L+RSVD+E+VTTFE PYV A+  LW D GIQ CYDRRREYQLTDSAKYYL +
Sbjct: 98  SANIEHADLVRSVDYESVTTFEEPYVTAMNSLWQDTGIQHCYDRRREYQLTDSAKYYLTD 157

Query: 138 IDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENV 197
           +DR+AA +Y+ T QDILRVR PTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHC    
Sbjct: 158 LDRIAAKDYVSTLQDILRVRAPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHC---- 213

Query: 198 TMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITY 257
                             FENVTSIIFLVALSEYDQILFES+NENRMEESKALFKTIITY
Sbjct: 214 ------------------FENVTSIIFLVALSEYDQILFESDNENRMEESKALFKTIITY 255

Query: 258 PWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQR 317
           PWFQHS V                  + F N   L  +  +  + ++Y    P + GP++
Sbjct: 256 PWFQHSSV------------------ILFLNKKDLLEEKIMYSHLVDYF---PEYDGPRK 294

Query: 318 DAIAAREFILRM 329
           DAIAAREFILRM
Sbjct: 295 DAIAAREFILRM 306
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
Homarus americanus (taxid: 6706)
>sp|P21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha OS=Mus musculus GN=Gnaq PE=1 SV=4 Back     alignment and function description
>sp|Q2PKF4|GNAQ_PIG Guanine nucleotide-binding protein G(q) subunit alpha OS=Sus scrofa GN=GNAQ PE=2 SV=3 Back     alignment and function description
>sp|P50148|GNAQ_HUMAN Guanine nucleotide-binding protein G(q) subunit alpha OS=Homo sapiens GN=GNAQ PE=1 SV=4 Back     alignment and function description
>sp|Q28294|GNAQ_CANFA Guanine nucleotide-binding protein G(q) subunit alpha OS=Canis familiaris GN=GNAQ PE=2 SV=2 Back     alignment and function description
>sp|P82471|GNAQ_RAT Guanine nucleotide-binding protein G(q) subunit alpha OS=Rattus norvegicus GN=Gnaq PE=1 SV=2 Back     alignment and function description
>sp|P45645|GNA11_MELGA Guanine nucleotide-binding protein subunit alpha-11 OS=Meleagris gallopavo GN=GNA11 PE=1 SV=1 Back     alignment and function description
>sp|Q9JID2|GNA11_RAT Guanine nucleotide-binding protein subunit alpha-11 OS=Rattus norvegicus GN=Gna11 PE=2 SV=1 Back     alignment and function description
>sp|P23625|GNAQ_DROME Guanine nucleotide-binding protein G(q) subunit alpha OS=Drosophila melanogaster GN=Galpha49B PE=2 SV=2 Back     alignment and function description
>sp|P43444|GNA11_XENLA Guanine nucleotide-binding protein subunit alpha-11 OS=Xenopus laevis GN=gna11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
388462225353 guanine nucleotide-binding protein Gq al 0.580 0.762 0.762 1e-129
328701700353 PREDICTED: guanine nucleotide-binding pr 0.580 0.762 0.743 1e-126
31209979353 AGAP005079-PI [Anopheles gambiae str. PE 0.580 0.762 0.75 1e-125
158292517353 AGAP005079-PC [Anopheles gambiae str. PE 0.580 0.762 0.75 1e-125
157126414353 GTP-binding protein alpha subunit, gna [ 0.580 0.762 0.746 1e-124
170049896353 GTP-binding protein alpha subunit, gna [ 0.580 0.762 0.746 1e-124
383854028353 PREDICTED: guanine nucleotide-binding pr 0.580 0.762 0.740 1e-124
383854036353 PREDICTED: guanine nucleotide-binding pr 0.580 0.762 0.740 1e-124
341575560353 G-protein alpha q subunit [Lygus hesperu 0.580 0.762 0.740 1e-123
112982768353 G protein alpha q isoform 1 [Bombyx mori 0.580 0.762 0.740 1e-123
>gi|388462225|gb|AFK32778.1| guanine nucleotide-binding protein Gq alpha subunit [Bemisia tabaci] Back     alignment and taxonomy information
 Score =  467 bits (1201), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/312 (76%), Positives = 249/312 (79%), Gaps = 43/312 (13%)

Query: 18  FVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYAD 77
            +GTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMD+LKIQYAD
Sbjct: 38  LLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDVLKIQYAD 97

Query: 78  PTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLME 137
            +C EKAELIRSVDFETVTTFESPYVEAIKELWAD GIQECYDRRREYQLTDSAKYYLME
Sbjct: 98  SSCSEKAELIRSVDFETVTTFESPYVEAIKELWADAGIQECYDRRREYQLTDSAKYYLME 157

Query: 138 IDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENV 197
           IDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHC    
Sbjct: 158 IDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHC---- 213

Query: 198 TMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITY 257
                             FENVTSIIFLVALSEYDQILFES+NENRMEESKALFKTIITY
Sbjct: 214 ------------------FENVTSIIFLVALSEYDQILFESDNENRMEESKALFKTIITY 255

Query: 258 PWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQR 317
           PWFQHS V                  + F N   L  +  +  + ++Y    P + GPQR
Sbjct: 256 PWFQHSSV------------------ILFLNKKDLLEEKILYSHLVDYF---PEYEGPQR 294

Query: 318 DAIAAREFILRM 329
           DAIAAREFILRM
Sbjct: 295 DAIAAREFILRM 306

Source: Bemisia tabaci

Species: Bemisia tabaci

Genus: Bemisia

Family: Aleyrodidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328701700|ref|XP_001948628.2| PREDICTED: guanine nucleotide-binding protein G(q) subunit alpha-like isoform 2 [Acyrthosiphon pisum] gi|149929781|gb|ABR37295.1| guanine nucleotide-binding protein Gq alpha subunit [Sitobion avenae] Back     alignment and taxonomy information
>gi|31209979|ref|XP_313956.1| AGAP005079-PI [Anopheles gambiae str. PEST] gi|158292525|ref|XP_001688490.1| AGAP005079-PG [Anopheles gambiae str. PEST] gi|30176629|gb|EAA44510.1| AGAP005079-PI [Anopheles gambiae str. PEST] gi|76881277|gb|ABA56307.1| G(alpha)q2 [Anopheles gambiae] gi|157017033|gb|EDO64073.1| AGAP005079-PG [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292517|ref|XP_001688486.1| AGAP005079-PC [Anopheles gambiae str. PEST] gi|157017029|gb|EDO64069.1| AGAP005079-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157126414|ref|XP_001660884.1| GTP-binding protein alpha subunit, gna [Aedes aegypti] gi|108873287|gb|EAT37512.1| AAEL010506-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170049896|ref|XP_001858618.1| GTP-binding protein alpha subunit, gna [Culex quinquefasciatus] gi|167871571|gb|EDS34954.1| GTP-binding protein alpha subunit, gna [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383854028|ref|XP_003702524.1| PREDICTED: guanine nucleotide-binding protein G(q) subunit alpha-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383854036|ref|XP_003702528.1| PREDICTED: guanine nucleotide-binding protein G(q) subunit alpha-like isoform 5 [Megachile rotundata] Back     alignment and taxonomy information
>gi|341575560|gb|AEK80437.1| G-protein alpha q subunit [Lygus hesperus] Back     alignment and taxonomy information
>gi|112982768|ref|NP_001036898.1| G protein alpha q isoform 1 [Bombyx mori] gi|34494848|dbj|BAC85104.1| Gq-like G protein alpha subunit [Bombyx mori] gi|56342249|dbj|BAD74002.1| G protein alpha subunit Gq [Bombyx mori] gi|197245034|dbj|BAG69142.1| G protein alpha q isoform 1 [Bombyx mori] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query463
FB|FBgn0004435353 Galphaq "G protein alpha q sub 0.393 0.515 0.780 7.1e-109
MGI|MGI:95776359 Gnaq "guanine nucleotide bindi 0.393 0.506 0.780 1.7e-107
RGD|620770359 Gnaq "guanine nucleotide bindi 0.393 0.506 0.774 2.1e-107
UNIPROTKB|E1BA29359 GNAQ "Uncharacterized protein" 0.393 0.506 0.780 3.5e-107
UNIPROTKB|Q28294359 GNAQ "Guanine nucleotide-bindi 0.393 0.506 0.780 3.5e-107
UNIPROTKB|P50148359 GNAQ "Guanine nucleotide-bindi 0.393 0.506 0.780 3.5e-107
UNIPROTKB|Q2PKF4359 GNAQ "Guanine nucleotide-bindi 0.393 0.506 0.780 3.5e-107
UNIPROTKB|F1PXM5324 GNAQ "Guanine nucleotide-bindi 0.390 0.558 0.784 4.5e-107
UNIPROTKB|Q5F3B5359 GNA11 "Uncharacterized protein 0.393 0.506 0.769 1.2e-106
ZFIN|ZDB-GENE-081105-76365 gna14a "guanine nucleotide bin 0.393 0.498 0.692 6.5e-104
FB|FBgn0004435 Galphaq "G protein alpha q subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 762 (273.3 bits), Expect = 7.1e-109, Sum P(2) = 7.1e-109
 Identities = 142/182 (78%), Positives = 159/182 (87%)

Query:    19 VGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADP 78
             +GTGESGKSTFIKQMRIIHGSGYSDEDKRG+IKLV+QNIFMAMQSMI+AMD+LKI Y   
Sbjct:    39 LGTGESGKSTFIKQMRIIHGSGYSDEDKRGYIKLVFQNIFMAMQSMIKAMDMLKISYGQG 98

Query:    79 TCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEI 138
                E A+L+ S+D+ETVTTFE PY+ AIK LW D GIQECYDRRREYQLTDSAKYYL ++
Sbjct:    99 EHSELADLVMSIDYETVTTFEDPYLNAIKTLWDDAGIQECYDRRREYQLTDSAKYYLSDL 158

Query:   139 DRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVT 198
              R+   +YLPTEQDILR RVPTTGI+EYPFDL+ I FRMVDVGGQRSERRKWIHCFENVT
Sbjct:   159 ARIEQADYLPTEQDILRARVPTTGILEYPFDLDGIVFRMVDVGGQRSERRKWIHCFENVT 218

Query:   199 MV 200
              +
Sbjct:   219 SI 220
GO:0003924 "GTPase activity" evidence=ISS;NAS;IMP
GO:0005834 "heterotrimeric G-protein complex" evidence=ISS;IBA;NAS
GO:0007602 "phototransduction" evidence=IEP;IDA;IMP;TAS
GO:0007202 "activation of phospholipase C activity" evidence=IGI;IPI
GO:0016056 "rhodopsin mediated signaling pathway" evidence=IMP
GO:0016028 "rhabdomere" evidence=IDA;TAS
GO:0007186 "G-protein coupled receptor signaling pathway" evidence=NAS
GO:0016027 "inaD signaling complex" evidence=IDA
GO:0016199 "axon midline choice point recognition" evidence=IMP
GO:0005525 "GTP binding" evidence=IEA
GO:0006184 "GTP catabolic process" evidence=IEA
GO:0046673 "negative regulation of compound eye retinal cell programmed cell death" evidence=IMP
GO:0007629 "flight behavior" evidence=IGI
GO:0030322 "stabilization of membrane potential" evidence=IGI
GO:0007608 "sensory perception of smell" evidence=IMP
GO:0043052 "thermotaxis" evidence=IMP;IDA
GO:0002385 "mucosal immune response" evidence=IMP
GO:0071244 "cellular response to carbon dioxide" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0016060 "metarhodopsin inactivation" evidence=IMP
GO:0004871 "signal transducer activity" evidence=IBA
GO:0031234 "extrinsic to internal side of plasma membrane" evidence=IBA
GO:0007188 "adenylate cyclase-modulating G-protein coupled receptor signaling pathway" evidence=IBA
GO:0060158 "phospholipase C-activating dopamine receptor signaling pathway" evidence=IBA
GO:0001664 "G-protein coupled receptor binding" evidence=IBA
GO:0031683 "G-protein beta/gamma-subunit complex binding" evidence=IBA
MGI|MGI:95776 Gnaq "guanine nucleotide binding protein, alpha q polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620770 Gnaq "guanine nucleotide binding protein (G protein), q polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BA29 GNAQ "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q28294 GNAQ "Guanine nucleotide-binding protein G(q) subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P50148 GNAQ "Guanine nucleotide-binding protein G(q) subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2PKF4 GNAQ "Guanine nucleotide-binding protein G(q) subunit alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXM5 GNAQ "Guanine nucleotide-binding protein G(q) subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5F3B5 GNA11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-081105-76 gna14a "guanine nucleotide binding protein (G protein), alpha 14a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P82471GNAQ_RATNo assigned EC number0.63460.58090.7493yesN/A
P45645GNA11_MELGANo assigned EC number0.64420.58090.7493yesN/A
P21279GNAQ_MOUSENo assigned EC number0.63780.58090.7493yesN/A
Q2PKF4GNAQ_PIGNo assigned EC number0.63780.58090.7493yesN/A
P50148GNAQ_HUMANNo assigned EC number0.63780.58090.7493yesN/A
Q28294GNAQ_CANFANo assigned EC number0.63780.58090.7493yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 1e-133
smart00275342 smart00275, G_alpha, G protein alpha subunit 1e-113
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 1e-107
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 1e-42
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 3e-34
smart00275342 smart00275, G_alpha, G protein alpha subunit 4e-33
cd00066315 cd00066, G-alpha, Alpha subunit of G proteins (gua 9e-13
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 9e-10
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-05
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 4e-04
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 7e-04
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information 
 Score =  387 bits (997), Expect = e-133
 Identities = 128/245 (52%), Positives = 166/245 (67%), Gaps = 23/245 (9%)

Query: 20  GTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPT 79
           G GESGKST +KQM+I+HG+G+SDE++R F  ++Y NI  +M++++RAM+ L I Y DP 
Sbjct: 7   GAGESGKSTILKQMKILHGNGFSDEERREFRPVIYSNILQSMKALLRAMETLNIPYGDPE 66

Query: 80  CEEKAELIRSVDFE-TVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEI 138
            E+ A+ I S+              EAIK LW DPGIQ CYDRR EYQL DSAKY+L  +
Sbjct: 67  NEKDAKKILSLAPRAEEGPLPPELAEAIKRLWKDPGIQACYDRRNEYQLNDSAKYFLDNL 126

Query: 139 DRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVT 198
           DR++ P+Y+PTEQDILR RV TTGIIE  F ++ ++FRM DVGGQRSER+K         
Sbjct: 127 DRISDPDYIPTEQDILRSRVKTTGIIETDFSIKNLKFRMFDVGGQRSERKK--------- 177

Query: 199 MVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYP 258
                        WIHCFE+VT+IIF+VALSEYDQ+L E E+ NRM+ES  LF +I    
Sbjct: 178 -------------WIHCFEDVTAIIFVVALSEYDQVLVEDESVNRMQESLKLFDSICNSR 224

Query: 259 WFQHS 263
           WF ++
Sbjct: 225 WFANT 229

The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute. Length = 315
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information
>gnl|CDD|206639 cd00066, G-alpha, Alpha subunit of G proteins (guanine nucleotide binding) Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 463
KOG0085|consensus359 100.0
KOG0082|consensus354 100.0
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 100.0
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 100.0
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 100.0
KOG0099|consensus379 100.0
KOG0082|consensus354 100.0
KOG0085|consensus359 100.0
KOG0099|consensus379 99.95
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 99.94
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.92
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.92
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.68
KOG0070|consensus181 99.67
KOG0074|consensus185 99.65
KOG0073|consensus185 99.65
KOG0071|consensus180 99.55
PLN00223181 ADP-ribosylation factor; Provisional 99.4
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 99.38
KOG0076|consensus197 99.35
PTZ00133182 ADP-ribosylation factor; Provisional 99.3
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.29
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 99.28
KOG0072|consensus182 99.28
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 99.27
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.25
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.22
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.2
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.19
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.17
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.15
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.11
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.07
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.07
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.03
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.02
KOG0077|consensus193 99.01
KOG0075|consensus186 99.0
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 98.97
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 98.95
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 98.93
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 98.87
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 98.85
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 98.84
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 98.84
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 98.81
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 98.81
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 98.8
cd00154159 Rab Rab family. Rab GTPases form the largest famil 98.8
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 98.79
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 98.78
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 98.78
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 98.74
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 98.74
PLN03071219 GTP-binding nuclear protein Ran; Provisional 98.74
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 98.74
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 98.73
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 98.72
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 98.72
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 98.71
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 98.7
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 98.7
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 98.7
PTZ00369189 Ras-like protein; Provisional 98.7
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 98.69
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 98.69
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 98.69
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 98.69
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 98.68
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 98.68
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 98.67
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 98.67
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 98.66
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 98.66
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 98.64
cd04123162 Rab21 Rab21 subfamily. The localization and functi 98.63
PLN00023334 GTP-binding protein; Provisional 98.63
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 98.63
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 98.63
cd04105203 SR_beta Signal recognition particle receptor, beta 98.62
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 98.62
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 98.61
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 98.6
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 98.6
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 98.6
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 98.6
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 98.59
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 98.59
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 98.59
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 98.58
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 98.58
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 98.58
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 98.57
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 98.57
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 98.57
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 98.54
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 98.54
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 98.54
cd00876160 Ras Ras family. The Ras family of the Ras superfam 98.54
COG1100219 GTPase SAR1 and related small G proteins [General 98.53
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 98.53
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 98.52
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 98.51
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 98.51
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 98.5
PLN03118211 Rab family protein; Provisional 98.49
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 98.49
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 98.49
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 98.48
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 98.48
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 98.48
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 98.47
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 98.46
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 98.46
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 98.46
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 98.45
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 98.45
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 98.41
TIGR00231161 small_GTP small GTP-binding protein domain. This m 98.4
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 98.4
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 98.39
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 98.37
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 98.37
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 98.36
PLN03108210 Rab family protein; Provisional 98.34
PRK04213201 GTP-binding protein; Provisional 98.3
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 98.29
PLN03110216 Rab GTPase; Provisional 98.28
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 98.26
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 98.23
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 98.2
PTZ00099176 rab6; Provisional 98.18
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 98.13
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 98.12
cd00881189 GTP_translation_factor GTP translation factor fami 98.03
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.03
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 97.99
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 97.87
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.82
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.78
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 97.78
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.76
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 97.75
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 97.66
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 97.64
COG2229187 Predicted GTPase [General function prediction only 97.64
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 97.62
PRK15494339 era GTPase Era; Provisional 97.62
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 97.57
PRK12317425 elongation factor 1-alpha; Reviewed 97.53
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 97.52
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 97.52
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 97.47
TIGR00503 527 prfC peptide chain release factor 3. This translat 97.46
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 97.45
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.45
PRK00093 435 GTP-binding protein Der; Reviewed 97.42
TIGR00483426 EF-1_alpha translation elongation factor EF-1 alph 97.39
PRK00741 526 prfC peptide chain release factor 3; Provisional 97.33
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 97.33
KOG0084|consensus205 97.32
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 97.32
PRK13351 687 elongation factor G; Reviewed 97.23
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 97.21
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 97.2
PRK10218 607 GTP-binding protein; Provisional 97.19
PRK00089292 era GTPase Era; Reviewed 97.14
KOG0090|consensus238 97.11
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 97.11
CHL00189 742 infB translation initiation factor 2; Provisional 97.11
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 97.09
PF09439181 SRPRB: Signal recognition particle receptor beta s 97.09
PRK05433 600 GTP-binding protein LepA; Provisional 97.02
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.0
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.98
PRK05306 787 infB translation initiation factor IF-2; Validated 96.97
PRK03003472 GTP-binding protein Der; Reviewed 96.93
PRK00093435 GTP-binding protein Der; Reviewed 96.92
TIGR03680406 eif2g_arch translation initiation factor 2 subunit 96.85
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 96.84
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.81
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 96.78
KOG0094|consensus221 96.77
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 96.75
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 96.72
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 96.68
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 96.63
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 96.62
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 96.51
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 96.5
cd01881176 Obg_like The Obg-like subfamily consists of five w 96.34
PRK12299335 obgE GTPase CgtA; Reviewed 96.32
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPa 96.25
KOG0092|consensus200 96.2
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 96.19
PRK09866 741 hypothetical protein; Provisional 96.15
KOG0395|consensus196 96.15
PRK08118167 topology modulation protein; Reviewed 96.09
PRK04000411 translation initiation factor IF-2 subunit gamma; 96.02
PTZ00141446 elongation factor 1- alpha; Provisional 95.99
TIGR02034406 CysN sulfate adenylyltransferase, large subunit. H 95.95
KOG0086|consensus214 95.95
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 95.95
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 95.95
CHL00071409 tufA elongation factor Tu 95.93
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 95.92
PRK07261171 topology modulation protein; Provisional 95.9
COG4639168 Predicted kinase [General function prediction only 95.89
PRK12739 691 elongation factor G; Reviewed 95.89
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 95.87
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 95.86
PRK03003 472 GTP-binding protein Der; Reviewed 95.84
KOG0078|consensus207 95.8
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 95.77
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 95.71
PRK12296500 obgE GTPase CgtA; Reviewed 95.67
PRK12297424 obgE GTPase CgtA; Reviewed 95.59
COG4619223 ABC-type uncharacterized transport system, ATPase 95.56
KOG3883|consensus198 95.47
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.32
PLN00043447 elongation factor 1-alpha; Provisional 95.31
PF1355562 AAA_29: P-loop containing region of AAA domain 95.27
PRK12735396 elongation factor Tu; Reviewed 95.22
KOG1673|consensus205 95.21
PLN03127447 Elongation factor Tu; Provisional 95.12
PRK06217183 hypothetical protein; Validated 95.01
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 94.96
KOG0394|consensus210 94.85
PLN03126478 Elongation factor Tu; Provisional 94.77
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 94.77
COG1126240 GlnQ ABC-type polar amino acid transport system, A 94.61
PRK00007 693 elongation factor G; Reviewed 94.4
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.32
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 94.28
PRK03839180 putative kinase; Provisional 94.27
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 94.25
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.22
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 94.2
PRK14532188 adenylate kinase; Provisional 94.07
smart00382148 AAA ATPases associated with a variety of cellular 93.96
PRK08233182 hypothetical protein; Provisional 93.96
KOG0093|consensus193 93.93
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 93.93
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 93.91
KOG0079|consensus198 93.9
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.89
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.88
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 93.85
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 93.83
PRK13949169 shikimate kinase; Provisional 93.82
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 93.8
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 93.77
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 93.76
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 93.71
PRK14530215 adenylate kinase; Provisional 93.69
PTZ00088229 adenylate kinase 1; Provisional 93.64
PF00004132 AAA: ATPase family associated with various cellula 93.6
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 93.6
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 93.56
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.52
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 93.46
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 93.44
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.43
KOG0057|consensus591 93.43
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 93.4
PRK02496184 adk adenylate kinase; Provisional 93.39
PF00025175 Arf: ADP-ribosylation factor family The prints ent 93.39
PTZ00416 836 elongation factor 2; Provisional 93.33
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.31
PRK12298390 obgE GTPase CgtA; Reviewed 93.25
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 93.24
PRK14531183 adenylate kinase; Provisional 93.24
PRK00300205 gmk guanylate kinase; Provisional 93.17
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 93.1
PRK05480209 uridine/cytidine kinase; Provisional 93.09
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.07
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.98
PF05729166 NACHT: NACHT domain 92.96
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 92.91
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 92.91
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 92.9
KOG0098|consensus216 92.84
PF13173128 AAA_14: AAA domain 92.81
COG4161242 ArtP ABC-type arginine transport system, ATPase co 92.8
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 92.75
PRK14738206 gmk guanylate kinase; Provisional 92.74
PRK00279215 adk adenylate kinase; Reviewed 92.7
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 92.67
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 92.67
COG4598256 HisP ABC-type histidine transport system, ATPase c 92.61
PRK12740 668 elongation factor G; Reviewed 92.61
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 92.6
COG3842352 PotA ABC-type spermidine/putrescine transport syst 92.56
PLN00116 843 translation elongation factor EF-2 subunit; Provis 92.55
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 92.54
PRK13695174 putative NTPase; Provisional 92.44
PRK06762166 hypothetical protein; Provisional 92.44
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 92.43
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 92.42
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 92.42
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 92.42
PRK14527191 adenylate kinase; Provisional 92.41
PRK00454196 engB GTP-binding protein YsxC; Reviewed 92.4
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 92.38
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 92.38
PRK14528186 adenylate kinase; Provisional 92.36
PRK06547172 hypothetical protein; Provisional 92.36
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 92.36
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 92.36
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.34
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 92.33
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 92.32
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 92.27
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 92.27
PRK11058426 GTPase HflX; Provisional 92.22
TIGR00436270 era GTP-binding protein Era. Era is an essential G 92.21
COG1136226 SalX ABC-type antimicrobial peptide transport syst 92.19
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 92.16
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.16
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.07
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 92.06
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 92.06
PRK14526211 adenylate kinase; Provisional 92.05
cd03269210 ABC_putative_ATPase This subfamily is involved in 92.05
PRK00625173 shikimate kinase; Provisional 92.04
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 92.03
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.02
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 92.01
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 92.0
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 92.0
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 91.98
PHA02530300 pseT polynucleotide kinase; Provisional 91.98
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 91.97
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 91.96
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 91.95
PLN02200234 adenylate kinase family protein 91.93
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 91.93
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 91.92
PRK14529223 adenylate kinase; Provisional 91.9
PF09439181 SRPRB: Signal recognition particle receptor beta s 91.87
cd03234226 ABCG_White The White subfamily represents ABC tran 91.87
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 91.83
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 91.82
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 91.82
PRK05057172 aroK shikimate kinase I; Reviewed 91.81
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 91.79
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 91.78
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 91.78
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 91.77
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 91.77
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 91.76
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 91.76
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 91.73
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 91.7
PRK08356195 hypothetical protein; Provisional 91.7
PRK07560 731 elongation factor EF-2; Reviewed 91.7
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 91.69
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.69
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 91.68
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 91.65
smart00534185 MUTSac ATPase domain of DNA mismatch repair MUTS f 91.64
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 91.64
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 91.64
PRK00131175 aroK shikimate kinase; Reviewed 91.63
COG4615546 PvdE ABC-type siderophore export system, fused ATP 91.62
COG4559259 ABC-type hemin transport system, ATPase component 91.62
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 91.61
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 91.61
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 91.6
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.6
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 91.58
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 91.58
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 91.57
TIGR00101199 ureG urease accessory protein UreG. This model rep 91.57
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 91.56
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 91.54
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 91.54
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 91.53
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 91.51
KOG3886|consensus295 91.51
PRK09825176 idnK D-gluconate kinase; Provisional 91.47
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 91.46
COG1117253 PstB ABC-type phosphate transport system, ATPase c 91.44
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 91.44
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 91.4
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 91.4
COG1084346 Predicted GTPase [General function prediction only 91.39
PRK14242253 phosphate transporter ATP-binding protein; Provisi 91.37
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 91.36
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 91.35
cd03215182 ABC_Carb_Monos_II This family represents domain II 91.33
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 91.23
PRK14241258 phosphate transporter ATP-binding protein; Provisi 91.23
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 91.23
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.22
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 91.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 91.21
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 91.19
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 91.19
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 91.18
cd03246173 ABCC_Protease_Secretion This family represents the 91.18
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 91.17
COG3638258 ABC-type phosphate/phosphonate transport system, A 91.16
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 91.14
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 91.13
PRK13947171 shikimate kinase; Provisional 91.12
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 91.12
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 91.1
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 91.09
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 91.05
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 91.04
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 91.04
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 91.04
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 91.02
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.01
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 91.0
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 90.99
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 90.96
PRK04182180 cytidylate kinase; Provisional 90.95
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 90.94
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 90.93
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 90.93
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 90.92
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 90.92
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 90.91
PRK10908222 cell division protein FtsE; Provisional 90.89
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 90.87
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 90.87
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 90.86
PRK01184184 hypothetical protein; Provisional 90.85
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 90.84
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 90.84
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 90.83
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 90.82
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 90.81
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 90.81
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 90.8
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 90.79
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 90.78
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 90.78
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 90.75
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 90.73
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 90.69
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 90.66
PLN02459261 probable adenylate kinase 90.65
PRK10790592 putative multidrug transporter membrane\ATP-bindin 90.65
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 90.63
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 90.62
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 90.62
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 90.62
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 90.6
PRK14737186 gmk guanylate kinase; Provisional 90.6
PLN02674244 adenylate kinase 90.57
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 90.57
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 90.5
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 90.49
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 90.47
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 90.46
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 90.45
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 90.44
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 90.43
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 90.43
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 90.43
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 90.42
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 90.42
PRK14240250 phosphate transporter ATP-binding protein; Provisi 90.41
KOG0080|consensus209 90.39
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 90.39
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 90.37
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 90.34
PRK05541176 adenylylsulfate kinase; Provisional 90.34
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 90.32
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 90.32
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 90.31
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 90.29
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 90.28
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 90.28
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 90.26
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 90.25
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 90.25
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 90.24
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 90.24
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 90.24
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 90.24
PRK08099399 bifunctional DNA-binding transcriptional repressor 90.23
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 90.23
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 90.23
cd03114148 ArgK-like The function of this protein family is u 90.19
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 90.18
PRK09580248 sufC cysteine desulfurase ATPase component; Review 90.17
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 90.14
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 90.14
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 90.13
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 90.12
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 90.11
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 90.1
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 90.09
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 90.09
PRK14238271 phosphate transporter ATP-binding protein; Provisi 90.08
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 90.07
>KOG0085|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.1e-88  Score=636.61  Aligned_cols=300  Identities=65%  Similarity=1.004  Sum_probs=292.9

Q ss_pred             CCCcceeEEEECCCCCChhHHHHHHHHhcCCCCCHHHHhhhhhhHHHHHHHHHHHHHHHHHHccccCCCccCHHHHHHHh
Q psy16468          9 CPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIR   88 (463)
Q Consensus         9 ~~~~~~kvLlLG~geSGKSTi~KQmrii~~~g~s~~E~~~~r~~I~~Nii~~~~~li~a~~~l~i~~~~~~~~~~a~~i~   88 (463)
                      ..+++.|+||||+||||||||+||||||||.||+++++..++++||+|++.+|+++|+||+.|.|++..++++++|..++
T Consensus        35 ~arrelkllllgtgesgkstfikqmriihg~gyseedrkgf~~lvyqnif~amqaMIrAMetL~I~y~~e~nk~~A~~vr  114 (359)
T KOG0085|consen   35 DARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEEDRKGFTKLVYQNIFTAMQAMIRAMETLKIPYKREENKAHASLVR  114 (359)
T ss_pred             hhhhhheeeeecCCCcchhhHHHHHHhhhcCCCChhhhccchHHHHHHHHHHHHHHHHHHHHhccccccccchhhhhHhh
Confidence            34899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccCchHHHHHHHhhcCChhHHHHHhhccccccccchhhhhcccceeecCCCCCCccccccccccccceeEEEE
Q psy16468         89 SVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPF  168 (463)
Q Consensus        89 ~~~~~~~~~~~~e~~~~i~~LW~D~~iq~~~~r~~e~~L~ds~~Yfl~~l~RI~~~~Y~PT~~Dil~~r~~T~Gi~e~~f  168 (463)
                      +.+.+....|...++.+|+.||.|||||+||+||+||||.||++||+++++||+.|+|.||.||+|+.|+|||||.|+.|
T Consensus       115 evd~ekVttfe~~yv~aik~LW~D~GIqeCYdRRREyqLsDSakYylsdldria~~~ylPTqQDvLRvRvPTTGi~eypf  194 (359)
T KOG0085|consen  115 EVDVEKVTTFEKRYVSAIKWLWRDPGIQECYDRRREYQLSDSAKYYLSDLDRIATPGYLPTQQDVLRVRVPTTGIIEYPF  194 (359)
T ss_pred             hcchHHhhhhhHHHHHHHHHHHhCcchHHHHHHHHHhhcchhhhHHhhhhhhhcCcccCcchhhhheeecCcccceecCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCceeeeeccCCCccccccccccceeeEEEecCCccccccccccccCcccEEEEEEeccchhhhhccCCccchHHHHH
Q psy16468        169 DLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESK  248 (463)
Q Consensus       169 ~~~~~~~~~~d~~~~~~~~~~~~~~f~~~~i~DvgGqr~eR~kW~~~f~~v~~iiFvv~ls~ydq~~~e~~~~nr~~esl  248 (463)
                      .+.++.|                      +++|||||++|||||+|||+||++|+|+|+||+|||++.|.++.|||+||+
T Consensus       195 dl~~iif----------------------rmvDvGGqrserrKWIHCFEnvtsi~fLvaLSEYDQvL~E~dnENRMeESk  252 (359)
T KOG0085|consen  195 DLQKIIF----------------------RMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQVLVESDNENRMEESK  252 (359)
T ss_pred             chhhhee----------------------eeeecCCchhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHccchhhHHHHH
Confidence            9999988                      999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCCeeEecCCccccccccccccceeeecchhhhchhhhhhccCCccccCCCCCCCcccHHHHHHHHHH
Q psy16468        249 ALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILR  328 (463)
Q Consensus       249 ~lf~~i~~~~~~~~~~il~~~~~~~~v~~~~~~~~~l~lNK~D~~~eki~~~~~~~l~~~fp~f~g~~~~~~~a~~fi~~  328 (463)
                      ++|..|+..|||+++++|                  +|+||.|++++||..+   .+.+|||+|.||..|+++|++||++
T Consensus       253 ALFrTIi~yPWF~nssVI------------------lFLNKkDlLEekI~yS---Hl~~YFPe~~GP~qDa~AAreFILk  311 (359)
T KOG0085|consen  253 ALFRTIITYPWFQNSSVI------------------LFLNKKDLLEEKILYS---HLADYFPEFDGPKQDAQAAREFILK  311 (359)
T ss_pred             HHHHHHhccccccCCceE------------------EEechhhhhhhhhhHH---HHHHhCcccCCCcccHHHHHHHHHH
Confidence            999999999999999999                  9999999999999999   8999999999999999999999999


Q ss_pred             Hh-ccCCCCCCcccccccCCCccc
Q psy16468        329 MT-STGRDRSARVHSANVRRPQSG  351 (463)
Q Consensus       329 ~f-~~~~~~~~~v~~H~vR~~~~~  351 (463)
                      +| .+|.+.++.+|+|+.=...+.
T Consensus       312 m~~d~nPd~dKii~SHfTcATDT~  335 (359)
T KOG0085|consen  312 MYVDMNPDSDKIIYSHFTCATDTE  335 (359)
T ss_pred             HHHhhCCCccceeeeeeeecccch
Confidence            99 999999999999998766553

>KOG0082|consensus Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>KOG0082|consensus Back     alignment and domain information
>KOG0085|consensus Back     alignment and domain information
>KOG0099|consensus Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>KOG0070|consensus Back     alignment and domain information
>KOG0074|consensus Back     alignment and domain information
>KOG0073|consensus Back     alignment and domain information
>KOG0071|consensus Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>KOG0076|consensus Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>KOG0072|consensus Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>KOG0077|consensus Back     alignment and domain information
>KOG0075|consensus Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>KOG0084|consensus Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>KOG0094|consensus Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0092|consensus Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>KOG0395|consensus Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>KOG0078|consensus Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>KOG3883|consensus Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1673|consensus Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>KOG0394|consensus Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG0093|consensus Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>KOG0079|consensus Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0098|consensus Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>KOG3886|consensus Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0080|consensus Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
2bcj_Q353 Crystal Structure Of G Protein-coupled Receptor Kin 1e-109
2bcj_Q353 Crystal Structure Of G Protein-coupled Receptor Kin 1e-35
4gnk_A353 Crystal Structure Of Galphaq In Complex With Full-l 1e-109
4gnk_A353 Crystal Structure Of Galphaq In Complex With Full-l 1e-35
3ah8_A355 Structure Of Heterotrimeric G Protein Galpha-Q Beta 1e-109
3ah8_A355 Structure Of Heterotrimeric G Protein Galpha-Q Beta 1e-35
3ohm_A327 Crystal Structure Of Activated G Alpha Q Bound To I 1e-109
3ohm_A327 Crystal Structure Of Activated G Alpha Q Bound To I 2e-35
4ekc_A347 Structure Of Human Regulator Of G Protein Signaling 1e-105
4ekc_A347 Structure Of Human Regulator Of G Protein Signaling 2e-34
3c7k_A333 Molecular Architecture Of Galphao And The Structura 2e-61
3c7k_A333 Molecular Architecture Of Galphao And The Structura 2e-12
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 5e-61
1svk_A353 Structure Of The K180p Mutant Of Gi Alpha Subunit B 1e-17
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 3e-60
1gp2_A353 G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 Wi 1e-16
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 3e-60
3ffb_A360 Crystal Structure Of A Fast Activating G Protein Mu 1e-16
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 5e-60
2xns_A327 Crystal Structure Of Human G Alpha I1 Bound To A De 1e-16
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 5e-60
2zjy_A356 Structure Of The K349p Mutant Of Gi Alpha 1 Subunit 1e-16
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 5e-60
1kjy_A325 Crystal Structure Of Human G[alpha]i1 Bound To The 1e-16
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 5e-60
1y3a_A329 Structure Of G-Alpha-I1 Bound To A Gdp-Selective Pe 1e-16
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 5e-60
4g5q_A330 Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 1e-16
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 6e-60
2ik8_A324 Crystal Structure Of The Heterodimeric Complex Of H 1e-16
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 6e-60
1bh2_A315 A326s Mutant Of An Inhibitory Alpha Subunit Length 1e-16
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 6e-60
2gtp_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-16
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 7e-60
2g83_A313 Structure Of Activated G-alpha-i1 Bound To A Nucleo 1e-16
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 8e-60
1fqj_A325 Crystal Structure Of The Heterotrimeric Complex Of 2e-17
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 1e-59
3d7m_A354 Crystal Structure Of The G Protein Fast-Exchange Do 9e-17
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 2e-59
3ums_A354 Crystal Structure Of The G202a Mutant Of Human G-Al 1e-16
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-59
1gg2_A353 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 3e-16
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 3e-59
1gil_A353 Structure Of Active Conformations Of Gia1 And The M 9e-17
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 4e-59
3onw_A328 Structure Of A G-Alpha-I1 Mutant With Enhanced Affi 1e-16
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 5e-59
1as0_A353 Gtp-Gamma-S Bound G42v Gia1 Length = 353 1e-16
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 6e-59
3qi2_A328 A Galpha P-Loop Mutation Prevents Transition To The 1e-16
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 7e-59
3qe0_A325 A Galpha-I1 P-Loop Mutation Prevents Transition To 1e-16
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 9e-59
3v00_C356 Studies Of A Constitutively Active G-Alpha Subunit 2e-17
1tnd_A324 The 2.2 Angstroms Crystal Structure Of Transducin-A 2e-58
1tnd_A324 The 2.2 Angstroms Crystal Structure Of Transducin-A 1e-16
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 6e-58
3umr_A354 Crystal Structure Of The G202d Mutant Of Human G-Al 3e-16
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 5e-57
2ode_A350 Crystal Structure Of The Heterodimeric Complex Of H 7e-16
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 6e-57
1got_A350 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-16
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 9e-57
4g5r_A330 Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 1e-15
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-56
2ihb_A323 Crystal Structure Of The Heterodimeric Complex Of H 1e-15
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 7e-56
4g5o_A330 Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length 1e-15
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 2e-51
1shz_A340 Crystal Structure Of The P115rhogef Rgrgs Domain In 2e-13
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 2e-50
1zcb_A362 Crystal Structure Of G Alpha 13 In Complex With Gdp 6e-13
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 3e-50
3cx7_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 8e-13
3cx6_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 2e-49
3cx6_A338 Crystal Structure Of Pdzrhogef Rgrgs Domain In A Co 8e-13
1zca_A359 Crystal Structure Of G Alpha 12 In Complex With Gdp 1e-45
1zca_A359 Crystal Structure Of G Alpha 12 In Complex With Gdp 1e-10
3sn6_A380 Crystal Structure Of The Beta2 Adrenergic Receptor- 1e-44
3sn6_A380 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-10
1cul_C380 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-44
1cul_C380 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-10
1cjk_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-43
1cjk_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-10
1azs_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 3e-43
1azs_C402 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-10
1cs4_C394 Complex Of Gs-Alpha With The Catalytic Domains Of M 3e-43
1cs4_C394 Complex Of Gs-Alpha With The Catalytic Domains Of M 2e-10
2xtz_A354 Crystal Structure Of The G Alpha Protein Atgpa1 Fro 8e-39
2xtz_A354 Crystal Structure Of The G Alpha Protein Atgpa1 Fro 2e-06
4fid_A340 Crystal Structure Of A Heterotrimeric G-Protein Sub 3e-35
4fid_A340 Crystal Structure Of A Heterotrimeric G-Protein Sub 5e-07
>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 Back     alignment and structure 
Iteration: 1

 Score =  392 bits (1008), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/312 (63%), Positives = 228/312 (73%), Gaps = 43/312 (13%)
Query: 18  FVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYAD 77
            +GTGESGKSTFIKQMRIIHGSGYSDEDKRGF KLVYQNIF AMQ+MIRAMD LKI Y  
Sbjct: 38  LLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKY 97
Query: 78  PTCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLME 137
              +  A+L+R VD E V+ FE+PYV+AIK LW DPGIQECYDRRREYQL+DS KYYL +
Sbjct: 98  EHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLND 157
Query: 138 IDRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENV 197
           +DRVA P+YLPT+QD+LRVRVPTTGIIEYPFDL+ + FRMVDVGGQRSERRKWIHC    
Sbjct: 158 LDRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHC---- 213
Query: 198 TMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITY 257
                             FENVTSI+FLVALSEYDQ+L ES+NENRMEESKALF+TIITY
Sbjct: 214 ------------------FENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITY 255
Query: 258 PWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQR 317
           PWFQ+S V                  + F N   L  +  +  + ++Y    P + GPQR
Sbjct: 256 PWFQNSSV------------------ILFLNKKDLLEEKIMYSHLVDYF---PEYDGPQR 294
Query: 318 DAIAAREFILRM 329
           DA AAREFIL+M
Sbjct: 295 DAQAAREFILKM 306
>pdb|2BCJ|Q Chain Q, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 353 Back     alignment and structure
>pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 Back     alignment and structure
>pdb|4GNK|A Chain A, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 353 Back     alignment and structure
>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 Back     alignment and structure
>pdb|3AH8|A Chain A, Structure Of Heterotrimeric G Protein Galpha-Q Beta Gamma In Complex With An Inhibitor Ym-254890 Length = 355 Back     alignment and structure
>pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 Back     alignment and structure
>pdb|3OHM|A Chain A, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 327 Back     alignment and structure
>pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 Back     alignment and structure
>pdb|4EKC|A Chain A, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 347 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|3C7K|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 333 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of Gi Alpha Subunit Bound To Alf4 And Gdp Length = 353 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|1GP2|A Chain A, G Protein Heterotrimer Gi_alpha_1 Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|2XNS|A Chain A, Crystal Structure Of Human G Alpha I1 Bound To A Designed Helical Peptide Derived From The Goloco Motif Of Rgs14 Length = 327 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|2ZJY|A Chain A, Structure Of The K349p Mutant Of Gi Alpha 1 Subunit Bound To Alf4 And Gdp Length = 356 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|1KJY|A Chain A, Crystal Structure Of Human G[alpha]i1 Bound To The Goloco Motif Of Rgs14 Length = 325 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|1Y3A|A Chain A, Structure Of G-Alpha-I1 Bound To A Gdp-Selective Peptide Provides Insight Into Guanine Nucleotide Exchange Length = 329 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|4G5Q|A Chain A, Structure Of Lgn Gl4GALPHAI1 COMPLEX Length = 330 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|2IK8|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 324 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|1BH2|A Chain A, A326s Mutant Of An Inhibitory Alpha Subunit Length = 315 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|2GTP|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs1 And Activated Gi Alpha 1 Length = 323 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|2G83|A Chain A, Structure Of Activated G-alpha-i1 Bound To A Nucleotide- State-selective Peptide: Minimal Determinants For Recognizing The Active Form Of A G Protein Alpha Subunit Length = 313 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|1FQJ|A Chain A, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 325 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|3D7M|A Chain A, Crystal Structure Of The G Protein Fast-Exchange Double Mutant I56cQ333C Length = 354 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|3UMS|A Chain A, Crystal Structure Of The G202a Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 353 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|1GIL|A Chain A, Structure Of Active Conformations Of Gia1 And The Mechanism Of Gtp Hydrolysis Length = 353 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|3ONW|A Chain A, Structure Of A G-Alpha-I1 Mutant With Enhanced Affinity For The Rgs14 Goloco Motif. Length = 328 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|1AS0|A Chain A, Gtp-Gamma-S Bound G42v Gia1 Length = 353 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|3QI2|A Chain A, A Galpha P-Loop Mutation Prevents Transition To The Activated State: G42r Bound To Rgs14 Goloco Length = 328 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|3QE0|A Chain A, A Galpha-I1 P-Loop Mutation Prevents Transition To The Activated State Length = 325 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|3V00|C Chain C, Studies Of A Constitutively Active G-Alpha Subunit Provide Insights Into The Mechanism Of G Protein Activation. Length = 356 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|1TND|A Chain A, The 2.2 Angstroms Crystal Structure Of Transducin-Alpha Complexed With Gtp Gamma S Length = 324 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|3UMR|A Chain A, Crystal Structure Of The G202d Mutant Of Human G-Alpha-I1 Length = 354 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|2ODE|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 350 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 350 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|4G5R|A Chain A, Structure Of Lgn Gl4GALPHAI3 COMPLEX Length = 330 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|2IHB|A Chain A, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 323 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|4G5O|A Chain A, Structure Of Lgn Gl4GALPHAI3(Q147L) COMPLEX Length = 330 Back     alignment and structure
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|1SHZ|A Chain A, Crystal Structure Of The P115rhogef Rgrgs Domain In A Complex With Galpha(13):galpha(i1) Chimera Length = 340 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|1ZCB|A Chain A, Crystal Structure Of G Alpha 13 In Complex With Gdp Length = 362 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|3CX7|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp-Alf4 Length = 338 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure
>pdb|3CX6|A Chain A, Crystal Structure Of Pdzrhogef Rgrgs Domain In A Complex With Galpha-13 Bound To Gdp Length = 338 Back     alignment and structure
>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 Back     alignment and structure
>pdb|1ZCA|A Chain A, Crystal Structure Of G Alpha 12 In Complex With Gdp, Mg2+ And Alf4- Length = 359 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|3SN6|A Chain A, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 380 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2',5'-Dideoxy-Adenosine 3'- Triphosphate And Mg Length = 380 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With Adenosine 5'-(Alpha Thio)-Triphosphate (Rp), Mg, And Mn Length = 402 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase Length = 402 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|1CS4|C Chain C, Complex Of Gs-Alpha With The Catalytic Domains Of Mammalian Adenylyl Cyclase: Complex With 2'-Deoxy-Adenosine 3'- Monophosphate, Pyrophosphate And Mg Length = 394 Back     alignment and structure
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From Arabidopsis Thaliana Length = 354 Back     alignment and structure
>pdb|2XTZ|A Chain A, Crystal Structure Of The G Alpha Protein Atgpa1 From Arabidopsis Thaliana Length = 354 Back     alignment and structure
>pdb|4FID|A Chain A, Crystal Structure Of A Heterotrimeric G-Protein Subunit From Entamoeba Histolytica, Ehg-Alpha-1 Length = 340 Back     alignment and structure
>pdb|4FID|A Chain A, Crystal Structure Of A Heterotrimeric G-Protein Subunit From Entamoeba Histolytica, Ehg-Alpha-1 Length = 340 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query463
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 1e-84
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 7e-27
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 4e-81
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 4e-25
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 7e-06
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 6e-81
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 2e-27
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 4e-78
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 5e-27
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 2e-76
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 2e-26
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 6e-05
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 1e-05
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 2e-04
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 2e-04
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 3e-04
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 3e-04
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 3e-04
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 4e-04
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 4e-04
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 4e-04
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 5e-04
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 9e-04
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
 Score =  262 bits (670), Expect = 1e-84
 Identities = 198/311 (63%), Positives = 225/311 (72%), Gaps = 43/311 (13%)

Query: 19  VGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADP 78
           +GTGESGKSTFIKQMRIIHGSGYSDEDKRGF KLVYQNIF AMQ+MIRAMD LKI Y   
Sbjct: 13  LGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYE 72

Query: 79  TCEEKAELIRSVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEI 138
             +  A+L+R VD E V+ FE+PYV+AIK LW DPGIQECYDRRREYQL+DS KYYL ++
Sbjct: 73  HNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDL 132

Query: 139 DRVAAPNYLPTEQDILRVRVPTTGIIEYPFDLEEIRFRMVDVGGQRSERRKWIHCFENVT 198
           DRVA P+YLPT+QD+LRVRVPTTGIIEYPFDL+ + FR                      
Sbjct: 133 DRVADPSYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFR---------------------- 170

Query: 199 MVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESKALFKTIITYP 258
           MVDVGGQRSERRKWIHCFENVTSI+FLVALSEYDQ+L ES+NENRMEESKALF+TIITYP
Sbjct: 171 MVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYP 230

Query: 259 WFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRD 318
           WFQ+S V                  + F N   L  +    +   +     P + GPQRD
Sbjct: 231 WFQNSSV------------------ILFLNKKDLLEE---KIMYSHLVDYFPEYDGPQRD 269

Query: 319 AIAAREFILRM 329
           A AAREFIL+M
Sbjct: 270 AQAAREFILKM 280
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 100.0
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 100.0
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 100.0
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 100.0
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 100.0
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 100.0
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 99.9
4fid_A340 G protein alpha subunit; RAS-like domain, all-heli 99.88
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 99.87
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 99.84
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 99.82
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 99.78
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.28
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.21
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.19
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.18
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.18
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.18
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.16
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.15
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.14
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.14
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.13
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.13
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.12
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.11
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.07
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.05
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.01
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 98.98
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 98.97
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 98.97
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 98.96
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 98.96
3t1o_A198 Gliding protein MGLA; G domain containing protein, 98.96
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 98.95
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 98.95
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 98.95
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 98.94
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 98.93
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 98.92
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 98.91
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 98.91
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 98.91
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 98.9
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 98.89
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 98.89
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 98.88
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 98.88
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 98.88
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 98.87
3o47_A329 ADP-ribosylation factor GTPase-activating protein 98.87
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 98.87
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 98.86
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 98.85
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 98.84
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 98.83
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 98.83
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 98.82
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 98.82
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 98.82
2fh5_B214 SR-beta, signal recognition particle receptor beta 98.81
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 98.81
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 98.8
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 98.8
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 98.8
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 98.8
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 98.8
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 98.8
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 98.8
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 98.8
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 98.8
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 98.78
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 98.78
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 98.77
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 98.77
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 98.77
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 98.76
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 98.76
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 98.74
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 98.74
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 98.73
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 98.73
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 98.73
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 98.73
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 98.72
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 98.72
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 98.72
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 98.71
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 98.7
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 98.7
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 98.69
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 98.69
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 98.68
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 98.68
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 98.68
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 98.67
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 98.66
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 98.66
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 98.66
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 98.63
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 98.63
3llu_A196 RAS-related GTP-binding protein C; structural geno 98.6
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 98.6
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 98.6
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 98.58
2ged_A193 SR-beta, signal recognition particle receptor beta 98.57
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.55
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 98.54
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 98.53
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 98.52
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 98.51
1nrj_B218 SR-beta, signal recognition particle receptor beta 98.49
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.48
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 98.46
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 98.45
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 97.82
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 98.43
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 98.3
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 98.28
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 98.26
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.23
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 98.22
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 98.21
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 98.17
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 98.14
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 98.14
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 98.14
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 98.14
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 98.13
3lxx_A239 GTPase IMAP family member 4; structural genomics c 98.13
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 98.12
2wji_A165 Ferrous iron transport protein B homolog; membrane 98.11
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 98.1
3lxw_A247 GTPase IMAP family member 1; immunity, structural 98.09
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 98.05
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 98.04
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 98.01
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 98.0
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.96
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.94
3iby_A256 Ferrous iron transport protein B; G protein, G dom 97.93
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 97.91
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.82
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 97.77
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.73
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 97.73
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.68
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 97.67
2elf_A370 Protein translation elongation factor 1A; tRNA, py 97.66
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 97.65
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 97.65
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 97.64
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 97.53
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 97.47
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 97.47
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.47
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 97.45
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 97.43
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 97.42
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 97.41
1wb1_A 482 Translation elongation factor SELB; selenocysteine 97.38
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 97.34
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 97.34
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 97.26
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 97.24
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 97.23
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.23
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 97.19
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 97.17
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 97.16
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 97.14
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 97.1
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 97.08
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 97.06
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.02
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 96.91
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.9
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.88
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 96.72
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 96.26
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.04
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.02
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 95.62
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 95.61
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 95.11
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 95.1
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 95.02
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 94.99
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.83
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.63
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.59
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.54
1kag_A173 SKI, shikimate kinase I; transferase, structural g 94.51
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.51
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 94.47
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.36
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.35
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 94.34
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.32
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 94.26
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.18
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 94.1
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.09
4a74_A231 DNA repair and recombination protein RADA; hydrola 93.97
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 93.96
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 93.87
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.87
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 93.85
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.81
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 93.74
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.74
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 93.72
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 93.68
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.65
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 93.6
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.59
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 93.51
3vaa_A199 Shikimate kinase, SK; structural genomics, center 93.5
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 93.48
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 93.48
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.45
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.44
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.42
1via_A175 Shikimate kinase; structural genomics, transferase 93.42
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.41
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.38
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 93.36
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 93.34
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.32
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.31
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.3
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 93.3
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 93.3
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.27
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 93.2
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.19
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.13
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 93.11
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.07
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.06
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 93.06
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.02
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 92.98
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.97
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.96
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 92.89
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.87
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 92.87
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 92.86
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.85
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 92.85
2hf9_A226 Probable hydrogenase nickel incorporation protein 92.84
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 92.81
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.81
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 92.8
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 92.8
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 92.77
1g6h_A257 High-affinity branched-chain amino acid transport 92.74
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.74
1ji0_A240 ABC transporter; ATP binding protein, structural g 92.71
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.69
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.67
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 92.63
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 92.61
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 92.61
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 92.61
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.58
2cvh_A220 DNA repair and recombination protein RADB; filamen 92.55
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.55
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 92.53
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 92.52
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 92.5
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 92.49
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 92.49
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.44
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 92.43
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.41
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 92.39
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 92.38
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.38
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.38
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 92.38
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 92.36
2ghi_A260 Transport protein; multidrug resistance protein, M 92.34
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.32
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 92.31
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 92.28
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 92.26
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.24
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 92.18
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.17
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 92.15
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.13
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 92.1
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.08
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 92.06
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 92.05
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 92.03
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 92.01
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 91.94
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 91.93
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 91.92
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 91.91
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 91.88
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.88
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.83
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 91.83
3kta_A182 Chromosome segregation protein SMC; structural mai 91.81
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.68
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 91.63
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 91.58
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 91.55
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.51
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 91.37
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 91.36
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 91.36
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 91.34
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 91.12
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 91.04
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.04
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.02
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 91.02
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 91.0
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 90.96
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 90.96
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 90.92
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 90.88
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 90.85
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.84
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 90.8
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 90.72
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.72
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 90.69
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 90.69
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 90.67
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 90.65
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.65
2www_A349 Methylmalonic aciduria type A protein, mitochondri 90.49
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 90.39
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 90.27
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.21
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 90.21
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 90.21
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.19
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.15
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 90.15
2kjq_A149 DNAA-related protein; solution structure, NESG, st 90.14
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.08
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 90.04
3bos_A242 Putative DNA replication factor; P-loop containing 89.97
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 89.97
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 89.89
2ewv_A372 Twitching motility protein PILT; pilus retraction 89.89
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 89.88
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.82
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 89.81
1p9r_A418 General secretion pathway protein E; bacterial typ 89.74
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 89.68
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 89.56
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 89.56
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.51
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.5
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 89.44
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 89.4
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 89.34
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 89.31
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 89.18
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 89.18
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 89.11
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 89.07
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 89.07
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 89.0
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 88.99
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 88.84
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 88.64
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 88.53
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.43
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 88.39
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 88.36
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 88.3
2chg_A226 Replication factor C small subunit; DNA-binding pr 88.3
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 88.12
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 88.1
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 88.06
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 87.83
2oap_1511 GSPE-2, type II secretion system protein; hexameri 87.82
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.77
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 87.76
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 87.72
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 87.67
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 87.52
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 87.35
1xjc_A169 MOBB protein homolog; structural genomics, midwest 87.27
2og2_A359 Putative signal recognition particle receptor; nuc 87.16
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 87.15
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 86.95
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 86.93
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 86.92
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 86.86
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 86.84
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 86.78
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 86.73
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 86.53
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.4
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 86.37
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 86.31
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 86.28
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 86.26
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 86.13
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 86.04
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 85.97
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 85.89
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 85.88
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 85.63
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 85.48
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 85.42
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 85.3
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 85.21
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 85.18
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 85.15
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 85.1
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 85.08
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 85.03
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 85.0
1jal_A363 YCHF protein; nucleotide-binding fold, structural 84.85
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 84.85
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 84.71
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 84.63
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 84.61
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 84.49
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 84.43
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 84.19
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 84.18
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 84.16
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 84.15
1vma_A306 Cell division protein FTSY; TM0570, structural gen 84.0
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 83.99
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 83.85
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 83.78
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 83.64
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 83.49
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 83.48
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 83.38
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 83.36
1wxq_A397 GTP-binding protein; structural genomics, riken st 83.29
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 83.2
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 83.15
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 83.13
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 83.13
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 83.1
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 83.06
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 83.06
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 83.03
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 82.97
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 82.89
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 82.83
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 82.65
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 82.64
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 82.64
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 82.55
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 82.51
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 82.48
2r62_A268 Cell division protease FTSH homolog; ATPase domain 82.39
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 82.37
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 82.3
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 82.27
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 82.19
2v1u_A387 Cell division control protein 6 homolog; DNA repli 82.03
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 82.01
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 81.89
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 81.81
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 81.7
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 81.65
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 81.59
3cnl_A262 YLQF, putative uncharacterized protein; circular p 81.41
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 81.31
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 81.3
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 81.24
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 81.22
4aby_A415 DNA repair protein RECN; hydrolase, double strand 81.21
1e69_A322 Chromosome segregation SMC protein; structural mai 81.2
3co5_A143 Putative two-component system transcriptional RES 81.18
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 80.99
1wxq_A397 GTP-binding protein; structural genomics, riken st 80.95
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 80.93
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 80.89
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 80.72
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 80.72
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 80.28
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 80.21
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 80.12
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 80.1
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 80.09
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 80.05
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 80.03
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
Probab=100.00  E-value=8.2e-75  Score=586.88  Aligned_cols=299  Identities=67%  Similarity=1.024  Sum_probs=286.6

Q ss_pred             CCCcceeEEEECCCCCChhHHHHHHHHhcCCCCCHHHHhhhhhhHHHHHHHHHHHHHHHHHHccccCCCccCHHHHHHHh
Q psy16468          9 CPALEASNDFVGTGESGKSTFIKQMRIIHGSGYSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIR   88 (463)
Q Consensus         9 ~~~~~~kvLlLG~geSGKSTi~KQmrii~~~g~s~~E~~~~r~~I~~Nii~~~~~li~a~~~l~i~~~~~~~~~~a~~i~   88 (463)
                      ..++++|+||||+||||||||+|||||||++||+++|+..|+++||.|++++|++|++||+.+++++++|+++..++.++
T Consensus         3 ~~~~~~klLlLG~geSGKSTi~KQmkiih~~gfs~~e~~~~~~~i~~N~~~~~~~li~a~~~l~i~~~~~~~~~~~~~~~   82 (327)
T 3ohm_A            3 DARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVR   82 (327)
T ss_dssp             --CCEEEEEEECSTTSSHHHHHHHHHHHHSCCCCHHHHHTTHHHHHHHHHHHHHHHHHHHHHTTCCCSSTHHHHHHHHHH
T ss_pred             hhcccceEEEEcCCCccHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHhHHHHHHHHHHHHHhcCCCCCCchhHHHHHHHh
Confidence            34789999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             cccccccccCchHHHHHHHhhcCChhHHHHHhhccccccccchhhhhcccceeecCCCCCCccccccccccccceeEEEE
Q psy16468         89 SVDFETVTTFESPYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPTTGIIEYPF  168 (463)
Q Consensus        89 ~~~~~~~~~~~~e~~~~i~~LW~D~~iq~~~~r~~e~~L~ds~~Yfl~~l~RI~~~~Y~PT~~Dil~~r~~T~Gi~e~~f  168 (463)
                      +++.....+++++++++|..||+||+||+||+|++||+|+||++|||++++||++++|.||.+|++++|.||+|+.+..|
T Consensus        83 ~~~~~~~~~~~~e~~~~i~~lW~d~~iq~~~~r~~e~~l~d~~~yfl~~l~Ri~~~~Y~PT~~Dilr~r~~TiGi~~~~~  162 (327)
T 3ohm_A           83 EVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRVPTTGIIEYPF  162 (327)
T ss_dssp             TCCGGGCCCCCTTHHHHHHHHHTCHHHHHHHHGGGGSCCCTTHHHHHTTHHHHHSTTCCCCHHHHTTCCCCCCSEEEEEE
T ss_pred             cccccccccccHHHHHHHHHHHcCHHHHHHHHccccceecccHHHHHHHHHHHhccCCCccccchhcccCceeeEEEEEE
Confidence            88776667899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeCCceeeeeccCCCccccccccccceeeEEEecCCccccccccccccCcccEEEEEEeccchhhhhccCCccchHHHHH
Q psy16468        169 DLEEIRFRMVDVGGQRSERRKWIHCFENVTMVDVGGQRSERRKWIHCFENVTSIIFLVALSEYDQILFESENENRMEESK  248 (463)
Q Consensus       169 ~~~~~~~~~~d~~~~~~~~~~~~~~f~~~~i~DvgGqr~eR~kW~~~f~~v~~iiFvv~ls~ydq~~~e~~~~nr~~esl  248 (463)
                      .++++++                      .+||+|||+++|++|.|||+++++||||+|+|+|||++.|+.+.|||++++
T Consensus       163 ~~~~v~l----------------------~iwDtgGQe~~R~~w~~yf~~~~~iIfV~dls~ydq~l~d~~~~nr~~es~  220 (327)
T 3ohm_A          163 DLQSVIF----------------------RMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESK  220 (327)
T ss_dssp             EETTEEE----------------------EEEEECCSHHHHTTGGGGCSSCSEEEEEEEGGGGGCBCSSCTTSBHHHHHH
T ss_pred             Eeeceee----------------------EEEEcCCchhHHHHHHHHhCCCCEEEEEEECccccccccccccHhHHHHHH
Confidence            9999888                      999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCCeeEecCCccccccccccccceeeecchhhhchhhhhhccCCccccCCCCCCCcccHHHHHHHHHH
Q psy16468        249 ALFKTIITYPWFQHSMVDVGGQRSERRKWIHCFENVTFCNSVQLFSQYNVILNCMNYTIVPPLHTGPQRDAIAAREFILR  328 (463)
Q Consensus       249 ~lf~~i~~~~~~~~~~il~~~~~~~~v~~~~~~~~~l~lNK~D~~~eki~~~~~~~l~~~fp~f~g~~~~~~~a~~fi~~  328 (463)
                      .+|+++++++++.++|++                  |++||+|++++|+...   ++++|||+|+|++.++++|.+||++
T Consensus       221 ~~~~~i~~~~~~~~~~ii------------------L~~NK~DL~~~ki~~~---~l~~~fp~y~g~~~~~e~a~~fi~~  279 (327)
T 3ohm_A          221 ALFRTIITYPWFQNSSVI------------------LFLNKKDLLEEKIMYS---HLVDYFPEYDGPQRDAQAAREFILK  279 (327)
T ss_dssp             HHHHHHHTSGGGTTCEEE------------------EEEECHHHHHHHTTTS---CGGGTCTTCCSCSSCHHHHHHHHHH
T ss_pred             HHHHHHhhhhccCCceEE------------------EEEECchhhhhhhccc---hHhhhchhccCCCCCHHHHHHHHHH
Confidence            999999999999999999                  9999999999999888   9999999999998899999999999


Q ss_pred             Hh-ccCCCCCCcccccccCCCcc
Q psy16468        329 MT-STGRDRSARVHSANVRRPQS  350 (463)
Q Consensus       329 ~f-~~~~~~~~~v~~H~vR~~~~  350 (463)
                      +| ++++.+.+++|.|++....+
T Consensus       280 ~F~~~~~~~~~~i~~~~TsA~d~  302 (327)
T 3ohm_A          280 MFVDLNPDSDKIIYSHFTCATDT  302 (327)
T ss_dssp             HHHSSCTTTTSCEEEEECCTTCH
T ss_pred             HHHhhcccccCCcEEEEEEeecC
Confidence            99 88877788999999877644
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Back     alignment and structure
>4fid_A G protein alpha subunit; RAS-like domain, all-helical domain, GTP binding, nucleotide signaling protein, transducer, lipoprotein; HET: MLY MSE GDP; 2.62A {Entamoeba histolytica} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 463
d2bcjq1117 a.66.1.1 (Q:67-183) Transducin (alpha subunit), in 8e-47
d2bcjq1117 a.66.1.1 (Q:67-183) Transducin (alpha subunit), in 2e-05
d1cipa1121 a.66.1.1 (A:61-181) Transducin (alpha subunit), in 4e-46
d1cipa1121 a.66.1.1 (A:61-181) Transducin (alpha subunit), in 3e-07
d1tada1121 a.66.1.1 (A:57-177) Transducin (alpha subunit), in 1e-45
d1tada1121 a.66.1.1 (A:57-177) Transducin (alpha subunit), in 4e-07
d1azta1114 a.66.1.1 (A:88-201) Transducin (alpha subunit), in 2e-43
d1azta1114 a.66.1.1 (A:88-201) Transducin (alpha subunit), in 2e-06
d1zcaa1122 a.66.1.1 (A:83-204) Transducin (alpha subunit), in 1e-42
d1zcaa1122 a.66.1.1 (A:83-204) Transducin (alpha subunit), in 8e-07
d1zcba1126 a.66.1.1 (A:76-201) Transducin (alpha subunit), in 1e-42
d1zcba1126 a.66.1.1 (A:76-201) Transducin (alpha subunit), in 2e-06
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 2e-08
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 4e-08
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 2e-05
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 6e-04
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 7e-05
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 1e-04
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure

class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  155 bits (394), Expect = 8e-47
 Identities = 84/117 (71%), Positives = 97/117 (82%)

Query: 41  YSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFETVTTFES 100
           YSDEDKRGF KLVYQNIF AMQ+MIRAMD LKI Y     +  A+L+R VD E V+ FE+
Sbjct: 1   YSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFEN 60

Query: 101 PYVEAIKELWADPGIQECYDRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVR 157
           PYV+AIK LW DPGIQECYDRRREYQL+DS KYYL ++DRVA P+YLPT+QD+LRVR
Sbjct: 61  PYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVR 117
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 121 Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 121 Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 121 Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 121 Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 114 Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Length = 114 Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query463
d1tada1121 Transducin (alpha subunit), insertion domain {Cow 99.97
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.97
d2bcjq1117 Transducin (alpha subunit), insertion domain {Mous 99.97
d1cipa1121 Transducin (alpha subunit), insertion domain {Rat 99.97
d1zcaa1122 Transducin (alpha subunit), insertion domain {Mous 99.96
d1zcba1126 Transducin (alpha subunit), insertion domain {Mous 99.96
d1azta1114 Transducin (alpha subunit), insertion domain {Cow 99.95
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.95
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.88
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.86
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.41
d1tada1121 Transducin (alpha subunit), insertion domain {Cow 99.39
d1cipa1121 Transducin (alpha subunit), insertion domain {Rat 99.36
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.31
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.27
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.24
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.2
d1zcaa1122 Transducin (alpha subunit), insertion domain {Mous 99.2
d2bcjq1117 Transducin (alpha subunit), insertion domain {Mous 99.2
d1zcba1126 Transducin (alpha subunit), insertion domain {Mous 99.18
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.12
d1azta1114 Transducin (alpha subunit), insertion domain {Cow 99.06
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.9
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 98.89
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.86
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 98.83
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 98.79
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 98.73
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 98.71
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 98.71
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 98.65
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 98.65
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 98.61
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 98.6
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 98.6
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 98.59
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 98.59
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 98.55
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 98.54
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 98.54
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 98.54
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 98.53
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 98.53
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 98.53
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 98.52
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 98.48
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 98.48
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 98.48
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 98.44
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.38
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 98.36
d2fh5b1207 Signal recognition particle receptor beta-subunit 98.35
d1nrjb_209 Signal recognition particle receptor beta-subunit 98.15
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 98.08
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.85
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 97.78
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 97.73
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.71
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 97.69
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.27
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 97.12
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.09
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 97.08
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 96.94
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 96.85
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 96.8
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 96.78
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.52
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.44
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 96.39
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.22
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.09
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.9
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 95.89
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.83
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.76
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.7
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.59
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.59
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.53
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.5
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.46
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.44
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.38
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.38
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.29
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.29
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 95.29
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.27
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 95.2
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 95.15
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 95.0
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 94.78
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.75
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 94.69
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 94.59
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 94.55
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 94.46
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.4
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 94.35
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 94.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.27
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.14
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.03
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.86
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 93.81
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.68
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.43
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 93.26
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.2
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.04
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.01
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.99
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.97
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 92.88
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.75
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.51
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.36
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.36
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.32
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.18
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.06
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 92.02
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.94
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.74
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.72
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.51
d2hyda1255 Putative multidrug export ATP-binding/permease pro 91.27
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 91.2
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.2
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 91.14
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.78
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.62
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.61
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 90.45
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 90.37
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 90.35
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 90.34
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.13
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 90.06
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.03
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.03
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.77
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.61
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.55
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 89.55
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 89.54
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 89.47
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 89.43
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.2
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 88.4
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 88.34
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 88.32
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.29
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 88.24
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 88.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 87.85
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 87.66
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 87.58
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 87.48
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.43
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 87.33
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 87.18
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 86.79
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 86.36
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 86.35
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 86.33
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 86.21
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 86.18
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 86.07
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.94
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 85.48
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 85.42
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.31
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 84.98
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 84.67
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 84.43
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.26
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 84.22
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 84.16
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 84.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.98
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 83.83
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 83.56
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 83.2
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 83.16
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 82.42
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 82.32
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 82.04
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 81.88
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 81.54
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 80.46
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 80.43
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 80.28
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Transducin (alpha subunit), insertion domain
superfamily: Transducin (alpha subunit), insertion domain
family: Transducin (alpha subunit), insertion domain
domain: Transducin (alpha subunit), insertion domain
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.97  E-value=4.2e-32  Score=234.90  Aligned_cols=120  Identities=42%  Similarity=0.743  Sum_probs=112.0

Q ss_pred             CCHHHHhhhhhhHHHHHHHHHHHHHHHHHHccccCCCccCHHHHHHHhccccc-ccccCchHHHHHHHhhcCChhHHHHH
Q psy16468         41 YSDEDKRGFIKLVYQNIFMAMQSMIRAMDLLKIQYADPTCEEKAELIRSVDFE-TVTTFESPYVEAIKELWADPGIQECY  119 (463)
Q Consensus        41 ~s~~E~~~~r~~I~~Nii~~~~~li~a~~~l~i~~~~~~~~~~a~~i~~~~~~-~~~~~~~e~~~~i~~LW~D~~iq~~~  119 (463)
                      ||++|+..|+++||.|++++|+.|++||+.++++++++++...++.+...... ...+++++++++|++||+|++||+||
T Consensus         1 Fs~eE~~~~~~~I~~Nii~~m~~li~a~~~l~i~~~~~~~~~~~~~i~~~~~~~~~~~~~~e~~~~i~~LW~D~~iq~~~   80 (121)
T d1tada1           1 YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHMADTIEEGTMPKEMSDIIQRLWKDSGIQACF   80 (121)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCSSTTHHHHHHHHHHHHHHSCTTCCCHHHHHHHHHHHHCHHHHHHH
T ss_pred             CCHHHHHHhHHHHHHHHHHHHHHHHHHHHHcCCCCCCchHHHHHHHHHHhhccccCCCCCHHHHHHHHHHhCCHHHHHHH
Confidence            78999999999999999999999999999999999999998888877654222 34679999999999999999999999


Q ss_pred             hhccccccccchhhhhcccceeecCCCCCCccccccccccc
Q psy16468        120 DRRREYQLTDSAKYYLMEIDRVAAPNYLPTEQDILRVRVPT  160 (463)
Q Consensus       120 ~r~~e~~L~ds~~Yfl~~l~RI~~~~Y~PT~~Dil~~r~~T  160 (463)
                      .|++||+|+||++|||++++||++|+|+||++||||+|.+|
T Consensus        81 ~r~~ef~L~Dsa~YF~~~l~RI~~~~Y~PT~qDiLr~R~~T  121 (121)
T d1tada1          81 DRASEYQLNDSAGYYLSDLERLVTPGYVPTEQDVLRSRVKT  121 (121)
T ss_dssp             HTGGGSCCCTTHHHHHTTHHHHTSTTCCCCHHHHHHCCCCC
T ss_pred             HhhhccccCcchHHHHHHHHHHcCCCCCCCHHHHhhhcCCC
Confidence            99999999999999999999999999999999999999997
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1tada1 a.66.1.1 (A:57-177) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cipa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zcaa1 a.66.1.1 (A:83-204) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azta1 a.66.1.1 (A:88-201) Transducin (alpha subunit), insertion domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure