Psyllid ID: psy16499

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATENDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNANRESMFNGLIANLEAKYGGESGKKETRRQSGRKK
cccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHccccccccccccccccccHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
cccHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
MKGLLQLCEKYYKTKDLYEVlnvdktatpEQIRKAFYKLSLvvhpdrvteedkevatendvekrkvydqtgtlededdeaifksdidWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFElvpfthpseedRYRQIIQDLidkeevpaFDKFLNEAKSKRNRRKFEKEEKLFEKEKAKderrkksgvrnsgadsSMDLIAAIQSKNANRESMFNGLIANLEakyggesgkketrrqsgrkk
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSlvvhpdrvteedkevatendvekrkvydqtgtlededdeaifksdidwtMYWKSLYKDVTEEDIINYEtkykgsaeeiNDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFlneakskrnrrkfekeeklfekekakderrkksgvrnsgadssmdLIAAIQSKNANRESMFNGLIANleakyggesgkketrrqsgrkk
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATENDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAkskrnrrkfekeeklfekekakderrkkSGVRNSGADSSMDLIAAIQSKNANRESMFNGLIANLEAKYGGESGKKETRRQSGRKK
***LLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHP**********************************AIFKSDIDWTMYW************INYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFD*****************************************************************LI************************
*KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATENDVEKRKVYDQTGTL************IDWTMYWKSLYKDVTEEDIINY**************KRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL****************************************************************************************
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRV**************KRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKFEKEEKLFEK*****************ADSSMDLIAAIQSKNANRESMFNGLIANLEAKYG****************
*KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVT*EDK***TENDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRR**E*E*K**********************DSSMDLIAAIQSKNANRESMFNGLIANLEAKYGG***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATENDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNANRESMFNGLIANLEAKYGGESGKKETRRQSGRKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
Q8WXX5260 DnaJ homolog subfamily C yes N/A 0.887 0.880 0.426 3e-45
Q91WN1259 DnaJ homolog subfamily C yes N/A 0.922 0.918 0.406 2e-44
Q9VGR7299 J domain-containing prote yes N/A 0.918 0.792 0.376 1e-38
Q9UTQ5282 Uncharacterized J domain- yes N/A 0.879 0.804 0.322 7e-21
Q9FL54284 Chaperone protein dnaJ 6 no N/A 0.810 0.735 0.295 4e-18
Q54M21502 DnaJ homolog subfamily C yes N/A 0.271 0.139 0.414 1e-07
Q5R6H3379 DnaJ homolog subfamily B yes N/A 0.484 0.329 0.275 9e-07
Q8TBM8379 DnaJ homolog subfamily B no N/A 0.484 0.329 0.275 2e-06
Q9QYI4376 DnaJ homolog subfamily B no N/A 0.484 0.332 0.271 2e-06
Q9HJ83 365 Chaperone protein DnaJ OS yes N/A 0.449 0.317 0.313 4e-06
>sp|Q8WXX5|DNJC9_HUMAN DnaJ homolog subfamily C member 9 OS=Homo sapiens GN=DNAJC9 PE=1 SV=1 Back     alignment and function desciption
 Score =  182 bits (461), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 151/251 (60%), Gaps = 22/251 (8%)

Query: 3   GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATE---- 58
           GLL LCE+ + T DLY VL V + A+  ++R+ ++K+SL VHPDRV E DKE AT     
Sbjct: 2   GLLDLCEEVFGTADLYRVLGVRREASDGEVRRGYHKVSLQVHPDRVGEGDKEDATRRFQI 61

Query: 59  --------NDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 110
                   +D E+R VYD+ GT+++  D  +   D DW  YW+ L+K ++ EDI  +E  
Sbjct: 62  LGKVYSVLSDREQRAVYDEQGTVDE--DSPVLTQDRDWEAYWRLLFKKISLEDIQAFEKT 119

Query: 111 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 170
           YKGS EE+ D K+AY+  +GDMD I E V     +EE R R IIQ  ID  EVP+++ F+
Sbjct: 120 YKGSEEELADIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRNIIQQAIDAGEVPSYNAFV 179

Query: 171 NEAKSKRNRRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNANRESMF 230
            E+K K N RK   +E+  E E +    RK+ G+ + G DS   L AAIQS+  +R+   
Sbjct: 180 KESKQKMNARKRRAQEEAKEAEMS----RKELGL-DEGVDS---LKAAIQSRQKDRQKEM 231

Query: 231 NGLIANLEAKY 241
           +  +A +EAKY
Sbjct: 232 DNFLAQMEAKY 242

Homo sapiens (taxid: 9606)
>sp|Q91WN1|DNJC9_MOUSE DnaJ homolog subfamily C member 9 OS=Mus musculus GN=Dnajc9 PE=2 SV=2 Back     alignment and function description
>sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 Back     alignment and function description
>sp|Q9UTQ5|YL39_SCHPO Uncharacterized J domain-containing protein C1071.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1071.09c PE=3 SV=1 Back     alignment and function description
>sp|Q9FL54|DNAJ6_ARATH Chaperone protein dnaJ 6 OS=Arabidopsis thaliana GN=ATJ6 PE=1 SV=1 Back     alignment and function description
>sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 Back     alignment and function description
>sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=2 SV=2 Back     alignment and function description
>sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
332019850268 DnaJ-like protein subfamily C member 9 [ 0.875 0.843 0.442 4e-47
156554683268 PREDICTED: J domain-containing protein C 0.910 0.876 0.429 2e-46
242011852265 conserved hypothetical protein [Pediculu 0.957 0.932 0.410 3e-46
307175358271 J domain-containing protein CG6693 [Camp 0.953 0.907 0.411 3e-45
378465945269 DnaJ-10 [Bombyx mori] 0.949 0.910 0.400 6e-45
312378846305 hypothetical protein AND_09491 [Anophele 0.891 0.754 0.407 2e-44
403298065260 PREDICTED: dnaJ homolog subfamily C memb 0.887 0.880 0.430 2e-44
321475919287 hypothetical protein DAPPUDRAFT_221714 [ 0.965 0.867 0.414 5e-44
126272757259 PREDICTED: dnaJ homolog subfamily C memb 0.903 0.899 0.431 6e-44
357616149267 DnaJ-like protein 10 [Danaus plexippus] 0.941 0.910 0.400 7e-44
>gi|332019850|gb|EGI60311.1| DnaJ-like protein subfamily C member 9 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 157/251 (62%), Gaps = 25/251 (9%)

Query: 1   MKGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATE-- 58
           M  LL LCE+Y+  ++ Y+VL + KTA  +Q++KA++KLSL+VHPDRV E  KE ATE  
Sbjct: 1   MASLLDLCEQYFGARNFYDVLKIPKTANDKQVKKAYHKLSLLVHPDRVEENIKEEATEKF 60

Query: 59  ----------NDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYE 108
                     +D EKRK+YD++G  ++E +E + +   +W  YW+SL+K++T EDI NYE
Sbjct: 61  KVLGRIHSILSDSEKRKIYDESGQYDEESEEVVMR---NWADYWRSLFKEITVEDINNYE 117

Query: 109 TKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDK 168
             YKGS  EI D KRAY+  +GDMD I E VPFT+  EE R   IIQDLI++ EVP +  
Sbjct: 118 KNYKGSETEIKDLKRAYIDSKGDMDYILEAVPFTNCDEEPRLHAIIQDLIERGEVPEYTT 177

Query: 169 FLNEAKSKRNRRKFEKEEKLFEKEKAKDERRKKS-GVRNSGADSSMDLIAAIQSKNANR- 226
           F NE     N++K ++  + + KE A+ ER +K   + N    ++ DL   IQ++N  R 
Sbjct: 178 FTNE-----NKKKKQRRRRKWAKEAAEAERLEKMLKIENEENAATNDLALVIQNRNKARA 232

Query: 227 ---ESMFNGLI 234
              ES F+ LI
Sbjct: 233 NQAESFFDSLI 243

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156554683|ref|XP_001601586.1| PREDICTED: J domain-containing protein CG6693-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242011852|ref|XP_002426658.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212510822|gb|EEB13920.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307175358|gb|EFN65377.1| J domain-containing protein CG6693 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|378465945|gb|AFC01224.1| DnaJ-10 [Bombyx mori] Back     alignment and taxonomy information
>gi|312378846|gb|EFR25302.1| hypothetical protein AND_09491 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|403298065|ref|XP_003939858.1| PREDICTED: dnaJ homolog subfamily C member 9 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|321475919|gb|EFX86880.1| hypothetical protein DAPPUDRAFT_221714 [Daphnia pulex] Back     alignment and taxonomy information
>gi|126272757|ref|XP_001364158.1| PREDICTED: dnaJ homolog subfamily C member 9-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|357616149|gb|EHJ70033.1| DnaJ-like protein 10 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
UNIPROTKB|F1MTK0261 DNAJC9 "Uncharacterized protei 0.934 0.923 0.375 6.1e-39
ZFIN|ZDB-GENE-040718-130252 dnajc9 "DnaJ (Hsp40) homolog, 0.655 0.670 0.414 8.3e-39
MGI|MGI:1915326259 Dnajc9 "DnaJ (Hsp40) homolog, 0.949 0.945 0.369 1.6e-38
RGD|1305009259 Dnajc9 "DnaJ (Hsp40) homolog, 0.934 0.930 0.373 2.1e-38
UNIPROTKB|Q8WXX5260 DNAJC9 "DnaJ homolog subfamily 0.949 0.942 0.371 4.3e-38
UNIPROTKB|E1C8S9260 DNAJC9 "Uncharacterized protei 0.949 0.942 0.360 6.3e-37
FB|FBgn0037878299 CG6693 [Drosophila melanogaste 0.922 0.795 0.342 2.8e-34
POMBASE|SPAC1071.09c282 SPAC1071.09c "DNAJ domain prot 0.961 0.879 0.316 1.8e-25
CGD|CAL0005200274 orf19.2875 [Candida albicans ( 0.546 0.514 0.351 6.9e-23
TAIR|locus:2082189262 AT3G12170 [Arabidopsis thalian 0.604 0.595 0.383 1.6e-22
UNIPROTKB|F1MTK0 DNAJC9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 416 (151.5 bits), Expect = 6.1e-39, P = 6.1e-39
 Identities = 100/266 (37%), Positives = 143/266 (53%)

Query:     3 GLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATE---- 58
             GLL+LCE+ + T DLY+VL V + A+  +IR+ ++K+SL VHPDRV E DKE AT     
Sbjct:     3 GLLELCEELFGTADLYQVLGVRREASDGEIRRGYHKVSLQVHPDRVGEGDKEDATRRFQI 62

Query:    59 --------NDVEKRKVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETK 110
                     +D E+R +YD+ GT++++ D  +   D DW  YW+ L+K ++ EDI  +E  
Sbjct:    63 LGKVYSVLSDKEQRTLYDEQGTVDEDSD--VLSQDRDWEAYWRLLFKKISLEDIQAFEKT 120

Query:   111 YKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDRYRQIIQDLIDKEEVPAFDKFL 170
             YKGS EE+ D K+AY+  +GDMD I E V     +EE R R IIQ  ID  EVP+++ F+
Sbjct:   121 YKGSEEELTDIKQAYLDFKGDMDQIMESVLCVQYTEEPRIRHIIQQAIDAGEVPSYNAFV 180

Query:   171 NEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVRNSGADSSMDLIAAIQSKNANRESMF 230
              E+                             GV N        L  AIQS+  +R+   
Sbjct:   181 KESKQKMNARKRRAQEEAKEAEMSRKELGLDEGVDN--------LKVAIQSRQKDRQKEM 232

Query:   231 NGLIANLEAKYGGES---GKKETRRQ 253
             +  +A +EAKY   S   GKK T ++
Sbjct:   233 DNFLAQMEAKYCKPSKRGGKKTTLKK 258
GO:0035176 "social behavior" evidence=IEA
ZFIN|ZDB-GENE-040718-130 dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1915326 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305009 Dnajc9 "DnaJ (Hsp40) homolog, subfamily C, member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXX5 DNAJC9 "DnaJ homolog subfamily C member 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8S9 DNAJC9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0037878 CG6693 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
POMBASE|SPAC1071.09c SPAC1071.09c "DNAJ domain protein, DNAJC9 family (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0005200 orf19.2875 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
TAIR|locus:2082189 AT3G12170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WXX5DNJC9_HUMANNo assigned EC number0.42620.88750.8807yesN/A
Q9VGR7Y6693_DROMENo assigned EC number0.37640.91860.7926yesN/A
Q91WN1DNJC9_MOUSENo assigned EC number0.40610.92240.9189yesN/A
Q9UTQ5YL39_SCHPONo assigned EC number0.32230.87980.8049yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 9e-11
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 1e-10
pfam0022663 pfam00226, DnaJ, DnaJ domain 3e-10
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 2e-09
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 2e-08
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-08
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 4e-08
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 5e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 7e-08
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 8e-08
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 1e-07
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 1e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 1e-07
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-07
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-07
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-07
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 4e-07
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 6e-07
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-06
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-06
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 1e-06
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-06
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-06
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-06
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 5e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-06
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 7e-06
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-05
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 8e-05
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-04
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-04
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 4e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 0.002
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 0.003
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 60.7 bits (148), Expect = 9e-11
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 10/69 (14%)

Query: 13 KTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR-VTEED-----KEV--ATE--NDVE 62
            +D YE+L V K A+ E+I+KA+ KL+   HPDR   +++     KE+  A E  +D E
Sbjct: 2  AKRDYYEILGVSKDASEEEIKKAYRKLAKKYHPDRNPGDKEAEEKFKEINEAYEVLSDPE 61

Query: 63 KRKVYDQTG 71
          KR  YDQ G
Sbjct: 62 KRAAYDQFG 70

Length = 371
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
KOG0719|consensus264 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.88
KOG0713|consensus336 99.85
KOG0712|consensus337 99.84
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.81
PRK14296 372 chaperone protein DnaJ; Provisional 99.77
PRK14288 369 chaperone protein DnaJ; Provisional 99.77
PRK14287 371 chaperone protein DnaJ; Provisional 99.75
PRK14286 372 chaperone protein DnaJ; Provisional 99.74
PRK14298 377 chaperone protein DnaJ; Provisional 99.72
PRK14276 380 chaperone protein DnaJ; Provisional 99.72
PRK14285365 chaperone protein DnaJ; Provisional 99.71
PRK14279 392 chaperone protein DnaJ; Provisional 99.71
PRK14294 366 chaperone protein DnaJ; Provisional 99.71
PRK14278 378 chaperone protein DnaJ; Provisional 99.7
PRK14280 376 chaperone protein DnaJ; Provisional 99.7
PRK14301 373 chaperone protein DnaJ; Provisional 99.69
PRK14297 380 chaperone protein DnaJ; Provisional 99.68
PRK14277 386 chaperone protein DnaJ; Provisional 99.68
PRK14282 369 chaperone protein DnaJ; Provisional 99.67
PRK14290 365 chaperone protein DnaJ; Provisional 99.67
PRK10767 371 chaperone protein DnaJ; Provisional 99.66
PRK14283 378 chaperone protein DnaJ; Provisional 99.66
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.65
PRK14281 397 chaperone protein DnaJ; Provisional 99.65
PRK14299291 chaperone protein DnaJ; Provisional 99.65
PRK14295 389 chaperone protein DnaJ; Provisional 99.64
PRK14284 391 chaperone protein DnaJ; Provisional 99.62
KOG0691|consensus296 99.62
PRK14291 382 chaperone protein DnaJ; Provisional 99.61
PRK14300 372 chaperone protein DnaJ; Provisional 99.61
PRK14292 371 chaperone protein DnaJ; Provisional 99.6
KOG0717|consensus 508 99.6
PRK14289 386 chaperone protein DnaJ; Provisional 99.6
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.58
PRK14293 374 chaperone protein DnaJ; Provisional 99.56
KOG0718|consensus 546 99.55
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.54
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 99.53
KOG0716|consensus279 99.49
KOG0715|consensus288 99.47
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.45
PHA03102153 Small T antigen; Reviewed 99.44
KOG0721|consensus230 99.42
PHA02624 647 large T antigen; Provisional 99.36
KOG0624|consensus504 99.35
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.35
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.27
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.17
KOG0722|consensus329 99.16
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.15
KOG0550|consensus486 99.14
KOG0720|consensus490 99.07
KOG0714|consensus306 99.06
PRK01356166 hscB co-chaperone HscB; Provisional 98.97
PRK05014171 hscB co-chaperone HscB; Provisional 98.92
PRK03578176 hscB co-chaperone HscB; Provisional 98.85
PRK00294173 hscB co-chaperone HscB; Provisional 98.81
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.79
PTZ00100116 DnaJ chaperone protein; Provisional 98.76
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.67
KOG1150|consensus250 98.37
PRK01773173 hscB co-chaperone HscB; Provisional 98.04
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 97.58
KOG1789|consensus 2235 97.13
KOG0568|consensus342 96.94
KOG0723|consensus112 96.58
KOG0431|consensus453 94.8
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 93.84
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 81.98
>KOG0719|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.6e-56  Score=387.86  Aligned_cols=227  Identities=41%  Similarity=0.678  Sum_probs=203.7

Q ss_pred             cchHHHHHHHhcCCCcchhcCCCCCCCHHHHHHHHHHHHHhhCCCCCCChhHHHhcc------------cCHHHHHhhhh
Q psy16499          2 KGLLQLCEKYYKTKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKEVATE------------NDVEKRKVYDQ   69 (258)
Q Consensus         2 m~ll~~~~~~~~~~d~YevLGV~~~As~~eIKkAYrklaLk~HPDK~~~~~k~~a~~------------sD~~kR~~YD~   69 (258)
                      |.+|..|...|.+.|+|+||||.++||+.+|++|||+|||+||||++++....+++.            ||.++|++||+
T Consensus         1 ~~~l~~~~~~f~~~d~YevLGVer~a~~~eIrkAY~klal~~HPDk~~eed~~ea~~kFq~l~k~y~iLsDeekR~~YDe   80 (264)
T KOG0719|consen    1 QFSLEECTGSFNKKDLYEVLGVERDATDKEIRKAYHKLALRLHPDKNHEEDKVEATEKFQQLQKAYQILSDEEKRAVYDE   80 (264)
T ss_pred             CcchhhccccccccCHHHHhhhcccCCHHHHHHHHHHHHHHhCCCcchhhhHHHHHHHHHHHHHHHHHhhHHHHHHHHhc
Confidence            456788999999999999999999999999999999999999999998655544443            99999999999


Q ss_pred             cCCCCCCCCcccccCCCCHHHHHHhhcCCCCHHHHHHHHHHccCchHHHHHHHHHhhcCCCCccchhhcccCCCCchHHH
Q psy16499         70 TGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAEEINDFKRAYVQGEGDMDLIFELVPFTHPSEEDR  149 (258)
Q Consensus        70 ~G~~~~~~~~~~~~~~~~~~~~f~~~F~~vt~edi~~F~~~Y~gs~eE~~dl~~~y~~~~G~~~~i~~~v~c~~~~de~R  149 (258)
                      +|..++..    .+-..+|.++|+.+|..||.++|++|...|+||++|+.||..+|++++|+|+.|++.|+|+.++|++|
T Consensus        81 tG~idd~~----~d~~~~~~e~~~~iyk~VteedIeef~a~Y~gSEeEk~Dl~~~Y~k~kG~m~~i~~~~l~~d~~De~R  156 (264)
T KOG0719|consen   81 TGSIDDES----GDIDEDWLEFWRAIYKKVTEEDIEEFEANYQGSEEEKKDLLKLYNKFKGKMNRILESVLCSDPKDEDR  156 (264)
T ss_pred             cCCCCCcc----chhhhHHHHHHHHHHhhcccccHHHHHHHhcccHHHHHHHHHHHHhcCChHHHHHHhhhcCCcccHHH
Confidence            99998642    22458999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCcchHHhHHHHHHHHHHHHHHHHHHHHHHHHhhhHHHHhccCCCCCCCChHHHHHHHHHHhhchhhh
Q psy16499        150 YRQIIQDLIDKEEVPAFDKFLNEAKSKRNRRKFEKEEKLFEKEKAKDERRKKSGVRNSGADSSMDLIAAIQSKNANRESM  229 (258)
Q Consensus       150 ~~~ii~~~i~~g~v~~~~~f~~~~~~~~~~r~~k~~~e~keae~~~~~~~k~~~~~~~~~~~~~~L~~~i~~r~~~r~~~  229 (258)
                      |++||+.||++|+|+.|++|+++++++ +.|..+.++|.++|+++.      ++      .+..+|.++|++|+..|...
T Consensus       157 ~keiid~~I~~Gev~~yK~y~~~~~~~-K~r~~~~~re~r~ak~~~------~~------~~~~DL~~~i~~r~~eRk~~  223 (264)
T KOG0719|consen  157 FKEIIDEAIADGEVKKYKAYEKWASEK-KMRAPKKAREKREAKVLA------AK------DNGIDLDAMIEKRGGERKGK  223 (264)
T ss_pred             HHHHHHHHHhcCCchhhhhcccchhhh-hhccccchHHHHHHHHHH------HH------hcCccHHHHHHHHhhhhhhh
Confidence            999999999999999999999998776 666677778888887754      22      24568999999999999999


Q ss_pred             HHHHHHHHHHhhCCCC
Q psy16499        230 FNGLIANLEAKYGGES  245 (258)
Q Consensus       230 ~~~~~~~Le~KY~~~~  245 (258)
                      |+|||++|++||++..
T Consensus       224 ~~sl~~SL~~kY~~~~  239 (264)
T KOG0719|consen  224 FDSLLDSLEEKYGGNA  239 (264)
T ss_pred             HHHHHHHHHHHhcccc
Confidence            9999999999998753

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-06
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 7e-06
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 7e-06
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 8e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 1e-05
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 2e-05
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-05
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-05
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-04
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-04
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 7e-04
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 40/68 (58%), Gaps = 9/68 (13%)
Query: 14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDR-----VTEEDKEVATE----NDVEKR 64
          + D YE+L V + A+ E ++KA+ +L+L  HPD+      TE  K + T     ++ EKR
Sbjct: 6  SGDYYEILGVSRGASDEDLKKAYRRLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKR 65
Query: 65 KVYDQTGT 72
          K YDQ G+
Sbjct: 66 KQYDQFGS 73
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 3e-11
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 8e-11
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 2e-10
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 2e-10
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-10
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 2e-10
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 2e-10
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-10
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 5e-10
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 5e-10
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 5e-10
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 8e-10
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 9e-10
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 9e-10
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-09
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-09
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-09
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 4e-09
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 7e-09
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 1e-08
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-08
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 4e-08
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-05
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
 Score = 61.5 bits (150), Expect = 3e-11
 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 9/66 (13%)

Query: 15 KDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEED-----KEVATENDV----EKRK 65
          KD Y +L V  T   + I+ A+ +L+   HPD   E D     K++A   +V    ++R 
Sbjct: 28 KDYYAILGVQPTDDLKTIKTAYRRLARKYHPDVSKENDAEAKFKDLAEAWEVLKDEQRRA 87

Query: 66 VYDQTG 71
           YDQ  
Sbjct: 88 EYDQLW 93
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.71
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.68
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.68
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.68
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.65
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.65
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.64
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.64
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.63
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.62
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.62
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.61
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.58
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.58
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.57
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.57
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.56
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.56
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.55
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.52
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.5
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.45
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.44
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.37
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.36
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.33
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.33
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.31
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.28
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.22
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.2
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.14
2guz_A71 Mitochondrial import inner membrane translocase su 99.1
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.41
2guz_B65 Mitochondrial import inner membrane translocase su 98.3
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 81.16
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
Probab=99.71  E-value=7.5e-18  Score=130.63  Aligned_cols=84  Identities=35%  Similarity=0.547  Sum_probs=54.6

Q ss_pred             CCCcchhcCCCCCCCHHHHHHHHHHHHHhhCCCCCCChh-H-------HHhcc--cCHHHHHhhhhcCCCCCCCCc---c
Q psy16499         14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEED-K-------EVATE--NDVEKRKVYDQTGTLEDEDDE---A   80 (258)
Q Consensus        14 ~~d~YevLGV~~~As~~eIKkAYrklaLk~HPDK~~~~~-k-------~~a~~--sD~~kR~~YD~~G~~~~~~~~---~   80 (258)
                      ..|||+||||+++||..+||+|||+|+++||||+++..+ .       .+|++  +||.+|..||.+|..+...++   .
T Consensus         2 ~~~~y~iLgv~~~as~~eIk~ayr~l~~~~HPDk~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~~~~~~~~~~~~~~   81 (103)
T 1bq0_A            2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMGGG   81 (103)
T ss_dssp             CCCSTTTTSSCSSCCHHHHHHHHHHHHTTTCTTTCTTTCTHHHHHHHHTTTTTSTTCSHHHHHTTTSTTTSSCSCC----
T ss_pred             CCCHHHHcCcCCCCCHHHHHHHHHHHHHHHCcCCCCCcHHHHHHHHHHHHHHHHHCCHHHHHHHHHHhhhhhcccCcCCC
Confidence            479999999999999999999999999999999997532 1       12333  999999999999988765311   1


Q ss_pred             cccCCCCHHHHHHhhcC
Q psy16499         81 IFKSDIDWTMYWKSLYK   97 (258)
Q Consensus        81 ~~~~~~~~~~~f~~~F~   97 (258)
                      +++...++.++|..+|+
T Consensus        82 ~~~~~~~~~~~f~~~f~   98 (103)
T 1bq0_A           82 GFGGGADFSDIFGDVFG   98 (103)
T ss_dssp             -----------------
T ss_pred             CCCCCCCHHHHHHHHHH
Confidence            11112245566666665
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-09
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 6e-07
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 6e-07
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-06
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 2e-05
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 7e-05
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 0.001
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 0.004
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Simian virus 40, Sv40 [TaxId: 10633]

 Score = 50.2 bits (119), Expect = 8e-09
 Identities = 22/112 (19%), Positives = 42/112 (37%), Gaps = 13/112 (11%)

Query: 13  KTKDLYEVLNVDKTA--TPEQIRKAFYKLSLVVHPDRVTEEDKEVATE------NDVEKR 64
           ++  L ++L ++++A      +RKA+ K     HPD+  +E+K            D  K 
Sbjct: 6   ESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKY 65

Query: 65  KVYDQTGTLEDEDDEAIFKSDIDWTMYWKSLYKDVTEEDIINYETKYKGSAE 116
                 G   D  +   + +D      W+  +    EE++   E       E
Sbjct: 66  AHQPDFGGFWDATEIPTYGTD-----EWEQWWNAFNEENLFCSEEMPSSDDE 112
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.76
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.72
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.58
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.44
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.34
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.31
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.19
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.76  E-value=3.1e-19  Score=129.47  Aligned_cols=62  Identities=42%  Similarity=0.634  Sum_probs=53.3

Q ss_pred             CCCcchhcCCCCCCCHHHHHHHHHHHHHhhCCCCCCChhHH--------Hhcc--cCHHHHHhhhhcCCCCC
Q psy16499         14 TKDLYEVLNVDKTATPEQIRKAFYKLSLVVHPDRVTEEDKE--------VATE--NDVEKRKVYDQTGTLED   75 (258)
Q Consensus        14 ~~d~YevLGV~~~As~~eIKkAYrklaLk~HPDK~~~~~k~--------~a~~--sD~~kR~~YD~~G~~~~   75 (258)
                      ..|||+||||+++||..+||+|||+++++||||++++++..        +|+.  +||.+|..||.+|..+.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~~~   73 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAF   73 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTSSC
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcccc
Confidence            47999999999999999999999999999999999765321        2333  99999999999997664
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure