Psyllid ID: psy16546


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
cEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHHHHcccccEEEcccccccHHHHcccHHHHHHHccccccccHHHHHc
cEEEEcccccccccccEEcEEEHHHHHHHHHHHHHHHccccccEEEEEEcccccEEHHHHHHHHHHHHcccccEEEEccccccccEEcEccHHHHHHccccccccHHHHHH
mitvfgadygtedgtgirDYIHVMDLAVGHVAALNKLQGEHLKIKfynlgtgqgtSVLQLLRTFErvtgkpvpyIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
mitvfgadygtedgTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTfervtgkpvpyiveARREGDIVSMYANTDLaqrelgwsarctvekmck
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
**TVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTV*****
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q14376348 UDP-glucose 4-epimerase O yes N/A 0.981 0.313 0.581 1e-32
P18645347 UDP-glucose 4-epimerase O no N/A 0.981 0.314 0.572 3e-32
Q5R8D0348 UDP-glucose 4-epimerase O yes N/A 0.981 0.313 0.572 4e-32
Q8R059347 UDP-glucose 4-epimerase O yes N/A 0.981 0.314 0.572 5e-32
Q9T0A7350 UDP-glucose 4-epimerase 3 yes N/A 0.990 0.314 0.545 9e-32
O65781350 UDP-glucose 4-epimerase G N/A N/A 0.990 0.314 0.527 4e-31
Q9SN58351 UDP-glucose 4-epimerase 2 no N/A 0.990 0.313 0.527 1e-30
Q42605351 UDP-glucose 4-epimerase 1 no N/A 0.990 0.313 0.522 6e-29
O65780354 UDP-glucose 4-epimerase G N/A N/A 0.990 0.310 0.522 9e-29
P55180339 UDP-glucose 4-epimerase O yes N/A 0.972 0.318 0.541 6e-28
>sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 Back     alignment and function desciption
 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 1/110 (0%)

Query: 2   ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
           + VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E    + YNLGTG G SVLQ++
Sbjct: 223 LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMV 281

Query: 62  RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
           +  E+ +GK +PY V ARREGD+ + YAN  LAQ ELGW+A   +++MC+
Sbjct: 282 QAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331




Catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 1EC: .EC: 3EC: .EC: 2
>sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 Back     alignment and function description
>sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 Back     alignment and function description
>sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=2 SV=1 Back     alignment and function description
>sp|Q9T0A7|GALE3_ARATH UDP-glucose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g23920 PE=2 SV=1 Back     alignment and function description
>sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 Back     alignment and function description
>sp|Q9SN58|GALE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=At4g10960 PE=2 SV=3 Back     alignment and function description
>sp|Q42605|GALE1_ARATH UDP-glucose 4-epimerase 1 OS=Arabidopsis thaliana GN=At1g12780 PE=1 SV=2 Back     alignment and function description
>sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 Back     alignment and function description
>sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
307172266 344 UDP-glucose 4-epimerase [Camponotus flor 0.990 0.319 0.681 3e-41
332022429 364 Putative UDP-glucose 4-epimerase [Acromy 0.990 0.302 0.681 4e-41
307197296 364 UDP-glucose 4-epimerase [Harpegnathos sa 0.990 0.302 0.690 5e-41
322796795 364 hypothetical protein SINV_11980 [Solenop 0.981 0.299 0.678 8e-41
48105285 363 PREDICTED: probable UDP-glucose 4-epimer 0.990 0.303 0.672 4e-40
380027263 363 PREDICTED: probable UDP-glucose 4-epimer 0.990 0.303 0.663 7e-40
383863089 364 PREDICTED: probable UDP-glucose 4-epimer 0.990 0.302 0.663 2e-39
242017036 384 UDP-glucose 4-epimerase, putative [Pedic 0.990 0.286 0.663 5e-39
340720162 364 PREDICTED: probable UDP-glucose 4-epimer 0.990 0.302 0.663 6e-39
156539983 360 PREDICTED: probable UDP-glucose 4-epimer 0.990 0.305 0.645 3e-38
>gi|307172266|gb|EFN63771.1| UDP-glucose 4-epimerase [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  172 bits (435), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%)

Query: 2   ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
           + +FG DY T DGTG+RDYIHVMDLA GHVAALN L  +HL++K YNLGTG G +VL+L+
Sbjct: 206 LLIFGGDYATNDGTGVRDYIHVMDLAAGHVAALNALHKQHLRLKIYNLGTGNGVTVLELI 265

Query: 62  RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
           +TFE+VTG  VPYI++ RREGDIVSMYANTDLA++ELGW+A+  VE+MC+
Sbjct: 266 KTFEKVTGTTVPYIIKERREGDIVSMYANTDLAKKELGWTAKYNVEQMCQ 315




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332022429|gb|EGI62737.1| Putative UDP-glucose 4-epimerase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307197296|gb|EFN78588.1| UDP-glucose 4-epimerase [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322796795|gb|EFZ19222.1| hypothetical protein SINV_11980 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|48105285|ref|XP_393006.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380027263|ref|XP_003697348.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Apis florea] Back     alignment and taxonomy information
>gi|383863089|ref|XP_003707015.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242017036|ref|XP_002428999.1| UDP-glucose 4-epimerase, putative [Pediculus humanus corporis] gi|212513845|gb|EEB16261.1| UDP-glucose 4-epimerase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340720162|ref|XP_003398512.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Bombus terrestris] gi|350408358|ref|XP_003488377.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|156539983|ref|XP_001602357.1| PREDICTED: probable UDP-glucose 4-epimerase-like isoform 1 [Nasonia vitripennis] gi|345496979|ref|XP_003427868.1| PREDICTED: probable UDP-glucose 4-epimerase-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
UNIPROTKB|Q14376348 GALE "UDP-glucose 4-epimerase" 0.981 0.313 0.581 1.6e-31
UNIPROTKB|Q3T105348 GALE "Uncharacterized protein" 0.990 0.316 0.576 2e-31
UNIPROTKB|I3LL84348 GALE "Uncharacterized protein" 0.981 0.313 0.581 2e-31
RGD|621493347 Gale "UDP-galactose-4-epimeras 0.981 0.314 0.572 4.2e-31
UNIPROTKB|Q4QRB0348 Gale "Gale protein" [Rattus no 0.981 0.313 0.572 4.2e-31
MGI|MGI:1921496347 Gale "galactose-4-epimerase, U 0.981 0.314 0.572 6.9e-31
TAIR|locus:2138121350 UGE2 "UDP-D-glucose/UDP-D-gala 0.990 0.314 0.545 1.1e-30
UNIPROTKB|F1NWE5351 GALE "Uncharacterized protein" 0.981 0.310 0.563 2.3e-30
UNIPROTKB|F1PI88348 GALE "Uncharacterized protein" 0.990 0.316 0.549 6.2e-30
TAIR|locus:2123466351 UGE5 "UDP-D-glucose/UDP-D-gala 0.990 0.313 0.527 1e-29
UNIPROTKB|Q14376 GALE "UDP-glucose 4-epimerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 1.6e-31, P = 1.6e-31
 Identities = 64/110 (58%), Positives = 83/110 (75%)

Query:     2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
             + VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E    + YNLGTG G SVLQ++
Sbjct:   223 LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMV 281

Query:    62 RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
             +  E+ +GK +PY V ARREGD+ + YAN  LAQ ELGW+A   +++MC+
Sbjct:   282 QAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331




GO:0000166 "nucleotide binding" evidence=IEA
GO:0044237 "cellular metabolic process" evidence=IEA
GO:0050662 "coenzyme binding" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0003978 "UDP-glucose 4-epimerase activity" evidence=EXP;IDA
GO:0019388 "galactose catabolic process" evidence=IDA;TAS
GO:0005829 "cytosol" evidence=TAS
GO:0005975 "carbohydrate metabolic process" evidence=TAS
GO:0044281 "small molecule metabolic process" evidence=TAS
UNIPROTKB|Q3T105 GALE "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL84 GALE "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|621493 Gale "UDP-galactose-4-epimerase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4QRB0 Gale "Gale protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1921496 Gale "galactose-4-epimerase, UDP" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2138121 UGE2 "UDP-D-glucose/UDP-D-galactose 4-epimerase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWE5 GALE "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI88 GALE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2123466 UGE5 "UDP-D-glucose/UDP-D-galactose 4-epimerase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P55180GALE_BACSU5, ., 1, ., 3, ., 20.54120.97290.3185yesN/A
Q5R8D0GALE_PONAB5, ., 1, ., 3, ., 20.57270.98190.3132yesN/A
Q9T0A7GALE3_ARATH5, ., 1, ., 3, ., 20.54540.99090.3142yesN/A
Q8R059GALE_MOUSE5, ., 1, ., 3, ., 20.57270.98190.3141yesN/A
Q14376GALE_HUMAN5, ., 1, ., 3, ., 20.58180.98190.3132yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
cd05247323 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, 3e-53
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 7e-51
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envel 2e-48
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase GalE 9e-41
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro 3e-37
pfam1395062 pfam13950, Epimerase_Csub, UDP-glucose 4-epimerase 2e-22
cd05256304 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e 5e-14
cd05264300 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase 1e-13
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimer 1e-10
cd05253332 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera 9e-10
cd05258337 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e 1e-07
cd05246315 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra 5e-07
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd 7e-06
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel 9e-06
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 1e-04
cd05228318 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr 7e-04
cd05260316 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase 0.001
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimera 0.002
cd05252336 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata 0.004
>gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs Back     alignment and domain information
 Score =  168 bits (429), Expect = 3e-53
 Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 2   ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
           + +FG DY T DGT +RDYIHV+DLA  HV AL KL+      + YNLGTG+G SVL+++
Sbjct: 208 LAIFGDDYPTPDGTCVRDYIHVVDLADAHVLALEKLE-NGGGSEIYNLGTGRGYSVLEVV 266

Query: 62  RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
             FE+V+GKP+PY +  RR GD  S+ A+   A+ ELGW  +  +E MC+
Sbjct: 267 EAFEKVSGKPIPYEIAPRRAGDPASLVADPSKAREELGWKPKRDLEDMCE 316


UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 323

>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|206121 pfam13950, Epimerase_Csub, UDP-glucose 4-epimerase C-term subunit Back     alignment and domain information
>gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.94
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.89
PLN02166436 dTDP-glucose 4,6-dehydratase 99.85
KOG1429|consensus350 99.85
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.84
PLN02206442 UDP-glucuronate decarboxylase 99.84
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.84
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.84
PLN02653340 GDP-mannose 4,6-dehydratase 99.83
PLN02240352 UDP-glucose 4-epimerase 99.83
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.8
KOG0747|consensus331 99.78
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.78
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.78
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.78
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.78
PLN02427386 UDP-apiose/xylose synthase 99.77
PLN00016378 RNA-binding protein; Provisional 99.75
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.75
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.75
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.75
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.74
KOG1371|consensus343 99.74
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.73
PLN02572442 UDP-sulfoquinovose synthase 99.72
PLN02260 668 probable rhamnose biosynthetic enzyme 99.72
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.68
KOG1431|consensus315 99.64
PLN02214342 cinnamoyl-CoA reductase 99.61
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.57
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.56
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.56
PLN02686367 cinnamoyl-CoA reductase 99.55
PRK05865 854 hypothetical protein; Provisional 99.53
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.53
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 99.53
PLN02650351 dihydroflavonol-4-reductase 99.52
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.5
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 99.49
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.47
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.46
PLN02896353 cinnamyl-alcohol dehydrogenase 99.44
PLN00198338 anthocyanidin reductase; Provisional 99.44
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 99.38
CHL00194317 ycf39 Ycf39; Provisional 99.38
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.33
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 99.29
KOG1372|consensus376 99.21
PF1395062 Epimerase_Csub: UDP-glucose 4-epimerase C-term sub 99.18
PLN02778298 3,5-epimerase/4-reductase 99.01
KOG3019|consensus315 99.01
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 99.01
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.95
KOG1502|consensus327 98.94
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.93
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.9
PRK07201 657 short chain dehydrogenase; Provisional 98.89
PLN02996491 fatty acyl-CoA reductase 98.89
PLN02583297 cinnamoyl-CoA reductase 98.88
PRK12320 699 hypothetical protein; Provisional 98.81
KOG1430|consensus361 98.77
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.75
PLN02260668 probable rhamnose biosynthetic enzyme 98.46
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.23
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.85
KOG2865|consensus391 97.73
PLN02503605 fatty acyl-CoA reductase 2 97.57
KOG2774|consensus366 97.49
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.4
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 96.68
PRK07074257 short chain dehydrogenase; Provisional 96.53
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.51
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.96
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.81
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 95.58
PRK05875276 short chain dehydrogenase; Provisional 94.91
PRK06482276 short chain dehydrogenase; Provisional 94.79
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.29
PRK07067257 sorbitol dehydrogenase; Provisional 94.28
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.22
PRK06194287 hypothetical protein; Provisional 93.96
PRK07806248 short chain dehydrogenase; Provisional 93.74
KOG1221|consensus467 92.78
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 92.59
PRK08324681 short chain dehydrogenase; Validated 91.22
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 90.88
PRK07775274 short chain dehydrogenase; Provisional 90.75
PRK12935247 acetoacetyl-CoA reductase; Provisional 90.59
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.11
PRK08263275 short chain dehydrogenase; Provisional 89.64
PRK12829264 short chain dehydrogenase; Provisional 89.1
PRK09135249 pteridine reductase; Provisional 88.68
PRK06914280 short chain dehydrogenase; Provisional 88.46
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 86.32
PRK05876275 short chain dehydrogenase; Provisional 85.5
PRK12828239 short chain dehydrogenase; Provisional 85.27
PRK12746254 short chain dehydrogenase; Provisional 83.99
PRK07060245 short chain dehydrogenase; Provisional 83.34
PRK07774250 short chain dehydrogenase; Provisional 83.24
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 81.8
PRK09134258 short chain dehydrogenase; Provisional 81.43
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
Probab=99.94  E-value=4.9e-26  Score=149.55  Aligned_cols=109  Identities=42%  Similarity=0.724  Sum_probs=101.6

Q ss_pred             eeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCCC
Q psy16546          2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARRE   81 (111)
Q Consensus         2 ~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~   81 (111)
                      +.|||.++.+.||+..||||||.|+|+|+++|++...+.. ...+||+++|..+|..|+++.+.+..|++.+.+..|.|+
T Consensus       206 l~ifG~DY~T~DGT~iRDYIHV~DLA~aH~~Al~~L~~~g-~~~~~NLG~G~G~SV~evi~a~~~vtg~~ip~~~~~RR~  284 (329)
T COG1087         206 LFIFGDDYDTKDGTCIRDYIHVDDLADAHVLALKYLKEGG-SNNIFNLGSGNGFSVLEVIEAAKKVTGRDIPVEIAPRRA  284 (329)
T ss_pred             eEEeCCCCCCCCCCeeeeeeehhHHHHHHHHHHHHHHhCC-ceeEEEccCCCceeHHHHHHHHHHHhCCcCceeeCCCCC
Confidence            6899999999999999999999999999999999875433 447999999999999999999999999999999999999


Q ss_pred             CccchhccCHHHHHHhhCCCccc-chHhhhC
Q psy16546         82 GDIVSMYANTDLAQRELGWSARC-TVEKMCK  111 (111)
Q Consensus        82 ~~~~~~~~d~~k~~~~lg~~p~~-~~~~~l~  111 (111)
                      +++...+.|++|+++.|||+|++ ++++.++
T Consensus       285 GDpa~l~Ad~~kA~~~Lgw~p~~~~L~~ii~  315 (329)
T COG1087         285 GDPAILVADSSKARQILGWQPTYDDLEDIIK  315 (329)
T ss_pred             CCCceeEeCHHHHHHHhCCCcccCCHHHHHH
Confidence            99999999999999999999999 8988763



>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG3019|consensus Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1ek5_A348 Structure Of Human Udp-Galactose 4-Epimerase In Com 8e-34
1i3k_A348 Molecular Basis For Severe Epimerase-Deficiency Gal 9e-34
1hzj_A348 Human Udp-Galactose 4-Epimerase: Accommodation Of U 9e-34
3enk_A341 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase F 1e-28
1a9z_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-26
1lrj_A338 Crystal Structure Of E. Coli Udp-Galactose 4-Epimer 2e-26
1kvq_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
1kvs_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
1kvu_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
2udp_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
1kvr_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
1a9y_A338 Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX 2e-26
1lrk_A338 Crystal Structure Of Escherichia Coli Udp-Galactose 2e-26
1kvt_A338 Udp-Galactose 4-Epimerase Complexed With Udp-Phenol 2e-26
1z45_A 699 Crystal Structure Of The Gal10 Fusion Protein Galac 2e-23
1gy8_A397 Trypanosoma Brucei Udp-Galactose 4' Epimerase Lengt 1e-18
2c20_A330 Crystal Structure Of Udp-Glucose 4-Epimerase Length 4e-18
2p5u_A311 Crystal Structure Of Thermus Thermophilus Hb8 Udp-G 1e-04
>pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimerase In Complex With Nad+ Length = 348 Back     alignment and structure

Iteration: 1

Score = 138 bits (347), Expect = 8e-34, Method: Compositional matrix adjust. Identities = 64/110 (58%), Positives = 83/110 (75%), Gaps = 1/110 (0%) Query: 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61 + VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E + YNLGTG G SVLQ++ Sbjct: 223 LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMV 281 Query: 62 RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111 + E+ +GK +PY V ARREGD+ + YAN LAQ ELGW+A +++MC+ Sbjct: 282 QAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331
>pdb|1I3K|A Chain A, Molecular Basis For Severe Epimerase-Deficiency Galactosemia: X-Ray Structure Of The Human V94m- Substituted Udp-Galactose 4-Epimerase Length = 348 Back     alignment and structure
>pdb|1HZJ|A Chain A, Human Udp-Galactose 4-Epimerase: Accommodation Of Udp-N- Acetylglucosamine Within The Active Site Length = 348 Back     alignment and structure
>pdb|3ENK|A Chain A, 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase From Burkholderia Pseudomallei Length = 341 Back     alignment and structure
>pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 Back     alignment and structure
>pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 Back     alignment and structure
>pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 Back     alignment and structure
>pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 Back     alignment and structure
>pdb|1Z45|A Chain A, Crystal Structure Of The Gal10 Fusion Protein Galactose MutarotaseUDP-Galactose 4-Epimerase From Saccharomyces Cerevisiae Complexed With Nad, Udp-Glucose, And Galactose Length = 699 Back     alignment and structure
>pdb|1GY8|A Chain A, Trypanosoma Brucei Udp-Galactose 4' Epimerase Length = 397 Back     alignment and structure
>pdb|2C20|A Chain A, Crystal Structure Of Udp-Glucose 4-Epimerase Length = 330 Back     alignment and structure
>pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 2e-62
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 2e-62
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 3e-62
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 2e-59
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 7e-56
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 8e-54
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 2e-39
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 2e-39
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 1e-30
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 5e-28
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 3e-21
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 4e-21
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 1e-20
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 6e-18
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 1e-16
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 2e-16
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 2e-16
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 3e-16
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 6e-15
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 5e-14
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 2e-13
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 1e-09
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 1e-09
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 9e-09
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 1e-08
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 2e-05
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1e-04
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 4e-04
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 Back     alignment and structure
 Score =  192 bits (490), Expect = 2e-62
 Identities = 64/109 (58%), Positives = 82/109 (75%), Gaps = 1/109 (0%)

Query: 3   TVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLR 62
            VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E    + YNLGTG G SVLQ+++
Sbjct: 224 NVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMVQ 282

Query: 63  TFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
             E+ +GK +PY V ARREGD+ + YAN  LAQ ELGW+A   +++MC+
Sbjct: 283 AMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331


>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.87
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.84
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.83
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.83
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.83
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.82
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.81
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.81
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.8
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.8
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.8
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.8
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.79
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.78
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.78
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.78
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.78
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.77
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.77
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.76
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.76
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.75
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.75
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.75
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.75
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.74
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.74
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.74
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.73
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.73
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.73
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.72
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.72
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.72
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.72
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.72
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.71
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.7
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.7
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 99.69
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.66
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.66
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.66
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.65
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.62
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.62
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.61
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.6
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.58
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.58
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.58
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.57
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.5
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.48
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.47
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.47
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.45
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.36
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.32
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.3
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.29
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.12
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.1
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.95
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.86
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.85
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.83
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.8
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.8
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.79
4f6c_A427 AUSA reductase domain protein; thioester reductase 98.68
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 98.6
4f6l_B508 AUSA reductase domain protein; thioester reductase 98.58
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 98.49
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.46
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 98.45
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 98.21
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.17
1xq6_A253 Unknown protein; structural genomics, protein stru 98.15
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 98.09
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.96
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.45
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 97.41
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 97.12
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.06
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 96.82
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.36
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.18
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 95.95
1spx_A278 Short-chain reductase family member (5L265); paral 95.84
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 95.46
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 95.33
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.2
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 94.63
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 94.54
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 94.21
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 93.49
3qlj_A322 Short chain dehydrogenase; structural genomics, se 93.42
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 92.92
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 92.4
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 92.38
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 92.36
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 91.94
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 91.75
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 91.51
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 91.13
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 91.13
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 90.92
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 90.17
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 90.01
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 89.78
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 89.7
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 89.54
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 89.5
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 89.38
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 89.3
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 89.22
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 88.37
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 88.18
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 88.13
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 87.67
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 87.57
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 87.43
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 87.3
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 87.16
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 86.48
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 86.41
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 86.11
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 85.99
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 85.45
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 85.27
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 85.15
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 85.1
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 84.78
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 84.44
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.15
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 83.95
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 83.87
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 83.87
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 83.85
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 83.72
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 83.64
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 83.29
4dqx_A277 Probable oxidoreductase protein; structural genomi 83.22
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 82.91
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 82.84
3tox_A280 Short chain dehydrogenase; structural genomics, PS 82.61
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 82.29
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 82.17
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 82.1
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 81.84
1xhl_A297 Short-chain dehydrogenase/reductase family member 81.78
3edm_A259 Short chain dehydrogenase; structural genomics, ox 81.7
4e4y_A244 Short chain dehydrogenase family protein; structur 81.57
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 81.32
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 81.08
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 80.92
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 80.47
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
Probab=99.87  E-value=1.1e-21  Score=131.45  Aligned_cols=109  Identities=51%  Similarity=0.920  Sum_probs=96.1

Q ss_pred             eeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCCC
Q psy16546          2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARRE   81 (111)
Q Consensus         2 ~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~   81 (111)
                      +.++|....+++|++.|+|+|++|+|++++.++++..... .+++||+++++.+|+.|+++.+.+.+|.+.++...+.++
T Consensus       219 ~~~~g~~~~~~~g~~~~~~i~v~Dva~a~~~~~~~~~~~~-~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~  297 (341)
T 3enk_A          219 LRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRD-ASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRP  297 (341)
T ss_dssp             EEEECSCSSSTTSSCEECEEEHHHHHHHHHHHHHHHHHHT-SCEEEEESCSCCEEHHHHHHHHHHHHCSCCCEEEECCCT
T ss_pred             eEEeCCccCCCCCCeeEeeEEHHHHHHHHHHHHHhhhcCC-cceEEEeCCCCceeHHHHHHHHHHHhCCCcceeeCCCCC
Confidence            4566766777799999999999999999999998732134 689999999999999999999999999998888888888


Q ss_pred             CccchhccCHHHHHHhhCCCcccchHhhhC
Q psy16546         82 GDIVSMYANTDLAQRELGWSARCTVEKMCK  111 (111)
Q Consensus        82 ~~~~~~~~d~~k~~~~lg~~p~~~~~~~l~  111 (111)
                      .+.....+|++|+++.|||+|.++++++|+
T Consensus       298 ~~~~~~~~d~~k~~~~lG~~p~~~l~~~l~  327 (341)
T 3enk_A          298 GDVAECYANPAAAAETIGWKAERDLERMCA  327 (341)
T ss_dssp             TCCSEECBCCHHHHHHHCCCCCCCHHHHHH
T ss_pred             CCccccccCHHHHHHHcCCCCCCCHHHHHH
Confidence            888888899999999999999999999873



>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 111
d1gy8a_383 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 8e-27
d1ek6a_346 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 1e-23
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 2e-23
d1z45a2347 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep 2e-19
d2b69a1312 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 2e-18
d1r6da_322 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-17
d1orra_338 c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella 8e-17
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 1e-16
d1sb8a_341 c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W 7e-13
d2c5aa1363 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T 1e-12
d1rpna_321 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo 3e-12
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 6e-11
d1y1pa1342 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo 2e-10
d1e6ua_315 c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras 4e-10
d1oc2a_346 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 9e-10
d1t2aa_347 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H 1e-07
d1xgka_350 c.2.1.2 (A:) Negative transcriptional regulator Nm 2e-06
d1qyda_312 c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { 2e-06
d1n7ha_339 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr 3e-06
d1i24a_393 c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 5e-06
d1rkxa_356 c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia 3e-05
d2q46a1252 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( 5e-05
d2blla1342 c.2.1.2 (A:316-657) Polymyxin resistance protein A 5e-04
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase)
species: Trypanosoma brucei [TaxId: 5691]
 Score = 99.5 bits (246), Expect = 8e-27
 Identities = 42/112 (37%), Positives = 62/112 (55%), Gaps = 5/112 (4%)

Query: 2   ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKF-----YNLGTGQGTS 56
           + +FG DY T DGT +RDY+HV DLA  H+ AL+ ++      K      +NLGT +G S
Sbjct: 254 MPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDYVEKLGPNDKSKYFSVFNLGTSRGYS 313

Query: 57  VLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEK 108
           V +++    + TG P+P     RREGD   + A +D A+  LGW  +    +
Sbjct: 314 VREVIEVARKTTGHPIPVRECGRREGDPAYLVAASDKAREVLGWKPKYDTLE 365


>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.89
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.88
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.86
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.86
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.86
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.83
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.83
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.83
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.82
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.81
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.8
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.79
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.78
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.76
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.73
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.68
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 99.68
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.67
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.64
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 99.62
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.53
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.42
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 99.25
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 99.04
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 99.03
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.4
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.1
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.86
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 93.46
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 93.09
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89  E-value=3.9e-23  Score=137.44  Aligned_cols=110  Identities=57%  Similarity=1.020  Sum_probs=100.1

Q ss_pred             CeeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCC
Q psy16546          1 MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARR   80 (111)
Q Consensus         1 ~~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~   80 (111)
                      ++.++|.+..+.+|.+.|||+|++|+|+++..++....... .+++||+++++.+|+.|+++.+.+.++.+.+....|.+
T Consensus       222 ~i~i~g~~~~~~~g~~~Rdfi~v~D~a~~~~~~~~~~~~~~-~~~i~Ni~~~~~~s~~dl~~~i~~~~~~~~~~~~~~~~  300 (346)
T d1ek6a_         222 ALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQC-GCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR  300 (346)
T ss_dssp             CEEEECSCSSSSSSSCEECEEEHHHHHHHHHHHHHHHTTTC-CEEEEEECCSCCEEHHHHHHHHHHHHCSCCCEEEECCC
T ss_pred             cEEEcCCcccCCCCCeeEeEEEEEeccchhhhhcccccccc-CceEEEeCCCCcccHHHHHHHHHHHhCCCCCeEECCCC
Confidence            46788888888999999999999999999999987764445 67899999999999999999999999999999999999


Q ss_pred             CCccchhccCHHHHHHhhCCCcccchHhhhC
Q psy16546         81 EGDIVSMYANTDLAQRELGWSARCTVEKMCK  111 (111)
Q Consensus        81 ~~~~~~~~~d~~k~~~~lg~~p~~~~~~~l~  111 (111)
                      +++...+++|++|+++.|||+|.++++|+|+
T Consensus       301 ~~e~~~~~~d~~k~~~~lgw~p~~slee~I~  331 (346)
T d1ek6a_         301 EGDVAACYANPSLAQEELGWTAALGLDRMCE  331 (346)
T ss_dssp             TTCCSEECBCCHHHHHTTCCCCCCCHHHHHH
T ss_pred             CCCCCEeeECHHHHHHHHCCCcCCCHHHHHH
Confidence            9998888999999999999999999999974



>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure