Psyllid ID: psy16546
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| 307172266 | 344 | UDP-glucose 4-epimerase [Camponotus flor | 0.990 | 0.319 | 0.681 | 3e-41 | |
| 332022429 | 364 | Putative UDP-glucose 4-epimerase [Acromy | 0.990 | 0.302 | 0.681 | 4e-41 | |
| 307197296 | 364 | UDP-glucose 4-epimerase [Harpegnathos sa | 0.990 | 0.302 | 0.690 | 5e-41 | |
| 322796795 | 364 | hypothetical protein SINV_11980 [Solenop | 0.981 | 0.299 | 0.678 | 8e-41 | |
| 48105285 | 363 | PREDICTED: probable UDP-glucose 4-epimer | 0.990 | 0.303 | 0.672 | 4e-40 | |
| 380027263 | 363 | PREDICTED: probable UDP-glucose 4-epimer | 0.990 | 0.303 | 0.663 | 7e-40 | |
| 383863089 | 364 | PREDICTED: probable UDP-glucose 4-epimer | 0.990 | 0.302 | 0.663 | 2e-39 | |
| 242017036 | 384 | UDP-glucose 4-epimerase, putative [Pedic | 0.990 | 0.286 | 0.663 | 5e-39 | |
| 340720162 | 364 | PREDICTED: probable UDP-glucose 4-epimer | 0.990 | 0.302 | 0.663 | 6e-39 | |
| 156539983 | 360 | PREDICTED: probable UDP-glucose 4-epimer | 0.990 | 0.305 | 0.645 | 3e-38 |
| >gi|307172266|gb|EFN63771.1| UDP-glucose 4-epimerase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 172 bits (435), Expect = 3e-41, Method: Compositional matrix adjust.
Identities = 75/110 (68%), Positives = 94/110 (85%)
Query: 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
+ +FG DY T DGTG+RDYIHVMDLA GHVAALN L +HL++K YNLGTG G +VL+L+
Sbjct: 206 LLIFGGDYATNDGTGVRDYIHVMDLAAGHVAALNALHKQHLRLKIYNLGTGNGVTVLELI 265
Query: 62 RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
+TFE+VTG VPYI++ RREGDIVSMYANTDLA++ELGW+A+ VE+MC+
Sbjct: 266 KTFEKVTGTTVPYIIKERREGDIVSMYANTDLAKKELGWTAKYNVEQMCQ 315
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332022429|gb|EGI62737.1| Putative UDP-glucose 4-epimerase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307197296|gb|EFN78588.1| UDP-glucose 4-epimerase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322796795|gb|EFZ19222.1| hypothetical protein SINV_11980 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|48105285|ref|XP_393006.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380027263|ref|XP_003697348.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|383863089|ref|XP_003707015.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242017036|ref|XP_002428999.1| UDP-glucose 4-epimerase, putative [Pediculus humanus corporis] gi|212513845|gb|EEB16261.1| UDP-glucose 4-epimerase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340720162|ref|XP_003398512.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Bombus terrestris] gi|350408358|ref|XP_003488377.1| PREDICTED: probable UDP-glucose 4-epimerase-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|156539983|ref|XP_001602357.1| PREDICTED: probable UDP-glucose 4-epimerase-like isoform 1 [Nasonia vitripennis] gi|345496979|ref|XP_003427868.1| PREDICTED: probable UDP-glucose 4-epimerase-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 111 | ||||||
| UNIPROTKB|Q14376 | 348 | GALE "UDP-glucose 4-epimerase" | 0.981 | 0.313 | 0.581 | 1.6e-31 | |
| UNIPROTKB|Q3T105 | 348 | GALE "Uncharacterized protein" | 0.990 | 0.316 | 0.576 | 2e-31 | |
| UNIPROTKB|I3LL84 | 348 | GALE "Uncharacterized protein" | 0.981 | 0.313 | 0.581 | 2e-31 | |
| RGD|621493 | 347 | Gale "UDP-galactose-4-epimeras | 0.981 | 0.314 | 0.572 | 4.2e-31 | |
| UNIPROTKB|Q4QRB0 | 348 | Gale "Gale protein" [Rattus no | 0.981 | 0.313 | 0.572 | 4.2e-31 | |
| MGI|MGI:1921496 | 347 | Gale "galactose-4-epimerase, U | 0.981 | 0.314 | 0.572 | 6.9e-31 | |
| TAIR|locus:2138121 | 350 | UGE2 "UDP-D-glucose/UDP-D-gala | 0.990 | 0.314 | 0.545 | 1.1e-30 | |
| UNIPROTKB|F1NWE5 | 351 | GALE "Uncharacterized protein" | 0.981 | 0.310 | 0.563 | 2.3e-30 | |
| UNIPROTKB|F1PI88 | 348 | GALE "Uncharacterized protein" | 0.990 | 0.316 | 0.549 | 6.2e-30 | |
| TAIR|locus:2123466 | 351 | UGE5 "UDP-D-glucose/UDP-D-gala | 0.990 | 0.313 | 0.527 | 1e-29 |
| UNIPROTKB|Q14376 GALE "UDP-glucose 4-epimerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 346 (126.9 bits), Expect = 1.6e-31, P = 1.6e-31
Identities = 64/110 (58%), Positives = 83/110 (75%)
Query: 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
+ VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E + YNLGTG G SVLQ++
Sbjct: 223 LNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMV 281
Query: 62 RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
+ E+ +GK +PY V ARREGD+ + YAN LAQ ELGW+A +++MC+
Sbjct: 282 QAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331
|
|
| UNIPROTKB|Q3T105 GALE "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LL84 GALE "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621493 Gale "UDP-galactose-4-epimerase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4QRB0 Gale "Gale protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1921496 Gale "galactose-4-epimerase, UDP" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138121 UGE2 "UDP-D-glucose/UDP-D-galactose 4-epimerase 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWE5 GALE "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PI88 GALE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2123466 UGE5 "UDP-D-glucose/UDP-D-galactose 4-epimerase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| cd05247 | 323 | cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, | 3e-53 | |
| PLN02240 | 352 | PLN02240, PLN02240, UDP-glucose 4-epimerase | 7e-51 | |
| COG1087 | 329 | COG1087, GalE, UDP-glucose 4-epimerase [Cell envel | 2e-48 | |
| TIGR01179 | 328 | TIGR01179, galE, UDP-glucose-4-epimerase GalE | 9e-41 | |
| PRK10675 | 338 | PRK10675, PRK10675, UDP-galactose-4-epimerase; Pro | 3e-37 | |
| pfam13950 | 62 | pfam13950, Epimerase_Csub, UDP-glucose 4-epimerase | 2e-22 | |
| cd05256 | 304 | cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-e | 5e-14 | |
| cd05264 | 300 | cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase | 1e-13 | |
| COG0451 | 314 | COG0451, WcaG, Nucleoside-diphosphate-sugar epimer | 1e-10 | |
| cd05253 | 332 | cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimera | 9e-10 | |
| cd05258 | 337 | cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, e | 1e-07 | |
| cd05246 | 315 | cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydra | 5e-07 | |
| TIGR01181 | 317 | TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehyd | 7e-06 | |
| COG1088 | 340 | COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cel | 9e-06 | |
| pfam01370 | 233 | pfam01370, Epimerase, NAD dependent epimerase/dehy | 1e-04 | |
| cd05228 | 318 | cd05228, AR_FR_like_1_SDR_e, uncharacterized subgr | 7e-04 | |
| cd05260 | 316 | cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase | 0.001 | |
| TIGR03466 | 328 | TIGR03466, HpnA, hopanoid-associated sugar epimera | 0.002 | |
| cd05252 | 336 | cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydrata | 0.004 |
| >gnl|CDD|187558 cd05247, UDP_G4E_1_SDR_e, UDP-glucose 4 epimerase, subgroup 1, extended (e) SDRs | Back alignment and domain information |
|---|
Score = 168 bits (429), Expect = 3e-53
Identities = 55/110 (50%), Positives = 75/110 (68%), Gaps = 1/110 (0%)
Query: 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLL 61
+ +FG DY T DGT +RDYIHV+DLA HV AL KL+ + YNLGTG+G SVL+++
Sbjct: 208 LAIFGDDYPTPDGTCVRDYIHVVDLADAHVLALEKLE-NGGGSEIYNLGTGRGYSVLEVV 266
Query: 62 RTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
FE+V+GKP+PY + RR GD S+ A+ A+ ELGW + +E MC+
Sbjct: 267 EAFEKVSGKPIPYEIAPRRAGDPASLVADPSKAREELGWKPKRDLEDMCE 316
|
UDP-glucose 4 epimerase (aka UDP-galactose-4-epimerase), is a homodimeric extended SDR. It catalyzes the NAD-dependent conversion of UDP-galactose to UDP-glucose, the final step in Leloir galactose synthesis. This subgroup has the characteristic active site tetrad and NAD-binding motif of the extended SDRs. Extended SDRs are distinct from classical SDRs. In addition to the Rossmann fold (alpha/beta folding pattern with a central beta-sheet) core region typical of all SDRs, extended SDRs have a less conserved C-terminal extension of approximately 100 amino acids. Extended SDRs are a diverse collection of proteins, and include isomerases, epimerases, oxidoreductases, and lyases; they typically have a TGXXGXXG cofactor binding motif. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold, an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Sequence identity between different SDR enzymes is typically in the 15-30% range; they catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase numbering). In addition to the Tyr and Lys, there is often an upstream Ser and/or an Asn, contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Atypical SDRs generally lack the catalytic residues characteristic of the SDRs, and their glycine-rich NAD(P)-binding motif is often different from the forms normally seen in classical or extended SDRs. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Length = 323 |
| >gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|224012 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|213592 TIGR01179, galE, UDP-glucose-4-epimerase GalE | Back alignment and domain information |
|---|
| >gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206121 pfam13950, Epimerase_Csub, UDP-glucose 4-epimerase C-term subunit | Back alignment and domain information |
|---|
| >gnl|CDD|187566 cd05256, UDP_AE_SDR_e, UDP-N-acetylglucosamine 4-epimerase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187574 cd05264, UDP_G4E_5_SDR_e, UDP-glucose 4-epimerase (G4E), subgroup 5, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|223528 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|187563 cd05253, UDP_GE_SDE_e, UDP glucuronic acid epimerase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187568 cd05258, CDP_TE_SDR_e, CDP-tyvelose 2-epimerase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187557 cd05246, dTDP_GD_SDR_e, dTDP-D-glucose 4,6-dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|224013 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family | Back alignment and domain information |
|---|
| >gnl|CDD|187539 cd05228, AR_FR_like_1_SDR_e, uncharacterized subgroup of aldehyde reductase and flavonoid reductase related proteins, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187570 cd05260, GDP_MD_SDR_e, GDP-mannose 4,6 dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >gnl|CDD|187562 cd05252, CDP_GD_SDR_e, CDP-D-glucose 4,6-dehydratase, extended (e) SDRs | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 99.94 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 99.89 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 99.85 | |
| KOG1429|consensus | 350 | 99.85 | ||
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 99.84 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 99.84 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 99.84 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 99.84 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 99.83 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 99.83 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 99.8 | |
| KOG0747|consensus | 331 | 99.78 | ||
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 99.78 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 99.78 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 99.78 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 99.78 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 99.77 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 99.75 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 99.75 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 99.75 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 99.75 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 99.74 | |
| KOG1371|consensus | 343 | 99.74 | ||
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 99.73 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 99.72 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 99.72 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 99.68 | |
| KOG1431|consensus | 315 | 99.64 | ||
| PLN02214 | 342 | cinnamoyl-CoA reductase | 99.61 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 99.57 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 99.56 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 99.56 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 99.55 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 99.53 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 99.53 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 99.53 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 99.52 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.5 | |
| COG1089 | 345 | Gmd GDP-D-mannose dehydratase [Cell envelope bioge | 99.49 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 99.47 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 99.46 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 99.44 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 99.44 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [ | 99.38 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 99.38 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 99.33 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 99.29 | |
| KOG1372|consensus | 376 | 99.21 | ||
| PF13950 | 62 | Epimerase_Csub: UDP-glucose 4-epimerase C-term sub | 99.18 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 99.01 | |
| KOG3019|consensus | 315 | 99.01 | ||
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 99.01 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 98.95 | |
| KOG1502|consensus | 327 | 98.94 | ||
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 98.93 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 98.9 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 98.89 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 98.89 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 98.88 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 98.81 | |
| KOG1430|consensus | 361 | 98.77 | ||
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 98.75 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 98.46 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 98.23 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 97.85 | |
| KOG2865|consensus | 391 | 97.73 | ||
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 97.57 | |
| KOG2774|consensus | 366 | 97.49 | ||
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 97.4 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 96.68 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 96.53 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 96.51 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 95.96 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 95.81 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases | 95.58 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 94.91 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 94.79 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.29 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 94.28 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 94.22 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 93.96 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 93.74 | |
| KOG1221|consensus | 467 | 92.78 | ||
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 92.59 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 91.22 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 90.88 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 90.75 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 90.59 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 90.11 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 89.64 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 89.1 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 88.68 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 88.46 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 86.32 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 85.5 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 85.27 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 83.99 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 83.34 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 83.24 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 81.8 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 81.43 |
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Probab=99.94 E-value=4.9e-26 Score=149.55 Aligned_cols=109 Identities=42% Similarity=0.724 Sum_probs=101.6
Q ss_pred eeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCCC
Q psy16546 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARRE 81 (111)
Q Consensus 2 ~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~ 81 (111)
+.|||.++.+.||+..||||||.|+|+|+++|++...+.. ...+||+++|..+|..|+++.+.+..|++.+.+..|.|+
T Consensus 206 l~ifG~DY~T~DGT~iRDYIHV~DLA~aH~~Al~~L~~~g-~~~~~NLG~G~G~SV~evi~a~~~vtg~~ip~~~~~RR~ 284 (329)
T COG1087 206 LFIFGDDYDTKDGTCIRDYIHVDDLADAHVLALKYLKEGG-SNNIFNLGSGNGFSVLEVIEAAKKVTGRDIPVEIAPRRA 284 (329)
T ss_pred eEEeCCCCCCCCCCeeeeeeehhHHHHHHHHHHHHHHhCC-ceeEEEccCCCceeHHHHHHHHHHHhCCcCceeeCCCCC
Confidence 6899999999999999999999999999999999875433 447999999999999999999999999999999999999
Q ss_pred CccchhccCHHHHHHhhCCCccc-chHhhhC
Q psy16546 82 GDIVSMYANTDLAQRELGWSARC-TVEKMCK 111 (111)
Q Consensus 82 ~~~~~~~~d~~k~~~~lg~~p~~-~~~~~l~ 111 (111)
+++...+.|++|+++.|||+|++ ++++.++
T Consensus 285 GDpa~l~Ad~~kA~~~Lgw~p~~~~L~~ii~ 315 (329)
T COG1087 285 GDPAILVADSSKARQILGWQPTYDDLEDIIK 315 (329)
T ss_pred CCCceeEeCHHHHHHHhCCCcccCCHHHHHH
Confidence 99999999999999999999999 8988763
|
|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >KOG1429|consensus | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >KOG0747|consensus | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG1371|consensus | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >KOG1431|consensus | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >KOG1372|consensus | Back alignment and domain information |
|---|
| >PF13950 Epimerase_Csub: UDP-glucose 4-epimerase C-term subunit; PDB: 1EK5_A 1I3K_B 1I3M_B 1HZJ_A 1EK6_A 1I3N_A 1I3L_A 2CNB_B 1GY8_D 1NAI_A | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >KOG3019|consensus | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1502|consensus | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12320 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1430|consensus | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >KOG2865|consensus | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >KOG2774|consensus | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1221|consensus | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 111 | ||||
| 1ek5_A | 348 | Structure Of Human Udp-Galactose 4-Epimerase In Com | 8e-34 | ||
| 1i3k_A | 348 | Molecular Basis For Severe Epimerase-Deficiency Gal | 9e-34 | ||
| 1hzj_A | 348 | Human Udp-Galactose 4-Epimerase: Accommodation Of U | 9e-34 | ||
| 3enk_A | 341 | 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase F | 1e-28 | ||
| 1a9z_A | 338 | Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX | 2e-26 | ||
| 1lrj_A | 338 | Crystal Structure Of E. Coli Udp-Galactose 4-Epimer | 2e-26 | ||
| 1kvq_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 1kvs_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 1kvu_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 2udp_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 1kvr_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 1a9y_A | 338 | Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEX | 2e-26 | ||
| 1lrk_A | 338 | Crystal Structure Of Escherichia Coli Udp-Galactose | 2e-26 | ||
| 1kvt_A | 338 | Udp-Galactose 4-Epimerase Complexed With Udp-Phenol | 2e-26 | ||
| 1z45_A | 699 | Crystal Structure Of The Gal10 Fusion Protein Galac | 2e-23 | ||
| 1gy8_A | 397 | Trypanosoma Brucei Udp-Galactose 4' Epimerase Lengt | 1e-18 | ||
| 2c20_A | 330 | Crystal Structure Of Udp-Glucose 4-Epimerase Length | 4e-18 | ||
| 2p5u_A | 311 | Crystal Structure Of Thermus Thermophilus Hb8 Udp-G | 1e-04 |
| >pdb|1EK5|A Chain A, Structure Of Human Udp-Galactose 4-Epimerase In Complex With Nad+ Length = 348 | Back alignment and structure |
|
| >pdb|1I3K|A Chain A, Molecular Basis For Severe Epimerase-Deficiency Galactosemia: X-Ray Structure Of The Human V94m- Substituted Udp-Galactose 4-Epimerase Length = 348 | Back alignment and structure |
| >pdb|1HZJ|A Chain A, Human Udp-Galactose 4-Epimerase: Accommodation Of Udp-N- Acetylglucosamine Within The Active Site Length = 348 | Back alignment and structure |
| >pdb|3ENK|A Chain A, 1.9a Crystal Structure Of Udp-Glucose 4-Epimerase From Burkholderia Pseudomallei Length = 341 | Back alignment and structure |
| >pdb|1A9Z|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Galactose Length = 338 | Back alignment and structure |
| >pdb|1LRJ|A Chain A, Crystal Structure Of E. Coli Udp-Galactose 4-Epimerase Complexed With Udp-N-Acetylglucosamine Length = 338 | Back alignment and structure |
| >pdb|1KVQ|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|1KVS|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|1KVU|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|2UDP|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|1KVR|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|1A9Y|A Chain A, Udp-Galactose 4-Epimerase Mutant S124aY149F COMPLEXED WITH UDP- Glucose Length = 338 | Back alignment and structure |
| >pdb|1LRK|A Chain A, Crystal Structure Of Escherichia Coli Udp-Galactose 4-Epimerase Mutant Y299c Complexed With Udp-N-Acetylglucosamine Length = 338 | Back alignment and structure |
| >pdb|1KVT|A Chain A, Udp-Galactose 4-Epimerase Complexed With Udp-Phenol Length = 338 | Back alignment and structure |
| >pdb|1Z45|A Chain A, Crystal Structure Of The Gal10 Fusion Protein Galactose MutarotaseUDP-Galactose 4-Epimerase From Saccharomyces Cerevisiae Complexed With Nad, Udp-Glucose, And Galactose Length = 699 | Back alignment and structure |
| >pdb|1GY8|A Chain A, Trypanosoma Brucei Udp-Galactose 4' Epimerase Length = 397 | Back alignment and structure |
| >pdb|2C20|A Chain A, Crystal Structure Of Udp-Glucose 4-Epimerase Length = 330 | Back alignment and structure |
| >pdb|2P5U|A Chain A, Crystal Structure Of Thermus Thermophilus Hb8 Udp-Glucose 4- Epimerase Complex With Nad Length = 311 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 111 | |||
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 2e-62 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 2e-62 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 3e-62 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 2e-59 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 7e-56 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 8e-54 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 2e-39 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 2e-39 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 1e-30 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 5e-28 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 3e-21 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 4e-21 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 1e-20 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 6e-18 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 1e-16 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 2e-16 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 2e-16 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 3e-16 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 6e-15 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 5e-14 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 2e-13 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 1e-09 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 1e-09 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 9e-09 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 1e-08 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 2e-05 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 1e-04 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 4e-04 |
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Length = 348 | Back alignment and structure |
|---|
Score = 192 bits (490), Expect = 2e-62
Identities = 64/109 (58%), Positives = 82/109 (75%), Gaps = 1/109 (0%)
Query: 3 TVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLR 62
VFG DY TEDGTG+RDYIHV+DLA GH+AAL KL+ E + YNLGTG G SVLQ+++
Sbjct: 224 NVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLK-EQCGCRIYNLGTGTGYSVLQMVQ 282
Query: 63 TFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEKMCK 111
E+ +GK +PY V ARREGD+ + YAN LAQ ELGW+A +++MC+
Sbjct: 283 AMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCE 331
|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Length = 338 | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} Length = 341 | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Length = 699 | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Length = 397 | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Length = 330 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Length = 330 | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Length = 311 | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A* 3aw9_A* Length = 312 | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} Length = 313 | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Length = 333 | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Length = 311 | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Length = 404 | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Length = 377 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Length = 352 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Length = 362 | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Length = 321 | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Length = 310 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Length = 351 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Length = 357 | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Length = 347 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Length = 379 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Length = 342 | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Length = 357 | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Length = 321 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 99.87 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 99.84 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 99.83 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 99.83 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 99.83 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 99.82 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 99.81 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 99.81 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 99.8 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 99.8 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 99.8 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 99.8 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 99.79 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 99.78 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 99.78 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 99.78 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 99.78 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 99.77 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 99.77 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 99.76 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 99.76 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 99.75 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 99.75 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 99.75 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 99.75 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 99.74 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 99.74 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 99.74 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 99.73 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 99.73 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 99.73 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 99.72 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 99.72 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 99.72 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 99.72 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 99.72 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 99.71 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 99.7 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 99.7 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 99.69 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 99.66 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 99.66 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 99.66 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 99.65 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 99.62 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 99.62 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 99.61 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 99.6 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 99.58 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 99.58 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 99.58 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 99.57 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 99.5 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 99.48 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 99.47 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 99.47 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 99.45 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 99.36 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 99.32 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 99.3 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 99.29 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 99.12 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 99.1 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 98.95 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 98.86 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 98.85 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 98.83 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 98.8 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 98.8 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 98.79 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 98.68 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 98.6 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 98.58 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 98.49 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 98.46 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 98.45 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 98.21 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 98.17 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 98.15 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 98.09 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 97.96 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 97.45 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 97.41 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 97.12 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 97.06 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 96.82 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 96.36 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 96.18 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 95.95 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 95.84 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 95.46 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.33 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 95.2 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 94.63 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 94.54 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 94.21 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 93.49 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 93.42 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 92.92 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 92.4 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 92.38 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 92.36 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 91.94 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 91.75 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 91.51 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 91.13 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 91.13 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 90.92 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 90.17 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 90.01 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 89.78 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 89.7 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 89.54 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 89.5 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 89.38 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 89.3 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 89.22 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 88.37 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 88.18 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 88.13 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 87.67 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 87.57 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 87.43 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 87.3 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 87.16 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 86.48 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 86.41 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 86.11 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 85.99 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 85.45 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 85.27 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 85.15 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 85.1 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 84.78 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 84.44 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 84.15 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 83.95 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 83.87 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 83.87 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 83.85 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 83.72 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 83.64 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 83.29 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 83.22 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 82.91 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 82.84 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 82.61 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 82.29 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 82.17 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 82.1 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 81.84 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 81.78 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 81.7 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 81.57 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 81.32 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 81.08 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 80.92 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 80.47 |
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
Probab=99.87 E-value=1.1e-21 Score=131.45 Aligned_cols=109 Identities=51% Similarity=0.920 Sum_probs=96.1
Q ss_pred eeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCCC
Q psy16546 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARRE 81 (111)
Q Consensus 2 ~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~~ 81 (111)
+.++|....+++|++.|+|+|++|+|++++.++++..... .+++||+++++.+|+.|+++.+.+.+|.+.++...+.++
T Consensus 219 ~~~~g~~~~~~~g~~~~~~i~v~Dva~a~~~~~~~~~~~~-~~~~~ni~~~~~~s~~e~~~~i~~~~g~~~~~~~~~~~~ 297 (341)
T 3enk_A 219 LRVFGSDYPTPDGTGVRDYIHVVDLARGHIAALDALERRD-ASLTVNLGTGRGYSVLEVVRAFEKASGRAVPYELVARRP 297 (341)
T ss_dssp EEEECSCSSSTTSSCEECEEEHHHHHHHHHHHHHHHHHHT-SCEEEEESCSCCEEHHHHHHHHHHHHCSCCCEEEECCCT
T ss_pred eEEeCCccCCCCCCeeEeeEEHHHHHHHHHHHHHhhhcCC-cceEEEeCCCCceeHHHHHHHHHHHhCCCcceeeCCCCC
Confidence 4566766777799999999999999999999998732134 689999999999999999999999999998888888888
Q ss_pred CccchhccCHHHHHHhhCCCcccchHhhhC
Q psy16546 82 GDIVSMYANTDLAQRELGWSARCTVEKMCK 111 (111)
Q Consensus 82 ~~~~~~~~d~~k~~~~lg~~p~~~~~~~l~ 111 (111)
.+.....+|++|+++.|||+|.++++++|+
T Consensus 298 ~~~~~~~~d~~k~~~~lG~~p~~~l~~~l~ 327 (341)
T 3enk_A 298 GDVAECYANPAAAAETIGWKAERDLERMCA 327 (341)
T ss_dssp TCCSEECBCCHHHHHHHCCCCCCCHHHHHH
T ss_pred CCccccccCHHHHHHHcCCCCCCCHHHHHH
Confidence 888888899999999999999999999873
|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 111 | ||||
| d1gy8a_ | 383 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 8e-27 | |
| d1ek6a_ | 346 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 1e-23 | |
| d1udca_ | 338 | c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras | 2e-23 | |
| d1z45a2 | 347 | c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-ep | 2e-19 | |
| d2b69a1 | 312 | c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 | 2e-18 | |
| d1r6da_ | 322 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 1e-17 | |
| d1orra_ | 338 | c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella | 8e-17 | |
| d1kewa_ | 361 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 1e-16 | |
| d1sb8a_ | 341 | c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase W | 7e-13 | |
| d2c5aa1 | 363 | c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {T | 1e-12 | |
| d1rpna_ | 321 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomo | 3e-12 | |
| d1db3a_ | 357 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric | 6e-11 | |
| d1y1pa1 | 342 | c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolo | 2e-10 | |
| d1e6ua_ | 315 | c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimeras | 4e-10 | |
| d1oc2a_ | 346 | c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { | 9e-10 | |
| d1t2aa_ | 347 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (H | 1e-07 | |
| d1xgka_ | 350 | c.2.1.2 (A:) Negative transcriptional regulator Nm | 2e-06 | |
| d1qyda_ | 312 | c.2.1.2 (A:) Pinoresinol-lariciresinol reductase { | 2e-06 | |
| d1n7ha_ | 339 | c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cr | 3e-06 | |
| d1i24a_ | 393 | c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 | 5e-06 | |
| d1rkxa_ | 356 | c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia | 3e-05 | |
| d2q46a1 | 252 | c.2.1.2 (A:2-253) Hypothetical protein At5g02240 ( | 5e-05 | |
| d2blla1 | 342 | c.2.1.2 (A:316-657) Polymyxin resistance protein A | 5e-04 |
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Length = 383 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) species: Trypanosoma brucei [TaxId: 5691]
Score = 99.5 bits (246), Expect = 8e-27
Identities = 42/112 (37%), Positives = 62/112 (55%), Gaps = 5/112 (4%)
Query: 2 ITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKF-----YNLGTGQGTS 56
+ +FG DY T DGT +RDY+HV DLA H+ AL+ ++ K +NLGT +G S
Sbjct: 254 MPIFGTDYPTPDGTCVRDYVHVCDLASAHILALDYVEKLGPNDKSKYFSVFNLGTSRGYS 313
Query: 57 VLQLLRTFERVTGKPVPYIVEARREGDIVSMYANTDLAQRELGWSARCTVEK 108
V +++ + TG P+P RREGD + A +D A+ LGW + +
Sbjct: 314 VREVIEVARKTTGHPIPVRECGRREGDPAYLVAASDKAREVLGWKPKYDTLE 365
|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 347 | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 312 | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Length = 322 | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Length = 338 | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Length = 341 | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 363 | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Length = 321 | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Length = 342 | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 346 | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 347 | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Length = 312 | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 339 | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 393 | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Length = 356 | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 252 | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Length = 342 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 111 | |||
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.89 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.88 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 99.86 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 99.86 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.86 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.83 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 99.83 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 99.83 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 99.82 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 99.81 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 99.8 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 99.79 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 99.78 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 99.76 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 99.73 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 99.68 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 99.68 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 99.67 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 99.64 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 99.62 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 99.53 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 99.42 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 99.25 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 99.04 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 99.03 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 98.4 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 98.1 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 94.86 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 93.46 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 93.09 |
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.89 E-value=3.9e-23 Score=137.44 Aligned_cols=110 Identities=57% Similarity=1.020 Sum_probs=100.1
Q ss_pred CeeeeCCCCCCCCCCccceeeeHHHHHHHHHHHHhhhhccccccceEEecCCCcccHHHHHHHHHHHhCCCccceEccCC
Q psy16546 1 MITVFGADYGTEDGTGIRDYIHVMDLAVGHVAALNKLQGEHLKIKFYNLGTGQGTSVLQLLRTFERVTGKPVPYIVEARR 80 (111)
Q Consensus 1 ~~~~~g~~~~~~~g~~~r~~v~v~D~a~a~~~~~~~~~~~~~~~~~yni~~~~~~s~~e~~~~i~~~~~~~~~~~~~~~~ 80 (111)
++.++|.+..+.+|.+.|||+|++|+|+++..++....... .+++||+++++.+|+.|+++.+.+.++.+.+....|.+
T Consensus 222 ~i~i~g~~~~~~~g~~~Rdfi~v~D~a~~~~~~~~~~~~~~-~~~i~Ni~~~~~~s~~dl~~~i~~~~~~~~~~~~~~~~ 300 (346)
T d1ek6a_ 222 ALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQC-GCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARR 300 (346)
T ss_dssp CEEEECSCSSSSSSSCEECEEEHHHHHHHHHHHHHHHTTTC-CEEEEEECCSCCEEHHHHHHHHHHHHCSCCCEEEECCC
T ss_pred cEEEcCCcccCCCCCeeEeEEEEEeccchhhhhcccccccc-CceEEEeCCCCcccHHHHHHHHHHHhCCCCCeEECCCC
Confidence 46788888888999999999999999999999987764445 67899999999999999999999999999999999999
Q ss_pred CCccchhccCHHHHHHhhCCCcccchHhhhC
Q psy16546 81 EGDIVSMYANTDLAQRELGWSARCTVEKMCK 111 (111)
Q Consensus 81 ~~~~~~~~~d~~k~~~~lg~~p~~~~~~~l~ 111 (111)
+++...+++|++|+++.|||+|.++++|+|+
T Consensus 301 ~~e~~~~~~d~~k~~~~lgw~p~~slee~I~ 331 (346)
T d1ek6a_ 301 EGDVAACYANPSLAQEELGWTAALGLDRMCE 331 (346)
T ss_dssp TTCCSEECBCCHHHHHTTCCCCCCCHHHHHH
T ss_pred CCCCCEeeECHHHHHHHHCCCcCCCHHHHHH
Confidence 9998888999999999999999999999974
|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|