Psyllid ID: psy16564

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MGNEKTKLKTTKIVVVQGTATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
ccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEccHHHHHHHccccEEccccccccccccEEEEEEEcccHHHHHHcccHHHHHcccccc
cccccccEEEccEEccccccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccccHHHHEEEEEcccccccEEEEEEEEEEEccccccHHHHHHccHcHHHHHHcc
mgnektklkTTKIVVVQGtatdnvpsandegvSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVladncdepAYKKLVQALCSehqiplikvdnnkklgewaglskldnmgkarkvvGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
mgnektklkttkivvvqgtatdnvpsandegvSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHqiplikvdnnkKLGEWAGLskldnmgkarKVVGCSCVVIKVRNWFLIicsrkstqvlsvnynks
MGNEktklkttkivvvQGTATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
************IVVVQ*********************LQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLS******
**********************NVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEW************RKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYN**
********KTTKIVVVQGTATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
********K*TKIVVVQ**************VSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNEKTKLKTTKIVVVQGTATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRNWFLIICSRKSTQVLSVNYNKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
P46405132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.747 1e-39
P25398132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.747 1e-39
P84175132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.747 1e-39
Q76I81132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.747 1e-39
P47840132 40S ribosomal protein S12 N/A N/A 0.656 0.780 0.737 2e-38
P63324132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.737 2e-38
P63323132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.737 2e-38
O13019132 40S ribosomal protein S12 yes N/A 0.656 0.780 0.737 2e-38
P80455139 40S ribosomal protein S12 yes N/A 0.707 0.798 0.637 2e-34
O59936132 40S ribosomal protein S12 N/A N/A 0.796 0.946 0.557 2e-33
>sp|P46405|RS12_PIG 40S ribosomal protein S12 OS=Sus scrofa GN=RPS12 PE=2 SV=2 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query: 31  GVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALC 90
           GV D+N ALQ+VLKTA  HDGLA+G+ EAAKALD+R+A LCVLA NCDEP Y KLV+ALC
Sbjct: 10  GVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALC 69

Query: 91  SEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
           +EHQI LIKVD+NKKLGEW GL K+D  GK RKVVGCSCVV+K
Sbjct: 70  AEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVK 112

Sus scrofa (taxid: 9823)
>sp|P25398|RS12_HUMAN 40S ribosomal protein S12 OS=Homo sapiens GN=RPS12 PE=1 SV=3 Back     alignment and function description
>sp|P84175|RS12_CHICK 40S ribosomal protein S12 OS=Gallus gallus GN=RPS12 PE=1 SV=2 Back     alignment and function description
>sp|Q76I81|RS12_BOVIN 40S ribosomal protein S12 OS=Bos taurus GN=RPS12 PE=2 SV=1 Back     alignment and function description
>sp|P47840|RS12_XENLA 40S ribosomal protein S12 OS=Xenopus laevis GN=rps12 PE=2 SV=2 Back     alignment and function description
>sp|P63324|RS12_RAT 40S ribosomal protein S12 OS=Rattus norvegicus GN=Rps12 PE=1 SV=2 Back     alignment and function description
>sp|P63323|RS12_MOUSE 40S ribosomal protein S12 OS=Mus musculus GN=Rps12 PE=1 SV=2 Back     alignment and function description
>sp|O13019|RS12_ORENI 40S ribosomal protein S12 OS=Oreochromis niloticus GN=rps12 PE=2 SV=3 Back     alignment and function description
>sp|P80455|RS12_DROME 40S ribosomal protein S12 OS=Drosophila melanogaster GN=RpS12 PE=2 SV=2 Back     alignment and function description
>sp|O59936|RS12_ERYGR 40S ribosomal protein S12 OS=Erysiphe graminis subsp. hordei GN=RPS12 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
110671424140 putative ribosomal protein S12 [Diaphori 0.713 0.8 1.0 2e-58
156546944140 PREDICTED: 40S ribosomal protein S12-lik 0.719 0.807 0.769 6e-44
307187759141 40S ribosomal protein S12 [Camponotus fl 0.713 0.794 0.769 8e-43
332020174146 40S ribosomal protein S12 [Acromyrmex ec 0.719 0.773 0.754 9e-43
380011329167 PREDICTED: 40S ribosomal protein S12-lik 0.713 0.670 0.752 9e-43
328776219168 PREDICTED: 40S ribosomal protein S12 [Ap 0.713 0.666 0.752 1e-42
307200661141 40S ribosomal protein S12 [Harpegnathos 0.713 0.794 0.769 1e-42
242009437139 40S ribosomal protein S12, putative [Ped 0.719 0.812 0.763 2e-42
264667383139 ribosomal protein S12 [Chrysomela tremul 0.745 0.841 0.741 3e-42
383853812141 PREDICTED: 40S ribosomal protein S12-lik 0.713 0.794 0.752 1e-41
>gi|110671424|gb|ABG81963.1| putative ribosomal protein S12 [Diaphorina citri] Back     alignment and taxonomy information
 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/112 (100%), Positives = 112/112 (100%)

Query: 22  DNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPA 81
           DNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPA
Sbjct: 6   DNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPA 65

Query: 82  YKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
           YKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK
Sbjct: 66  YKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 117

Source: Diaphorina citri

Species: Diaphorina citri

Genus: Diaphorina

Family: Psyllidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156546944|ref|XP_001605124.1| PREDICTED: 40S ribosomal protein S12-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307187759|gb|EFN72731.1| 40S ribosomal protein S12 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020174|gb|EGI60618.1| 40S ribosomal protein S12 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380011329|ref|XP_003689761.1| PREDICTED: 40S ribosomal protein S12-like [Apis florea] Back     alignment and taxonomy information
>gi|328776219|ref|XP_624645.2| PREDICTED: 40S ribosomal protein S12 [Apis mellifera] Back     alignment and taxonomy information
>gi|307200661|gb|EFN80764.1| 40S ribosomal protein S12 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242009437|ref|XP_002425492.1| 40S ribosomal protein S12, putative [Pediculus humanus corporis] gi|212509347|gb|EEB12754.1| 40S ribosomal protein S12, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|264667383|gb|ACY71277.1| ribosomal protein S12 [Chrysomela tremula] Back     alignment and taxonomy information
>gi|383853812|ref|XP_003702416.1| PREDICTED: 40S ribosomal protein S12-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
UNIPROTKB|P84175132 RPS12 "40S ribosomal protein S 0.656 0.780 0.747 1.3e-38
UNIPROTKB|Q76I81132 RPS12 "40S ribosomal protein S 0.656 0.780 0.747 1.3e-38
UNIPROTKB|E2R4N7132 RPS12 "40S ribosomal protein S 0.656 0.780 0.747 1.3e-38
UNIPROTKB|P25398132 RPS12 "40S ribosomal protein S 0.656 0.780 0.747 1.3e-38
UNIPROTKB|P46405132 RPS12 "40S ribosomal protein S 0.656 0.780 0.747 1.3e-38
RGD|2323601132 LOC100359593 "ribosomal protei 0.656 0.780 0.747 1.3e-38
UNIPROTKB|Q6PDW1132 LOC100359593 "40S ribosomal pr 0.656 0.780 0.747 1.3e-38
RGD|2321715132 Rps12l3 "ribosomal protein S12 0.656 0.780 0.737 3.4e-38
ZFIN|ZDB-GENE-030131-8951132 rps12 "ribosomal protein S12" 0.656 0.780 0.747 7e-38
RGD|62024132 Rps12 "ribosomal protein S12" 0.656 0.780 0.737 1.5e-37
UNIPROTKB|P84175 RPS12 "40S ribosomal protein S12" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 413 (150.4 bits), Expect = 1.3e-38, P = 1.3e-38
 Identities = 77/103 (74%), Positives = 88/103 (85%)

Query:    31 GVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALC 90
             GV D+N ALQ+VLKTA  HDGLA+G+ EAAKALD+R+A LCVLA NCDEP Y KLV+ALC
Sbjct:    10 GVMDVNTALQEVLKTALIHDGLARGIREAAKALDKRQAHLCVLASNCDEPMYVKLVEALC 69

Query:    91 SEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
             +EHQI LIKVD+NKKLGEW GL K+D  GK RKVVGCSCVV+K
Sbjct:    70 AEHQINLIKVDDNKKLGEWVGLCKIDREGKPRKVVGCSCVVVK 112
GO:0003735 "structural constituent of ribosome" evidence=IEA
GO:0006412 "translation" evidence=IEA
GO:0022627 "cytosolic small ribosomal subunit" evidence=IEA
UNIPROTKB|Q76I81 RPS12 "40S ribosomal protein S12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4N7 RPS12 "40S ribosomal protein S12" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P25398 RPS12 "40S ribosomal protein S12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P46405 RPS12 "40S ribosomal protein S12" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|2323601 LOC100359593 "ribosomal protein S12-like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PDW1 LOC100359593 "40S ribosomal protein S12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2321715 Rps12l3 "ribosomal protein S12-like 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8951 rps12 "ribosomal protein S12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|62024 Rps12 "ribosomal protein S12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O13019RS12_ORENINo assigned EC number0.73780.65600.7803yesN/A
P46405RS12_PIGNo assigned EC number0.74750.65600.7803yesN/A
Q54PX9RS12_DICDINo assigned EC number0.61380.64330.7426yesN/A
O14062RS12A_SCHPONo assigned EC number0.63260.62420.6758yesN/A
P25398RS12_HUMANNo assigned EC number0.74750.65600.7803yesN/A
P48589RS12_YEASTNo assigned EC number0.53840.56680.6223yesN/A
P47840RS12_XENLANo assigned EC number0.73780.65600.7803N/AN/A
P62008RL7A_PYRABNo assigned EC number0.33940.63690.8130yesN/A
P62009RL7A_PYRHONo assigned EC number0.33940.63690.8130yesN/A
P80455RS12_DROMENo assigned EC number0.63710.70700.7985yesN/A
P84175RS12_CHICKNo assigned EC number0.74750.65600.7803yesN/A
O97249RS12_PLAF7No assigned EC number0.48240.71970.8014yesN/A
Q76I81RS12_BOVINNo assigned EC number0.74750.65600.7803yesN/A
P49196RS12_CAEELNo assigned EC number0.61940.70700.7928yesN/A
Q9SKZ3RS122_ARATHNo assigned EC number0.560.63690.6944yesN/A
P63323RS12_MOUSENo assigned EC number0.73780.65600.7803yesN/A
P63324RS12_RATNo assigned EC number0.73780.65600.7803yesN/A
B6YWH9RL7A_THEONNo assigned EC number0.32110.63690.8130yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
pfam0124895 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/ 1e-30
COG1358116 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L3 9e-19
PRK04175122 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Vali 1e-07
TIGR03677117 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae 5e-07
PRK1360282 PRK13602, PRK13602, putative ribosomal protein L7A 4e-04
>gnl|CDD|216387 pfam01248, Ribosomal_L7Ae, Ribosomal protein L7Ae/L30e/S12e/Gadd45 family Back     alignment and domain information 
 Score =  105 bits (265), Expect = 1e-30
 Identities = 36/96 (37%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 37  KALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIP 96
            AL++VLK A     L  GL E  KAL R +A+L ++A++CD     KL+ ALC E  +P
Sbjct: 1   DALKEVLKKALKTGKLVLGLKEVTKALRRGKAKLVIIAEDCDPEEKVKLLPALCKEKNVP 60

Query: 97  LIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVI 132
            + V + K+LGE  G  +      A K  G S +++
Sbjct: 61  YVYVPSKKELGEACGKPRP-VSALAIKDNGDSKILV 95

This family includes: Ribosomal L7A from metazoa, Ribosomal L8-A and L8-B from fungi, 30S ribosomal protein HS6 from archaebacteria, 40S ribosomal protein S12 from eukaryotes, Ribosomal protein L30 from eukaryotes and archaebacteria. Gadd45 and MyD118. Length = 95
>gnl|CDD|224277 COG1358, RPL8A, Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|179766 PRK04175, rpl7ae, 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>gnl|CDD|188367 TIGR03677, rpl7ae, 50S ribosomal protein L7Ae Back     alignment and domain information
>gnl|CDD|184174 PRK13602, PRK13602, putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
KOG3406|consensus134 99.94
PRK0101899 50S ribosomal protein L30e; Reviewed 99.94
TIGR03677117 rpl7ae 50S ribosomal protein L7Ae. Multifunctional 99.94
PRK04175122 rpl7ae 50S ribosomal protein L7Ae; Validated 99.93
PTZ00106108 60S ribosomal protein L30; Provisional 99.93
PRK0728398 hypothetical protein; Provisional 99.93
PRK07714100 hypothetical protein; Provisional 99.92
COG1358116 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Tr 99.91
PRK05583104 ribosomal protein L7Ae family protein; Provisional 99.89
PF0124895 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/G 99.89
PRK0668382 hypothetical protein; Provisional 99.87
PRK1360282 putative ribosomal protein L7Ae-like; Provisional 99.87
COG1911100 RPL30 Ribosomal protein L30E [Translation, ribosom 99.84
PRK1360182 putative L7Ae-like ribosomal protein; Provisional 99.83
PRK1360084 putative ribosomal protein L7Ae-like; Provisional 99.82
PRK09190220 hypothetical protein; Provisional 99.78
PTZ00222263 60S ribosomal protein L7a; Provisional 99.77
KOG3167|consensus153 99.75
PTZ00365266 60S ribosomal protein L7Ae-like; Provisional 99.67
KOG3387|consensus131 99.66
KOG2988|consensus112 99.26
KOG3166|consensus209 97.53
PF08228158 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR0 97.28
PF03465113 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This do 96.63
PF15608100 PELOTA_1: PELOTA RNA binding domain 95.81
PF0803276 SpoU_sub_bind: RNA 2'-O ribose methyltransferase s 95.81
TIGR00108409 eRF peptide chain release factor eRF/aRF, subunit 94.49
PRK04011411 peptide chain release factor 1; Provisional 93.79
TIGR03676403 aRF1/eRF1 peptide chain release factor 1, archaeal 93.78
TIGR00111351 pelota probable translation factor pelota. This mo 93.68
PF1008797 DUF2325: Uncharacterized protein conserved in bact 93.23
PRK11181 244 23S rRNA (guanosine-2'-O-)-methyltransferase; Prov 85.9
PRK10864 346 putative methyltransferase; Provisional 85.75
cd01422115 MGS Methylglyoxal synthase catalyzes the enolizati 85.55
TIGR00679 304 hpr-ser Hpr(Ser) kinase/phosphatase. The hprK gene 82.97
TIGR00186 237 rRNA_methyl_3 rRNA methylase, putative, group 3. t 82.66
PF02603127 Hpr_kinase_N: HPr Serine kinase N terminus; InterP 80.8
COG1537352 PelA Predicted RNA-binding proteins [General funct 80.54
cd00532112 MGS-like MGS-like domain. This domain composes the 80.04
>KOG3406|consensus Back     alignment and domain information 
Probab=99.94  E-value=5.1e-27  Score=177.15  Aligned_cols=108  Identities=70%  Similarity=1.118  Sum_probs=105.9

Q ss_pred             cccHHHHHHHHHHHHHhcCCceeeHHHHHHHHhcCCeeEEEEcCCCCchhhHHHHHHHHHhCCCCEEEeCCHHHHHHHhC
Q psy16564         32 VSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAG  111 (157)
Q Consensus        32 ~m~~~k~L~~lL~~A~~agklv~G~~~v~KaL~kgkakLVIlA~D~s~~~~~~~l~~lc~~~~Ipvi~v~sk~eLG~a~G  111 (157)
                      .||++.+|+.+|+.|+-++.++.|.+++.|+|.+.++.||++|+||++++|.+++++||.+++||++.+.+..+||+|+|
T Consensus        15 ~mdv~~AL~~Vlk~al~~dGlarGi~Ea~KaldkrqA~lcvLaencdep~yvKLVeALcaeh~iplikV~d~k~LGew~G   94 (134)
T KOG3406|consen   15 VMDVNTALQEVLKTALVHDGLARGIHEAAKALDKRQAHLCVLAENCDEPMYVKLVEALCAEHQIPLIKVGDAKELGEWAG   94 (134)
T ss_pred             cccHHHHHHHHHHHHHHhchHHhHHHHHHHHHhhCceeEEEEeccCCchHHHHHHHHHHhhcCCCeEEeccchhhhhhhc
Confidence            49999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCCccceeeeEEEEEecCchhH
Q psy16564        112 LSKLDNMGKARKVVGCSCVVIKVRNWFL  139 (157)
Q Consensus       112 ~~~~~~~gk~rki~~~s~vaI~D~g~~~  139 (157)
                      .+++|++|++||+++|||++|.|+|...
T Consensus        95 lckid~eGnarKvvGcs~vvVkd~geet  122 (134)
T KOG3406|consen   95 LCKIDSEGNARKVVGCSCVVVKDYGEET  122 (134)
T ss_pred             eeeecCCCCeeEeecceEEEEeeccccc
Confidence            9999999999999999999999999865

>PRK01018 50S ribosomal protein L30e; Reviewed Back     alignment and domain information
>TIGR03677 rpl7ae 50S ribosomal protein L7Ae Back     alignment and domain information
>PRK04175 rpl7ae 50S ribosomal protein L7Ae; Validated Back     alignment and domain information
>PTZ00106 60S ribosomal protein L30; Provisional Back     alignment and domain information
>PRK07283 hypothetical protein; Provisional Back     alignment and domain information
>PRK07714 hypothetical protein; Provisional Back     alignment and domain information
>COG1358 RPL8A Ribosomal protein HS6-type (S12/L30/L7a) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05583 ribosomal protein L7Ae family protein; Provisional Back     alignment and domain information
>PF01248 Ribosomal_L7Ae: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; InterPro: IPR004038 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK06683 hypothetical protein; Provisional Back     alignment and domain information
>PRK13602 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>COG1911 RPL30 Ribosomal protein L30E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13601 putative L7Ae-like ribosomal protein; Provisional Back     alignment and domain information
>PRK13600 putative ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>PRK09190 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00222 60S ribosomal protein L7a; Provisional Back     alignment and domain information
>KOG3167|consensus Back     alignment and domain information
>PTZ00365 60S ribosomal protein L7Ae-like; Provisional Back     alignment and domain information
>KOG3387|consensus Back     alignment and domain information
>KOG2988|consensus Back     alignment and domain information
>KOG3166|consensus Back     alignment and domain information
>PF08228 RNase_P_pop3: RNase P subunit Pop3; InterPro: IPR013241 This family of fungal proteins form a subunit of RNase P, the ribonucleoprotein enzyme that cleaves the leader sequence of precursor tRNAs to generate mature tRNAs Back     alignment and domain information
>PF03465 eRF1_3: eRF1 domain 3; InterPro: IPR005142 This domain is found in the release factor eRF1 which terminates protein biosynthesis by recognizing stop codons at the A site of the ribosome and stimulating peptidyl-tRNA bond hydrolysis at the peptidyl transferase centre Back     alignment and domain information
>PF15608 PELOTA_1: PELOTA RNA binding domain Back     alignment and domain information
>PF08032 SpoU_sub_bind: RNA 2'-O ribose methyltransferase substrate binding; InterPro: IPR013123 Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications Back     alignment and domain information
>TIGR00108 eRF peptide chain release factor eRF/aRF, subunit 1 Back     alignment and domain information
>PRK04011 peptide chain release factor 1; Provisional Back     alignment and domain information
>TIGR03676 aRF1/eRF1 peptide chain release factor 1, archaeal and eukaryotic forms Back     alignment and domain information
>TIGR00111 pelota probable translation factor pelota Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK11181 23S rRNA (guanosine-2'-O-)-methyltransferase; Provisional Back     alignment and domain information
>PRK10864 putative methyltransferase; Provisional Back     alignment and domain information
>cd01422 MGS Methylglyoxal synthase catalyzes the enolization of dihydroxyacetone phosphate (DHAP) to produce methylglyoxal Back     alignment and domain information
>TIGR00679 hpr-ser Hpr(Ser) kinase/phosphatase Back     alignment and domain information
>TIGR00186 rRNA_methyl_3 rRNA methylase, putative, group 3 Back     alignment and domain information
>PF02603 Hpr_kinase_N: HPr Serine kinase N terminus; InterPro: IPR011126 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>COG1537 PelA Predicted RNA-binding proteins [General function prediction only] Back     alignment and domain information
>cd00532 MGS-like MGS-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3zey_F144 High-resolution Cryo-electron Microscopy Structure 3e-21
3u5c_M143 The Structure Of The Eukaryotic Ribosome At 3.0 A R 4e-19
2xzm_U126 Crystal Structure Of The Eukaryotic 40s Ribosomal S 3e-14
2fc3_A124 Crystal Structure Of The Extremely Thermostable Aer 2e-08
1pxw_A128 Crystal Structure Of L7ae Srnp Core Protein From Py 3e-06
2czw_A124 Crystal Structure Analysis Of Protein Component Ph1 3e-06
3hjw_C120 Structure Of A Functional Ribonucleoprotein Pseudou 4e-06
3lwo_C123 Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONT 4e-06
3nmu_C129 Crystal Structure Of Substrate-Bound Halfmer Box CD 4e-06
2hvy_D130 Crystal Structure Of An HACA BOX RNP FROM PYROCOCCU 4e-06
1rlg_A119 Molecular Basis Of Box CD RNA-Protein Interaction: 2e-05
3id5_C130 Crystal Structure Of Sulfolobus Solfataricus CD RNP 3e-05
2kg4_A165 Three-Dimensional Structure Of Human Gadd45alpha In 3e-04
1ffk_E119 Crystal Structure Of The Large Ribosomal Subunit Fr 7e-04
3cg6_A146 Crystal Structure Of Gadd45 Gamma Length = 146 7e-04
>pdb|3ZEY|F Chain F, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 144 Back     alignment and structure 
Iteration: 1

 Score = 97.4 bits (241), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 74/118 (62%), Gaps = 6/118 (5%)
Query: 22  DNVPS-ANDEGVSD-----INKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLAD 75
           D VP  A  + V+D     +  AL+ VL  AR  +GL  GL E  +ALDRR A LCVLAD
Sbjct: 10  DKVPEPAVIDAVADAMPDSLEDALRIVLMKARETNGLICGLSEVTRALDRRTAHLCVLAD 69
Query: 76  NCDEPAYKKLVQALCSEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
           +C++  YKKLV AL  ++ I L+ +D  +KL +WAGL+++   G  RK + CSC+ ++
Sbjct: 70  DCEDEEYKKLVTALAKQNNIDLVSMDEREKLAQWAGLTRMAADGSVRKTLKCSCLAVR 127
>pdb|3U5C|M Chain M, The Structure Of The Eukaryotic Ribosome At 3.0 A Resolution. This Entry Contains Proteins Of The 40s Subunit, Ribosome A Length = 143 Back     alignment and structure
>pdb|2XZM|U Chain U, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 126 Back     alignment and structure
>pdb|2FC3|A Chain A, Crystal Structure Of The Extremely Thermostable Aeropyrum Pernix L7ae Multifunctional Protein Length = 124 Back     alignment and structure
>pdb|1PXW|A Chain A, Crystal Structure Of L7ae Srnp Core Protein From Pyrococcus Abyssii Length = 128 Back     alignment and structure
>pdb|2CZW|A Chain A, Crystal Structure Analysis Of Protein Component Ph1496p Of P.Horikoshii Ribonuclease P Length = 124 Back     alignment and structure
>pdb|3HJW|C Chain C, Structure Of A Functional Ribonucleoprotein Pseudouridine Synthase Bound To A Substrate Rna Length = 120 Back     alignment and structure
>pdb|3LWO|C Chain C, Structure Of HACA RNP BOUND TO A SUBSTRATE RNA CONTAINING 5BRU Length = 123 Back     alignment and structure
>pdb|3NMU|C Chain C, Crystal Structure Of Substrate-Bound Halfmer Box CD RNP Length = 129 Back     alignment and structure
>pdb|2HVY|D Chain D, Crystal Structure Of An HACA BOX RNP FROM PYROCOCCUS FURIOSUS Length = 130 Back     alignment and structure
>pdb|1RLG|A Chain A, Molecular Basis Of Box CD RNA-Protein Interaction: Co- Crystal Structure Of The Archaeal Srnp Intiation Complex Length = 119 Back     alignment and structure
>pdb|3ID5|C Chain C, Crystal Structure Of Sulfolobus Solfataricus CD RNP ASSEMBLED WITH Nop5, Fibrillarin, L7ae And A Split Half CD RNA Length = 130 Back     alignment and structure
>pdb|2KG4|A Chain A, Three-Dimensional Structure Of Human Gadd45alpha In Solution By Nmr Length = 165 Back     alignment and structure
>pdb|1FFK|E Chain E, Crystal Structure Of The Large Ribosomal Subunit From Haloarcula Marismortui At 2.4 Angstrom Resolution Length = 119 Back     alignment and structure
>pdb|3CG6|A Chain A, Crystal Structure Of Gadd45 Gamma Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 5e-42
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 1e-39
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 9e-36
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 2e-34
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 2e-33
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 3e-22
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 2e-18
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 1e-16
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 5e-13
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 5e-12
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 6e-12
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 6e-12
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 1e-11
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 2e-10
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 2e-10
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 4e-07
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 9e-07
1w41_A101 50S ribosomal protein L30E; electrostatic interact 1e-06
3iz5_F190 60S ribosomal protein L9 (L6P); eukaryotic ribosom 1e-06
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 3e-06
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 5e-06
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 2e-05
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 1e-04
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 1e-04
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 4e-04
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 5e-04
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 8e-04
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Length = 143 Back     alignment and structure
 Score =  136 bits (342), Expect = 5e-42
 Identities = 56/119 (47%), Positives = 70/119 (58%), Gaps = 2/119 (1%)

Query: 17  QGTATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADN 76
           +                 I  AL+ VL+TA  HDGLA+GL E+ KAL R EA L VL  +
Sbjct: 6   EVVEVQEETVVEQTAEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSS 65

Query: 77  CDEPAYKKLVQALC--SEHQIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
             E    KLV+ L    E+++PLIKV + K+LGEWAGL K+D  G ARKVVG S VV+K
Sbjct: 66  VTEANIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGASVVVVK 124
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Length = 165 Back     alignment and structure
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Length = 126 Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Length = 167 Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Length = 146 Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Length = 124 Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Length = 119 Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Length = 120 Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Length = 82 Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Length = 134 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Length = 121 Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Length = 120 Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Length = 122 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Length = 144 Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Length = 135 Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Length = 105 Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Length = 113 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Length = 101 Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Length = 110 Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Length = 125 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Length = 104 Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Length = 255 Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Length = 101 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Length = 101 Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Length = 266 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
2xzm_U126 Ribosomal protein L7AE containing protein; ribosom 99.97
3u5c_M143 40S ribosomal protein S12, 40S ribosomal protein S 99.97
2ale_A134 SNU13, NHP2/L7AE family protein YEL026W; splicing, 99.95
3o85_A122 Ribosomal protein L7AE; alpha beta sandwich fold, 99.95
3iz5_f112 60S ribosomal protein L30 (L30E); eukaryotic ribos 99.95
2aif_A135 Ribosomal protein L7A; high-mobility like protein, 99.94
2jnb_A144 NHP2-like protein 1; splicing, KINK-turn RNA-bindi 99.94
4a18_G104 RPL30; ribosome, eukaryotic initiation factor 6, E 99.94
3on1_A101 BH2414 protein; structural genomics, PSI-2, protei 99.94
3u5e_c105 L32, RP73, YL38, 60S ribosomal protein L30; transl 99.94
2lbw_A121 H/ACA ribonucleoprotein complex subunit 2; L7AE, s 99.93
3j21_Z99 50S ribosomal protein L30E; archaea, archaeal, KIN 99.93
3v7q_A101 Probable ribosomal protein YLXQ; L7AE superfamily, 99.93
1vq8_F120 50S ribosomal protein L7AE; ribosome 50S, protein- 99.93
2fc3_A124 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.93
1rlg_A119 50S ribosomal protein L7AE; protein-RNA, structura 99.93
1w41_A101 50S ribosomal protein L30E; electrostatic interact 99.92
3cpq_A110 50S ribosomal protein L30E; RNA-protein, elongatio 99.91
2kg4_A165 Growth arrest and DNA-damage-inducible protein GA 99.91
1xbi_A120 50S ribosomal protein L7AE; alpha-beta-alpha sandw 99.9
3vi6_A125 60S ribosomal protein L30; three-layer alpha/beta/ 99.88
3v7e_A82 Ribosome-associated protein L7AE-like; RNA-protein 99.88
3cg6_A146 Growth arrest and DNA-damage-inducible 45 gamma; a 99.84
2zkr_f266 60S ribosomal protein L7A; protein-RNA complex, 60 99.81
3jyw_G113 60S ribosomal protein L8(A); eukaryotic ribosome, 99.8
4a17_F255 RPL7A, 60S ribosomal protein L9; eukaryotic riboso 99.8
3izc_H256 60S ribosomal protein RPL8 (L7AE); eukaryotic ribo 99.8
3ffm_A167 Growth arrest and DNA-damage-inducible protein GAD 99.78
3iz5_H258 60S ribosomal protein L7A (L7AE); eukaryotic ribos 99.76
3ir9_A166 Peptide chain release factor subunit 1; structural 95.47
3oby_A352 Protein pelota homolog; SM fold, hydrolase; 2.90A 94.9
1x52_A124 Pelota homolog, CGI-17; ERF1_3 domain, structural 93.34
3j15_A357 Protein pelota; ribosome recycling, ribosome, arch 93.0
3agk_A373 Peptide chain release factor subunit 1; translatio 92.95
3e20_C441 Eukaryotic peptide chain release factor subunit 1; 91.69
2qi2_A347 Pelota, cell division protein pelota related prote 91.34
1gz0_A 253 Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O 89.74
3nk6_A 277 23S rRNA methyltransferase; nosiheptide, nosihepti 89.45
3agj_B358 Protein pelota homolog; GTP binding, translation-h 88.95
3obw_A364 Protein pelota homolog; SM fold, hydrolase; 2.60A 88.02
2vgn_A386 DOM34; translation termination factor, protein bio 87.03
1b93_A152 Protein (methylglyoxal synthase); glycolytic bypas 85.63
3mca_B390 Protein DOM34, elongation factor 1 alpha-like prot 85.02
1dt9_A437 ERF1, protein (eukaryotic peptide chain release fa 84.42
2xw6_A134 MGS, methylglyoxal synthase; lyase; 1.08A {Thermus 84.27
1ipa_A 274 RRMH, RNA 2'-O-ribose methyltransferase; DEEP tref 83.27
1vmd_A178 MGS, methylglyoxal synthase; TM1185, structural ge 82.64
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 80.17
>2xzm_U Ribosomal protein L7AE containing protein; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_U Back     alignment and structure
Probab=99.97  E-value=2.4e-32  Score=205.85  Aligned_cols=111  Identities=31%  Similarity=0.595  Sum_probs=106.8

Q ss_pred             CCCCcccHHHHHHHHHHHHHhcCCceeeHHHHHHHHhcCCeeEEEEcCCCCchhhHHHHHHHHHhCCCCEEEeCCHHHHH
Q psy16564         28 NDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLIKVDNNKKLG  107 (157)
Q Consensus        28 ~~~~~m~~~k~L~~lL~~A~~agklv~G~~~v~KaL~kgkakLVIlA~D~s~~~~~~~l~~lc~~~~Ipvi~v~sk~eLG  107 (157)
                      |++++|+++.+|+.+|++|+++|+++.|.++++++|++|+++|||||+|++|++++.+|+++|++++|||++++++.+||
T Consensus         1 ~~~~~~~i~~~l~~~L~~A~~~gkl~~G~~~v~Kai~~gka~LViiA~D~~p~~~~~~i~~lc~~~~Ip~~~v~sk~~LG   80 (126)
T 2xzm_U            1 MADQNQQLNEVLAKVIKSSNCQDAISKGLHEVLRTIEAKQALFVCVAEDCDQGNYVKLVKALCAKNEIKYVSVPKRASLG   80 (126)
T ss_dssp             --CCTHHHHHHHHHHHTTTTSSSCEEESHHHHHHHHHHTCCSEEEEESSCCSTTHHHHHHHHHHHTTCCEEEESCSHHHH
T ss_pred             CCcccccHHHHHHHHHHHHHHcCCEeecHHHHHHHHHcCCceEEEEeCCCChHHHHHHHHHHHHHhCCCEEEECCHHHHH
Confidence            58999999999999999999999999999999999999999999999999877899999999999999999999999999


Q ss_pred             HHhCCCccccCCCccceeeeEEEEEecCchh
Q psy16564        108 EWAGLSKLDNMGKARKVVGCSCVVIKVRNWF  138 (157)
Q Consensus       108 ~a~G~~~~~~~gk~rki~~~s~vaI~D~g~~  138 (157)
                      +|||+++++++|+||++++|||++|+|+|..
T Consensus        81 ~a~G~~k~d~~g~~rk~v~~s~vaI~d~g~~  111 (126)
T 2xzm_U           81 EYLGHFTANAKGEIKKVKGCSSLAIRKYAPE  111 (126)
T ss_dssp             HHHTCCCBCTTCCBSCCCCCCEEEESSCCTT
T ss_pred             HHHCCCccccccCcCceeeEEEEEEEecCcc
Confidence            9999999999999999999999999999987
>3u5c_M 40S ribosomal protein S12, 40S ribosomal protein S11-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_M Back     alignment and structure
>2ale_A SNU13, NHP2/L7AE family protein YEL026W; splicing, RNA, yeast, His-TAG, RNA binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: d.79.3.1 PDB: 1zwz_A 2ozb_A 3siu_A 3siv_A 1e7k_A Back     alignment and structure
>3o85_A Ribosomal protein L7AE; alpha beta sandwich fold, K-turn RNA binding protein, KINK T ribosomal protein; 1.81A {Giardia lamblia} Back     alignment and structure
>2aif_A Ribosomal protein L7A; high-mobility like protein, transcription factor, structural genomics, structural genomics consortium, SGC; 1.90A {Cryptosporidium parvum} SCOP: d.79.3.1 Back     alignment and structure
>2jnb_A NHP2-like protein 1; splicing, KINK-turn RNA-binding protein, NHPX, RNA binding protein; NMR {Homo sapiens} SCOP: d.79.3.1 Back     alignment and structure
>4a18_G RPL30; ribosome, eukaryotic initiation factor 6, EIF6, transla large ribosomal subunit, rRNA; 3.52A {Tetrahymena thermophila} PDB: 4a19_G 4a1b_G 4a1d_G 4adx_6 Back     alignment and structure
>3on1_A BH2414 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; HET: MSE; 1.65A {Bacillus halodurans} Back     alignment and structure
>3u5e_c L32, RP73, YL38, 60S ribosomal protein L30; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3izc_f 3izs_f 3o58_Z 3o5h_Z 1t0k_B 3u5i_c 4b6a_c 1ck2_A 1cn7_A 1nmu_B* 3jyw_2 Back     alignment and structure
>2lbw_A H/ACA ribonucleoprotein complex subunit 2; L7AE, snoRNP, scaRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} PDB: 2lbx_A Back     alignment and structure
>3j21_Z 50S ribosomal protein L30E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3v7q_A Probable ribosomal protein YLXQ; L7AE superfamily, K-turn binding, K-turn RNA, hypothetical R protein, RNA binding protein; HET: CIT; 1.55A {Bacillus subtilis} Back     alignment and structure
>1vq8_F 50S ribosomal protein L7AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: d.79.3.1 PDB: 1vq4_F* 1vq5_F* 1vq6_F* 1vq7_F* 1s72_F* 1vq9_F* 1vqk_F* 1vql_F* 1vqm_F* 1vqn_F* 1vqo_F* 1vqp_F* 1yhq_F* 1yi2_F* 1yij_F* 1yit_F* 1yj9_F* 1yjn_F* 1yjw_F* 2otj_F* ... Back     alignment and structure
>2fc3_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich, ribosome, RNA binding protein; 1.56A {Aeropyrum pernix} SCOP: d.79.3.1 PDB: 3pla_C* 3id5_C* 3hax_D* 2hvy_D* 3hay_D* 3nvi_B 3nmu_C 3nvk_E* 3lwr_C 3lwo_C* 3lwq_C* 3lwp_C 3lwv_C 3hjw_C* 2czw_A 1pxw_A Back     alignment and structure
>1rlg_A 50S ribosomal protein L7AE; protein-RNA, structural protein/RNA complex; HET: 5BU; 2.70A {Archaeoglobus fulgidus} SCOP: d.79.3.1 Back     alignment and structure
>1w41_A 50S ribosomal protein L30E; electrostatic interactions, thermostability, protein engineering; 1.7A {Thermococcus celer} SCOP: d.79.3.1 PDB: 3n4y_A 3lfo_A 1w40_A 1go0_A 1go1_A 1h7m_A 1w42_A 1w3e_X 3ra6_A 3ra5_A 3n4z_A 2bo1_A Back     alignment and structure
>3cpq_A 50S ribosomal protein L30E; RNA-protein, elongation factor, ribonucleoprotein, structural genomics, NPPSFA; 1.90A {Methanocaldococcus jannaschii} Back     alignment and structure
>2kg4_A Growth arrest and DNA-damage-inducible protein GA alpha; GADD45, flexible regions, monomer cycle; NMR {Homo sapiens} Back     alignment and structure
>1xbi_A 50S ribosomal protein L7AE; alpha-beta-alpha sandwich fold, RNA binding protein/structural protein complex; HET: EPE; 1.45A {Methanocaldococcus jannaschii} SCOP: d.79.3.1 PDB: 1ra4_A* 1sds_A 3paf_A Back     alignment and structure
>3vi6_A 60S ribosomal protein L30; three-layer alpha/beta/ALPA; 1.59A {Homo sapiens} PDB: 2zkr_6 1ysh_C Back     alignment and structure
>3v7e_A Ribosome-associated protein L7AE-like; RNA-protein complex, K-turn, L7AE-like, A member L7AE/L30E superfamily; HET: SAM; 2.80A {Bacillus subtilis} Back     alignment and structure
>3cg6_A Growth arrest and DNA-damage-inducible 45 gamma; alpha/beta, cell cycle; 1.70A {Mus musculus} PDB: 2wal_A Back     alignment and structure
>2zkr_f 60S ribosomal protein L7A; protein-RNA complex, 60S ribosomal subunit, ribosomal protein/RNA complex; 8.70A {Canis familiaris} Back     alignment and structure
>3jyw_G 60S ribosomal protein L8(A); eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} PDB: 1s1i_G Back     alignment and structure
>4a17_F RPL7A, 60S ribosomal protein L9; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_F 4a1c_F 4a1e_F Back     alignment and structure
>3ffm_A Growth arrest and DNA-damage-inducible protein GADD45 gamma; beta-turn-helix, cell cycle; 2.30A {Homo sapiens} Back     alignment and structure
>3ir9_A Peptide chain release factor subunit 1; structural genomics, APC36528.1, C-terminal domain, PSI-2, protein structure initiative; 2.21A {Methanosarcina mazei} Back     alignment and structure
>3oby_A Protein pelota homolog; SM fold, hydrolase; 2.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1x52_A Pelota homolog, CGI-17; ERF1_3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.79.3.2 Back     alignment and structure
>3j15_A Protein pelota; ribosome recycling, ribosome, archaea, translation-transport complex; HET: ADP; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3agk_A Peptide chain release factor subunit 1; translation; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3e20_C Eukaryotic peptide chain release factor subunit 1; SUP35, SUP45, translation termination, peptide release, GTP- nucleotide-binding; 3.50A {Schizosaccharomyces pombe} Back     alignment and structure
>2qi2_A Pelota, cell division protein pelota related protein; DOM34, cell cycle; 2.90A {Thermoplasma acidophilum} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 Back     alignment and structure
>1gz0_A Hypothetical tRNA/RRNA methyltransferase YJFH; 2'O-methyltransferase, knot, montreal- kingston bacterial structural genomics initiative, BSGI; 2.5A {Escherichia coli} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>3nk6_A 23S rRNA methyltransferase; nosiheptide, nosiheptide-resistance methyltransferase, 23S R methyltransferase; 2.00A {Streptomyces actuosus} PDB: 3nk7_A* 3gyq_A* Back     alignment and structure
>3agj_B Protein pelota homolog; GTP binding, translation-hydrolase complex; HET: GTP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3obw_A Protein pelota homolog; SM fold, hydrolase; 2.60A {Sulfolobus solfataricus} Back     alignment and structure
>2vgn_A DOM34; translation termination factor, protein biosynthesis, translation regulation, cell division, mRNA degradation; 2.5A {Saccharomyces cerevisiae} SCOP: b.38.4.1 c.55.4.2 d.79.3.2 PDB: 2vgm_A 3izq_0 3j16_A* Back     alignment and structure
>1b93_A Protein (methylglyoxal synthase); glycolytic bypass, lyase; 1.90A {Escherichia coli} SCOP: c.24.1.2 PDB: 1egh_A 1ik4_A* 1s8a_A 1s89_A Back     alignment and structure
>3mca_B Protein DOM34, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1dt9_A ERF1, protein (eukaryotic peptide chain release factor subunit 1); tRNA mimicry, protein sythesis, STOP codon recognition, peptidyl-tRNA hydrolysis; 2.70A {Homo sapiens} SCOP: c.55.4.2 d.79.3.2 d.91.1.1 PDB: 3e1y_A* 2ktu_A 2ktv_A 2lgt_A 2hst_A Back     alignment and structure
>2xw6_A MGS, methylglyoxal synthase; lyase; 1.08A {Thermus SP} PDB: 2x8w_A 1wo8_A Back     alignment and structure
>1ipa_A RRMH, RNA 2'-O-ribose methyltransferase; DEEP trefoil knot, rossmann fold, EL30-like fold, riken structural genomics/proteomics initiative; 2.40A {Thermus thermophilus} SCOP: c.116.1.1 d.79.3.3 Back     alignment and structure
>1vmd_A MGS, methylglyoxal synthase; TM1185, structural genomics, JCSG, P structure initiative, PSI, joint center for structural GENO lyase; 2.06A {Thermotoga maritima} SCOP: c.24.1.2 Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d2fc3a1124 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyr 9e-20
d1rlga_113 d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Arc 5e-19
d1vqof1119 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeo 9e-19
d2alea1126 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein 2e-17
d2ozba1125 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Hu 1e-16
d2aifa1115 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Crypto 3e-16
d1xbia1115 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeo 6e-16
d2bo1a1100 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L3 3e-15
d1w3ex198 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 5e-13
d1t0kb_97 d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L3 6e-13
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Ribosomal protein L7ae
species: Aeropyrum pernix [TaxId: 56636]

 Score = 77.6 bits (191), Expect = 9e-20
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 34  DINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEH 93
           D+ +   + +K AR    + KG +E  KA++R  A+L V+A++ D P     +  LC E 
Sbjct: 11  DLAEKAYEAVKRARETGRIKKGTNETTKAVERGLAKLVVIAEDVDPPEIVMHLPLLCDEK 70

Query: 94  QIPLIKVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIK 133
           +IP + V + K+LGE AG+            V  + V I 
Sbjct: 71  KIPYVYVPSKKRLGEAAGIE-----------VAAASVAII 99
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 113 Back     information, alignment and structure
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 119 Back     information, alignment and structure
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Length = 115 Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 115 Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 100 Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Length = 98 Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d2alea1126 Small nuclear ribonucleoprotein-associated protein 99.94
d1vqof1119 Ribosomal protein L7ae {Archaeon Haloarcula marism 99.93
d1w3ex198 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.93
d2aifa1115 Ribosomal protein L7ae {Cryptosporidium parvum [Ta 99.93
d2ozba1125 Spliceosomal 15.5kd protein {Human (Homo sapiens) 99.93
d1t0kb_97 Eukaryotic ribosomal protein L30 (L30e) {Baker's y 99.92
d1rlga_113 Ribosomal protein L7ae {Archaeon Archaeoglobus ful 99.92
d2fc3a1124 Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 5 99.92
d2bo1a1100 Eukaryotic ribosomal protein L30 (L30e) {Archaeon 99.92
d1xbia1115 Ribosomal protein L7ae {Archaeon Methanococcus jan 99.9
d1gz0a276 RlmB, N-terminal domain {Escherichia coli [TaxId: 97.36
d1dt9a2146 C-terminal domain of eukaryotic peptide chain rele 95.42
d2qi2a395 Cell division protein pelota {Thermoplasma acidoph 95.06
d2vgna3104 Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} 94.88
d1x52a1111 Cell division protein pelota {Human (Homo sapiens) 94.83
d1ipaa2105 RrmA (RrmH), N-terminal domain {Thermus thermophil 86.28
d1wo8a1126 Methylglyoxal synthase, MgsA {Thermus thermophilus 81.15
>d2alea1 d.79.3.1 (A:1-126) Small nuclear ribonucleoprotein-associated protein 1, Snu13p {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: L30e-like
family: L30e/L7ae ribosomal proteins
domain: Small nuclear ribonucleoprotein-associated protein 1, Snu13p
species: Saccharomyces cerevisiae [TaxId: 4932]

Probab=99.94  E-value=7.9e-27  Score=173.88  Aligned_cols=105  Identities=21%  Similarity=0.363  Sum_probs=95.2

Q ss_pred             cccCCCCCCCCCCcccHHHHHHHHHHHHHhcCCceeeHHHHHHHHhcCCeeEEEEcCCCCchhhHHHHHHHHHhCCCCEE
Q psy16564         19 TATDNVPSANDEGVSDINKALQQVLKTARAHDGLAKGLHEAAKALDRREAQLCVLADNCDEPAYKKLVQALCSEHQIPLI   98 (157)
Q Consensus        19 ~~~~~~~~p~~~~~m~~~k~L~~lL~~A~~agklv~G~~~v~KaL~kgkakLVIlA~D~s~~~~~~~l~~lc~~~~Ipvi   98 (157)
                      +.+||+|+|+++.+  +++.+.++|+.|+++|+++.|.++|+++|++|+++|||||+|++|.++..+++.+|++++||++
T Consensus         2 ~~~~~~a~P~a~~~--l~~~i~~ll~~a~~~~~l~~G~~ev~K~i~~g~a~lVviA~D~~p~~~~~~l~~lc~~~~Ip~~   79 (126)
T d2alea1           2 SAPNPKAFPLADAA--LTQQILDVVQQAANLRQLKKGANEATKTLNRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYV   79 (126)
T ss_dssp             CCCCTTCCSBCCHH--HHHHHHHHHHHHHHTTCEEESHHHHHHHHHHTCEEEEEEETTCSSGGGGTHHHHHHHHHTCCEE
T ss_pred             CCCCCccCCCCCHH--HHHHHHHHHHHHHHcCCcccCHHHHHHHHHcCCCeEEEEeCCCChHHHHHHHHHHHhccCCCEE
Confidence            46899999999997  7777779999999999999999999999999999999999999998899999999999999999


Q ss_pred             EeCCHHHHHHHhCCCccccCCCccceeeeEEEEEecCc
Q psy16564         99 KVDNNKKLGEWAGLSKLDNMGKARKVVGCSCVVIKVRN  136 (157)
Q Consensus        99 ~v~sk~eLG~a~G~~~~~~~gk~rki~~~s~vaI~D~g  136 (157)
                      +++++.+||+|||++           +++++++|.+.+
T Consensus        80 ~v~sk~~LG~a~G~~-----------~~~~~~~i~~~~  106 (126)
T d2alea1          80 FVPSRVALGRACGVS-----------RPVIAASITTND  106 (126)
T ss_dssp             EESCHHHHHHHTTCS-----------SCCSEEEEECCT
T ss_pred             EECchhHHHHHhCCC-----------CCeEEEEEeccc
Confidence            999999999999986           345566665443
>d1vqof1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1w3ex1 d.79.3.1 (X:1-98) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d2aifa1 d.79.3.1 (A:16-130) Ribosomal protein L7ae {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2ozba1 d.79.3.1 (A:4-128) Spliceosomal 15.5kd protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0kb_ d.79.3.1 (B:) Eukaryotic ribosomal protein L30 (L30e) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bo1a1 d.79.3.1 (A:1-100) Eukaryotic ribosomal protein L30 (L30e) {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1xbia1 d.79.3.1 (A:2-116) Ribosomal protein L7ae {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gz0a2 d.79.3.3 (A:2-77) RlmB, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dt9a2 d.79.3.2 (A:277-422) C-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qi2a3 d.79.3.2 (A:244-338) Cell division protein pelota {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2vgna3 d.79.3.2 (A:278-381) Dom34 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1x52a1 d.79.3.2 (A:8-118) Cell division protein pelota {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ipaa2 d.79.3.3 (A:1-105) RrmA (RrmH), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wo8a1 c.24.1.2 (A:1-126) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure