Psyllid ID: psy16633

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540

AIAKLGWLEPTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKALETPQINSTNNRKRKRDKESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDEVKGFEYRAKDAWRSNYFEDNPTDLETLRHDKALYTVRIQSHLADVPDYIVPPALKKLARIEDDGDEDVRAEPITDEEYNKQYEEYKKRSKENERN

ccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHcccccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHcccccEEEEccHHHHHHHHcccccccccccEEEEEcccHHcccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEEEcHHHHHHHcccHHHHccccHHHcHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHccccccccccccccccHHccccccccccccccccccccccHHHHHHHHHcccccccccc

cEEEEccccccccccHHHccccccccHHHHHHHHHcccccccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcHcccccccccccEEEEEccHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHcccEEEEEccHHHHHHHHcccccHHHHEEEEEHHHHHHHHHccccHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEEEHHHcccccccccccccEEcccccccccccEccccEEEEEEcccccHHHHEEEEccccccccccEEEEEEcccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccEEEccccccccHHcccHcHHHHHccccccccccccccccHHHHHHHHHHHHHHcHHcccc

aiaklgwlepTLIQVYFelpftftlfCIPLQAiaklgwleptliqERAIPLILQNKDVLVRartgsgktgafAIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMkcsrdvkcvdiseqvdvsvqepllverpdivvaTPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHlilrnpvilkleepaiapvsqlAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKIStcvlnselpakaRCHAVYQFNQGLYDVIIASdekaletpqinstnnrkrkrdkesgvsrgidfqfvsnvinfdfpldIQCYIHragrtargknqgtaLSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLmtnlheddfiikpyqfnldevkgfeyrakdawrsnyfednptdletlrhdKALYTVRIQShladvpdyivppalKKLArieddgdedvraepitdeeYNKQYEEYKKRSKENERN

aiaklgwlepTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGsgktgafaIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQvdvsvqepllverpdivvATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKaletpqinstnnrkrkrdkesgvsrgidfqfVSNVINFDFPLDIQCYIHRAgrtargknqGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDEVKGFEYRakdawrsnyfednptdletLRHDKALYTVRIQshladvpdyiVPPALKKLarieddgdedvraepitdeeynkqyeeykkrskenern

***KLGWLEPTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIAS***************************RGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDEVKGFEYRAKDAWRSNYFEDNPTDLETLRHDKALYTVRIQSHLADVPDYIVPPAL*****************************************

*********PTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQ***************ALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPA*APVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKALE******************GVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDGTAL**********************************NLDEVKGFEYRAKDAWRSNYFEDNPTDLE*****************ADVPDY***********************************************

AIAKLGWLEPTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKALETPQIN**************VSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDEVKGFEYRAKDAWRSNYFEDNPTDLETLRHDKALYTVRIQSHLADVPDYIVPPALKKLARIEDDGDEDVRAEPITDEEYNKQYE************

AIAKLGWLEPTLIQVYFELPFTFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQVQETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKALET********RKRKRD*ESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLH*****IKPY*FNLDEVKGFEYRAKDAWRSNYFEDNPTDLETLRHDKALYTVRIQSHLADVPDYIVPPALKKLAR***********EPITDEEYNKQYEEYKKRS******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		540	2.2.26 [Sep-21-2011]
Q9NY93		547	Probable ATP-dependent RN	yes	N/A	0.844	0.833	0.467	1e-125
Q9D0R4		546	Probable ATP-dependent RN	yes	N/A	0.838	0.829	0.460	1e-123
Q3SZ40		546	Probable ATP-dependent RN	yes	N/A	0.840	0.831	0.455	1e-123
A6SNX1		607	ATP-dependent RNA helicas	N/A	N/A	0.861	0.766	0.396	1e-105
A7EM78		607	ATP-dependent RNA helicas	N/A	N/A	0.861	0.766	0.395	1e-103
Q2UFL0		605	ATP-dependent RNA helicas	yes	N/A	0.855	0.763	0.395	1e-102
Q0CY48		619	ATP-dependent RNA helicas	N/A	N/A	0.924	0.806	0.373	1e-101
Q4X0C2		649	ATP-dependent RNA helicas	yes	N/A	0.870	0.724	0.389	1e-100
A1C7F7		621	ATP-dependent RNA helicas	N/A	N/A	0.909	0.790	0.372	1e-100
A1DHV3		619	ATP-dependent RNA helicas	N/A	N/A	0.870	0.759	0.386	1e-100

>sp\|Q9NY93\|DDX56_HUMAN Probable ATP-dependent RNA helicase DDX56 OS=Homo sapiens GN=DDX56 PE=1 SV=1	Back alignment and function desciption

 Score =  448 bits (1152), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/507 (46%), Positives = 326/507 (64%), Gaps = 51/507 (10%)

Query: 30  LQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQV 89
           LQA+  LGW  PTLIQE+AIPL L+ KD+L RARTGSGKT A+AIPM+Q +++ K T  V
Sbjct: 19  LQAVTDLGWSRPTLIQEKAIPLALEGKDLLARARTGSGKTAAYAIPMLQLLLHRKATGPV 78

Query: 90  --QETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIV 147
             Q  + LVL P+KEL  Q    IQ+L   C+RDV+  ++S   D   Q  +L+E+PD+V
Sbjct: 79  VEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVV 138

Query: 148 VATPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASA 207
           V TP+R L+HL+  +L L+ SLE++++DEADL+FSFG+E+++K++L  LP++YQA L SA
Sbjct: 139 VGTPSRILSHLQQDSLKLRDSLELLVVDEADLLFSFGFEEELKSLLCHLPRIYQAFLMSA 198

Query: 208 TLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQ-EDEKATILYTLLKLNLVQ 266
           T +EDV +LK LIL NPV LKL+E  +    QL  + ++ + E++K  +LY LLKL+L++
Sbjct: 199 TFNEDVQALKELILHNPVTLKLQESQLPGPDQLQQFQVVCETEEDKFLLLYALLKLSLIR 258

Query: 267 GKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEK 326
           GK+++FVNT+++ Y+L+L+LEQF I TCVLN ELP ++RCH + QFNQG YD +IA+D +
Sbjct: 259 GKSLLFVNTLERSYRLRLFLEQFSIPTCVLNGELPLRSRCHIISQFNQGFYDCVIATDAE 318

Query: 327 ALETPQINSTNNRKRKRDK----ESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTAR 382
            L  P       R  K DK    E+GV+RGIDF  VS V+NFD P   + YIHRAGRTAR
Sbjct: 319 VLGAPVKGKRRGRGPKGDKASDPEAGVARGIDFHHVSAVLNFDLPPTPEAYIHRAGRTAR 378

Query: 383 GKNQGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFN 442
             N G  L+FV   EQ          F   + ++L++  N            I+ PYQF 
Sbjct: 379 ANNPGIVLTFVLPTEQ----------FHLGKIEELLSGENR---------GPILLPYQFR 419

Query: 443 LDEVKGFEYRAKDAWRS-------------------------NYFEDNPTDLETLRHDKA 477
           ++E++GF YR +DA RS                          YFEDNP DL+ LRHD  
Sbjct: 420 MEEIEGFRYRCRDAMRSVTKQAIREARLKEIKEELLHSEKLKTYFEDNPRDLQLLRHDLP 479

Query: 478 LYTVRIQSHLADVPDYIVPPALKKLAR 504
           L+   ++ HL  VPDY+VPPAL+ L R
Sbjct: 480 LHPAVVKPHLGHVPDYLVPPALRGLVR 506

May play a role in later stages of the processing of the pre-ribosomal particles leading to mature 60S ribosomal subunits. Has intrinsic ATPase activity.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q9D0R4\|DDX56_MOUSE Probable ATP-dependent RNA helicase DDX56 OS=Mus musculus GN=Ddx56 PE=2 SV=1	Back alignment and function description

>sp\|Q3SZ40\|DDX56_BOVIN Probable ATP-dependent RNA helicase DDX56 OS=Bos taurus GN=DDX56 PE=2 SV=1	Back alignment and function description

>sp\|A6SNX1\|DBP9_BOTFB ATP-dependent RNA helicase dbp9 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp9 PE=3 SV=2	Back alignment and function description

>sp\|A7EM78\|DBP9_SCLS1 ATP-dependent RNA helicase dbp9 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp9 PE=3 SV=1	Back alignment and function description

>sp\|Q2UFL0\|DBP9_ASPOR ATP-dependent RNA helicase dbp9 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp9 PE=3 SV=1	Back alignment and function description

>sp\|Q0CY48\|DBP9_ASPTN ATP-dependent RNA helicase dbp9 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp9 PE=3 SV=2	Back alignment and function description

>sp\|Q4X0C2\|DBP9_ASPFU ATP-dependent RNA helicase dbp9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp9 PE=3 SV=1	Back alignment and function description

>sp\|A1C7F7\|DBP9_ASPCL ATP-dependent RNA helicase dbp9 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp9 PE=3 SV=1	Back alignment and function description

>sp\|A1DHV3\|DBP9_NEOFI ATP-dependent RNA helicase dbp9 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp9 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		540
156552886		555	PREDICTED: probable ATP-dependent RNA he	0.848	0.825	0.628	0.0
270002128		550	hypothetical protein TcasGA2_TC001089 [T	0.844	0.829	0.636	1e-180
91077434		647	PREDICTED: similar to ATP-dependent RNA	0.844	0.704	0.636	1e-179
340726173		550	PREDICTED: probable ATP-dependent RNA he	0.848	0.832	0.614	1e-179
350405187		550	PREDICTED: probable ATP-dependent RNA he	0.842	0.827	0.618	1e-179
307199009		547	Probable ATP-dependent RNA helicase DDX5	0.848	0.837	0.630	1e-176
380024218		551	PREDICTED: LOW QUALITY PROTEIN: probable	0.842	0.825	0.602	1e-176
383862497		547	PREDICTED: probable ATP-dependent RNA he	0.848	0.837	0.610	1e-176
328778265		552	PREDICTED: probable ATP-dependent RNA he	0.842	0.824	0.602	1e-174
242010319		544	DEAD box ATP-dependent RNA helicase, put	0.846	0.840	0.588	1e-172

>gi\|156552886\|ref\|XP_001600943.1\| PREDICTED: probable ATP-dependent RNA helicase DDX56 [Nasonia vitripennis]	Back alignment and taxonomy information

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/501 (62%), Positives = 387/501 (77%), Gaps = 43/501 (8%)

Query: 30  LQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQV 89
           L+AIAKLGWLEPTLIQE+ IPLIL  KDVLVRARTGSGKTGAFA+P++QKI++ K+T Q 
Sbjct: 32  LKAIAKLGWLEPTLIQEKTIPLILDGKDVLVRARTGSGKTGAFAVPLVQKILSNKETQQH 91

Query: 90  QETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVA 149
           Q+T  L+L+PSKELC Q+H+    LT KCSR+V+C+DIS QV++SVQ+PLL E PDIV+A
Sbjct: 92  QQTTGLILAPSKELCKQIHEVFVNLTTKCSREVRCLDISPQVELSVQKPLLAENPDIVIA 151

Query: 150 TPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATL 209
           TP RAL HLKAK L++K SLE +IIDEADL+FSFGYE+++K +L +LP +YQAILASATL
Sbjct: 152 TPGRALQHLKAKNLNVKKSLETLIIDEADLIFSFGYEEEIKTLLAYLPTVYQAILASATL 211

Query: 210 SEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQGKT 269
           SEDVLSLK L+L NP ILKLEEP +AP SQLAHY + A+E++KA ILY LLKL+L++GK 
Sbjct: 212 SEDVLSLKKLVLHNPAILKLEEPPLAPPSQLAHYTLAAEENDKAAILYALLKLHLIRGKC 271

Query: 270 IIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKALE 329
           IIFVNTVD+CYKLKL+LEQF I TCVLNSELPA +RC AV QFN G YD+IIASDEKALE
Sbjct: 272 IIFVNTVDRCYKLKLFLEQFGIPTCVLNSELPASSRCRAVTQFNSGTYDIIIASDEKALE 331

Query: 330 TPQINSTNNRKRKRDKESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTA 389
            P +      KR++DKESGV+RGIDFQFVSNVINFDFPLDI  YIHRAGRTARGKNQGTA
Sbjct: 332 EPHVMKQKRGKRRKDKESGVARGIDFQFVSNVINFDFPLDINAYIHRAGRTARGKNQGTA 391

Query: 390 LSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDEVKGF 449
                            LSFV++RE+ ++  V E L  +  +++ + K YQF L+EV+GF
Sbjct: 392 -----------------LSFVAIRERPMLEQVEEQLKKDYGQEN-LFKTYQFKLNEVEGF 433

Query: 450 EYRAKDAWRS-------------------------NYFEDNPTDLETLRHDKALYTVRIQ 484
            YR++DAW++                         +YFEDNP DL++LR DKAL+TVR+Q
Sbjct: 434 RYRSRDAWKAVTRIAVREARLKEIKQEVLTCDKLKSYFEDNPRDLQSLRQDKALHTVRLQ 493

Query: 485 SHLADVPDYIVPPALKKLARI 505
           +HL DVP+YIVP +LK +A I
Sbjct: 494 AHLKDVPEYIVPASLKSMANI 514

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270002128\|gb\|EEZ98575.1\| hypothetical protein TcasGA2_TC001089 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|91077434\|ref\|XP_966623.1\| PREDICTED: similar to ATP-dependent RNA helicase DBP9 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|340726173\|ref\|XP_003401436.1\| PREDICTED: probable ATP-dependent RNA helicase DDX56-like [Bombus terrestris]	Back alignment and taxonomy information

>gi\|350405187\|ref\|XP_003487352.1\| PREDICTED: probable ATP-dependent RNA helicase DDX56-like [Bombus impatiens]	Back alignment and taxonomy information

>gi\|307199009\|gb\|EFN79733.1\| Probable ATP-dependent RNA helicase DDX56 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|380024218\|ref\|XP_003695902.1\| PREDICTED: LOW QUALITY PROTEIN: probable ATP-dependent RNA helicase DDX56-like [Apis florea]	Back alignment and taxonomy information

>gi\|383862497\|ref\|XP_003706720.1\| PREDICTED: probable ATP-dependent RNA helicase DDX56-like [Megachile rotundata]	Back alignment and taxonomy information

>gi\|328778265\|ref\|XP_391920.3\| PREDICTED: probable ATP-dependent RNA helicase DDX56 isoform 1 [Apis mellifera]	Back alignment and taxonomy information

>gi\|242010319\|ref\|XP_002425916.1\| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi\|212509892\|gb\|EEB13178.1\| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		540
FB\|FBgn0001565		560	Hlc "Helicase" [Drosophila mel	0.846	0.816	0.517	1.1e-129
ZFIN\|ZDB-GENE-040825-3		557	ddx56 "DEAD (Asp-Glu-Ala-Asp)	0.840	0.815	0.505	1.6e-128
UNIPROTKB\|Q9NY93		547	DDX56 "Probable ATP-dependent	0.844	0.833	0.467	4.7e-116
MGI\|MGI:1277172		546	Ddx56 "DEAD (Asp-Glu-Ala-Asp)	0.838	0.829	0.460	2e-115
UNIPROTKB\|G3V6M5		546	Ddx56 "Protein Ddx56" [Rattus	0.838	0.829	0.462	8.7e-115
UNIPROTKB\|Q3SZ40		546	DDX56 "Probable ATP-dependent	0.840	0.831	0.459	1.4e-114
UNIPROTKB\|F1SSH6		545	DDX56 "Uncharacterized protein	0.842	0.834	0.440	3.1e-108
SGD\|S000004266		594	DBP9 "DEAD-box protein require	0.611	0.555	0.395	1.1e-98
ASPGD\|ASPL0000000390		610	AN6374 [Emericella nidulans (t	0.572	0.506	0.451	3e-98
UNIPROTKB\|G3V0G3		375	DDX56 "DEAD (Asp-Glu-Ala-Asp)	0.648	0.933	0.515	3.3e-98

FB\|FBgn0001565 Hlc "Helicase" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 1235 (439.8 bits), Expect = 1.1e-129, Sum P(2) = 1.1e-129
 Identities = 260/502 (51%), Positives = 341/502 (67%)

Query:    30 LQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQV 89
             L+A+A+LGW +PTLIQ  AIPL+L+ KDV+VRARTGSGKT  +A+P+IQKI+N K  A  
Sbjct:    21 LKAVAQLGWQQPTLIQSTAIPLLLEGKDVVVRARTGSGKTATYALPLIQKILNSKLNASE 80

Query:    90 QETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQV-DVSVQEPLLVERPDIVV 148
             Q   A+VL+P+KELC Q  K I++L   C + V+  DI++   D   Q   L E PDIVV
Sbjct:    81 QYVSAVVLAPTKELCRQSRKVIEQLVESCGKVVRVADIADSSNDTVTQRHALSESPDIVV 140

Query:   149 ATPARALAHLKA-KTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASA 207
             ATPA  LA+ +A   +DLK  +E +++DEADLVF++GYE D K ++K LP +YQA+L SA
Sbjct:   141 ATPANLLAYAEAGSVVDLKH-VETLVVDEADLVFAYGYEKDFKRLIKHLPPIYQAVLVSA 199

Query:   208 TLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLVQG 267
             TL++DV+ +K L L NPV LKLEEP + P  QL+H  ILA+E++K  ILY LLKL L++G
Sbjct:   200 TLTDDVVRMKGLCLNNPVTLKLEEPELVPQDQLSHQRILAEENDKPAILYALLKLRLIRG 259

Query:   268 KTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKA 327
             K+IIFVN++D+CYK++L+LEQF I  CVLNSELPA  R H + QFN+G YD+IIASDE  
Sbjct:   260 KSIIFVNSIDRCYKVRLFLEQFGIRACVLNSELPANIRIHTISQFNKGTYDIIIASDEHH 319

Query:   328 LETPQINSTNNRKRKR--DKESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKN 385
             +E P   S  NRK  R  D ES  SRGIDFQ V+NVINFDFP D+  YIHRAGRTARG N
Sbjct:   320 MEKPGGKSATNRKSPRSGDMESSASRGIDFQCVNNVINFDFPRDVTSYIHRAGRTARGNN 379

Query:   386 QGTALSFVSLREQDLMNDGTALSFVSLREQDLMNDVNEYLMTNLHEDDFIIKPYQFNLDE 445
             +G+ LSFVS++E  + ND          E+ L +           E + IIK YQF ++E
Sbjct:   380 KGSVLSFVSMKESKV-NDSV--------EKKLCDSFAA------QEGEQIIKNYQFKMEE 424

Query:   446 VKGFEYRAKDAWRS-------------------N------YFEDNPTDLETLRHDKALYT 480
             V+ F YRA+D WR+                   N      +FE+N  DL+ LRHDK L  
Sbjct:   425 VESFRYRAQDCWRAATRVAVHDTRIREIKIEILNCEKLKAFFEENKRDLQALRHDKPLRA 484

Query:   481 VRIQSHLADVPDYIVPPALKKL 502
             +++QSHL+D+P+YIVP ALK++
Sbjct:   485 IKVQSHLSDMPEYIVPKALKRV 506

GO:0004004 "ATP-dependent RNA helicase activity" evidence=ISS

GO:0005524 "ATP binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0022008 "neurogenesis" evidence=IMP

ZFIN\|ZDB-GENE-040825-3 ddx56 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 56" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NY93 DDX56 "Probable ATP-dependent RNA helicase DDX56" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1277172 Ddx56 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 56" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V6M5 Ddx56 "Protein Ddx56" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZ40 DDX56 "Probable ATP-dependent RNA helicase DDX56" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SSH6 DDX56 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

SGD\|S000004266 DBP9 "DEAD-box protein required for 27S rRNA processing" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000000390 AN6374 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V0G3 DDX56 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 56, isoform CRA_a" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9D0R4	DDX56_MOUSE	3, ., 6, ., 4, ., 1, 3	0.4604	0.8388	0.8296	yes	N/A
Q6BLM5	DBP9_DEBHA	3, ., 6, ., 4, ., 1, 3	0.3714	0.8703	0.8020	yes	N/A
Q9SW44	RH16_ARATH	3, ., 6, ., 4, ., 1, 3	0.3561	0.8314	0.7172	yes	N/A
Q4X0C2	DBP9_ASPFU	3, ., 6, ., 4, ., 1, 3	0.3897	0.8703	0.7241	yes	N/A
Q06218	DBP9_YEAST	3, ., 6, ., 4, ., 1, 3	0.3686	0.8888	0.8080	yes	N/A
Q6ATJ8	RH16_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.3493	0.8462	0.6820	yes	N/A
Q6BZR4	DBP9_YARLI	3, ., 6, ., 4, ., 1, 3	0.3704	0.8425	0.8363	yes	N/A
Q6FUA6	DBP9_CANGA	3, ., 6, ., 4, ., 1, 3	0.3729	0.8703	0.7899	yes	N/A
Q9NY93	DDX56_HUMAN	3, ., 6, ., 4, ., 1, 3	0.4674	0.8444	0.8336	yes	N/A
O60080	DBP9_SCHPO	3, ., 6, ., 4, ., 1, 3	0.3505	0.8462	0.7680	yes	N/A
Q5AZA6	DBP9_EMENI	3, ., 6, ., 4, ., 1, 3	0.3966	0.8703	0.7704	yes	N/A
Q4IJ56	DBP9_GIBZE	3, ., 6, ., 4, ., 1, 3	0.3801	0.8740	0.7674	yes	N/A
Q6CUI6	DBP9_KLULA	3, ., 6, ., 4, ., 1, 3	0.3646	0.8611	0.7828	yes	N/A
Q74ZC1	DBP9_ASHGO	3, ., 6, ., 4, ., 1, 3	0.3716	0.8944	0.8117	yes	N/A
A2QCW6	DBP9_ASPNC	3, ., 6, ., 4, ., 1, 3	0.3826	0.8703	0.7629	yes	N/A
P0CR10	DBP9_CRYNJ	3, ., 6, ., 4, ., 1, 3	0.3728	0.8944	0.7703	yes	N/A
A3LV40	DBP9_PICST	3, ., 6, ., 4, ., 1, 3	0.3719	0.8703	0.8089	yes	N/A
Q3SZ40	DDX56_BOVIN	3, ., 6, ., 4, ., 1, 3	0.4554	0.8407	0.8315	yes	N/A
Q2UFL0	DBP9_ASPOR	3, ., 6, ., 4, ., 1, 3	0.3953	0.8555	0.7636	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	0.824
3rd Layer	3.6.4	0.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		540
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	4e-89
cd00268		203	cd00268, DEADc, DEAD-box helicases	2e-57
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	1e-56
PRK11192		434	PRK11192, PRK11192, ATP-dependent RNA helicase Srm	5e-54
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	1e-46
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	2e-45
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	8e-43
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	3e-41
PRK04537		572	PRK04537, PRK04537, ATP-dependent RNA helicase Rhl	3e-39
PTZ00424		401	PTZ00424, PTZ00424, helicase 45; Provisional	2e-38
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	5e-36
PRK04837		423	PRK04837, PRK04837, ATP-dependent RNA helicase Rhl	1e-32
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	3e-28
PTZ00110		545	PTZ00110, PTZ00110, helicase; Provisional	6e-26
PLN00206		518	PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel	6e-26
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	5e-23
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	7e-15
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	3e-14
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	4e-13
COG1205		851	COG1205, COG1205, Distinct helicase family with a	4e-10
cd09639		353	cd09639, Cas3_I, CRISPR/Cas system-associated prot	2e-06
PRK13767		876	PRK13767, PRK13767, ATP-dependent helicase; Provis	1e-05
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	5e-05
TIGR01587		358	TIGR01587, cas3_core, CRISPR-associated helicase C	9e-05
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	1e-04
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	2e-04
COG4581		1041	COG4581, COG4581, Superfamily II RNA helicase [DNA	3e-04
COG1204		766	COG1204, COG1204, Superfamily II helicase [General	5e-04
COG4098		441	COG4098, comFA, Superfamily II DNA/RNA helicase re	0.001
pfam04851		100	pfam04851, ResIII, Type III restriction enzyme, re	0.004

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

 Score =  283 bits (725), Expect = 4e-89
 Identities = 132/373 (35%), Positives = 201/373 (53%), Gaps = 35/373 (9%)

Query: 30  LQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQTAQV 89
           LQA+  LG+ EPT IQ  AIPLIL  +DVL +A+TG+GKT AF +P++QKI+   +   V
Sbjct: 41  LQALKDLGFEEPTPIQLAAIPLILAGRDVLGQAQTGTGKTAAFLLPLLQKILKSVERKYV 100

Query: 90  QETKALVLSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVA 149
               AL+L+P++EL  Q+ + +++L  K    ++   +   V +  Q   L    DIVVA
Sbjct: 101 S---ALILAPTRELAVQIAEELRKLG-KNLGGLRVAVVYGGVSIRKQIEALKRGVDIVVA 156

Query: 150 TPARALAHLKAKTLDLKSSLEIVIIDEADLVFSFGYEDDMKAVLKFLPKLYQAILASATL 209
           TP R L  +K   LDL S +E +++DEAD +   G+ DD++ +LK LP   Q +L SAT+
Sbjct: 157 TPGRLLDLIKRGKLDL-SGVETLVLDEADRMLDMGFIDDIEKILKALPPDRQTLLFSATM 215

Query: 210 SEDVLSLKHLILRNPVILKLE----EPAIAPVSQLAHYHILAQEDEKATILYTLLKLNLV 265
            +D+  L    L +PV +++     E  +  + Q   Y  +  E+EK  +L  LLK    
Sbjct: 216 PDDIRELARRYLNDPVEIEVSVEKLERTLKKIKQ--FYLEVESEEEKLELLLKLLKDEDE 273

Query: 266 QGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDE 325
            G+ I+FV T     +L   L +       L+ +LP + R  A+ +F  G   V++A+D 
Sbjct: 274 -GRVIVFVRTKRLVEELAESLRKRGFKVAALHGDLPQEERDRALEKFKDGELRVLVATDV 332

Query: 326 KALETPQINSTNNRKRKRDKESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKN 385
                                   +RG+D   VS+VIN+D PLD + Y+HR GRT R   
Sbjct: 333 -----------------------AARGLDIPDVSHVINYDLPLDPEDYVHRIGRTGRAGR 369

Query: 386 QGTALSFVSLREQ 398
           +G A+SFV+  E+
Sbjct: 370 KGVAISFVTEEEE 382

Length = 513

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|185609 PTZ00424, PTZ00424, helicase 45; Provisional	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|240273 PTZ00110, PTZ00110, helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|187770 cd09639, Cas3_I, CRISPR/Cas system-associated protein Cas3	Back alignment and domain information

>gnl\|CDD\|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		540
KOG0346\|consensus		569		100.0
KOG0330\|consensus		476		100.0
KOG0331\|consensus		519		100.0
KOG0338\|consensus		691		100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0340\|consensus		442		100.0
KOG0342\|consensus		543		100.0
KOG0333\|consensus		673		100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0328\|consensus		400		100.0
PTZ00110		545	helicase; Provisional	100.0
KOG0345\|consensus		567		100.0
KOG0343\|consensus		758		100.0
KOG0326\|consensus		459		100.0
KOG0348\|consensus		708		100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
KOG0336\|consensus		629		100.0
KOG0335\|consensus		482		100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0339\|consensus		731		100.0
KOG0341\|consensus		610		100.0
KOG0347\|consensus		731		100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0332\|consensus		477		100.0
KOG0337\|consensus		529		100.0
KOG0334\|consensus		997		100.0
KOG0327\|consensus		397		100.0
KOG0350\|consensus		620		100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0344\|consensus		593		100.0
KOG4284\|consensus		980		100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
KOG0329\|consensus		387		100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
KOG0948\|consensus		1041		100.0
PRK09401		1176	reverse gyrase; Reviewed	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK14701		1638	reverse gyrase; Provisional	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	100.0
KOG0349\|consensus		725		100.0
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	100.0
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	100.0
PHA02558		501	uvsW UvsW helicase; Provisional	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	100.0
KOG0352\|consensus		641		100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
PRK09200		790	preprotein translocase subunit SecA; Reviewed	100.0
COG1205		851	Distinct helicase family with a unique C-terminal	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
KOG0351\|consensus		941		100.0
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	100.0
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	100.0
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	100.0
PRK13766		773	Hef nuclease; Provisional	100.0
KOG0947\|consensus		1248		100.0
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	100.0
KOG0354\|consensus		746		100.0
KOG0353\|consensus		695		100.0
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	100.0
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	100.0
PRK05580		679	primosome assembly protein PriA; Validated	100.0
KOG0952\|consensus		1230		99.98
PRK09694		878	helicase Cas3; Provisional	99.97
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.97
PRK04914		956	ATP-dependent helicase HepA; Validated	99.97
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.97
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.97
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.96
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.96
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.96
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.96
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.96
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.96
KOG0951\|consensus		1674		99.95
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.95
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.94
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.94
KOG0950\|consensus		1008		99.93
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.93
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.92
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.91
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.9
KOG0922\|consensus		674		99.9
KOG0920\|consensus		924		99.9
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.89
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.89
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.88
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.88
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.87
PRK05298		652	excinuclease ABC subunit B; Provisional	99.86
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.86
KOG0923\|consensus		902		99.85
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.85
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.84
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.83
KOG0926\|consensus		1172		99.82
KOG0949\|consensus		1330		99.82
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.81
COG4096		875	HsdR Type I site-specific restriction-modification	99.81
KOG0924\|consensus		1042		99.8
KOG4150\|consensus		1034		99.79
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.78
KOG0953\|consensus		700		99.78
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.76
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.74
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.73
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.73
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.71
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.7
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.7
KOG0385\|consensus		971		99.7
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.67
KOG0925\|consensus		699		99.67
COG4889		1518	Predicted helicase [General function prediction on	99.67
KOG0387\|consensus		923		99.65
KOG1123\|consensus		776		99.64
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.63
KOG0390\|consensus		776		99.61
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.61
KOG0951\|consensus		1674		99.6
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	99.59
KOG1000\|consensus		689		99.53
PRK14873		665	primosome assembly protein PriA; Provisional	99.53
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.52
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	99.49
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	99.47
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.47
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	99.47
KOG0384\|consensus		1373		99.45
KOG0392\|consensus		1549		99.44
KOG0389\|consensus		941		99.43
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	99.38
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	99.31
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	99.23
KOG2340\|consensus		698		99.2
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.15
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.15
KOG0386\|consensus		1157		99.12
KOG0921\|consensus		1282		99.11
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	99.01
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	99.01
KOG1002\|consensus		791		98.98
KOG4439\|consensus		901		98.92
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	98.86
COG0610		962	Type I site-specific restriction-modification syst	98.85
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.78
KOG0388\|consensus		1185		98.66
KOG1015\|consensus		1567		98.6
PRK15483		986	type III restriction-modification system StyLTI en	98.5
KOG0952\|consensus		1230		98.5
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	98.35
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	98.26
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	98.13
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	98.08
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	98.04
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	98.0
KOG1803\|consensus		649		97.84
PRK10536		262	hypothetical protein; Provisional	97.84
KOG1802\|consensus		935		97.81
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.81
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.77
PF13245		76	AAA_19: Part of AAA domain	97.73
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.68
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.65
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.63
KOG0391\|consensus		1958		97.59
KOG0391\|consensus		1958		97.53
KOG1016\|consensus		1387		97.52
PRK13889		988	conjugal transfer relaxase TraA; Provisional	97.5
KOG1132\|consensus		945		97.49
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	97.45
COG3587		985	Restriction endonuclease [Defense mechanisms]	97.38
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	97.35
PRK06526		254	transposase; Provisional	97.3
PRK13826		1102	Dtr system oriT relaxase; Provisional	97.24
PRK08181		269	transposase; Validated	97.21
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	97.19
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	97.13
KOG1805\|consensus		1100		97.08
TIGR00376		637	DNA helicase, putative. The gene product may repre	96.96
PRK04296		190	thymidine kinase; Provisional	96.88
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	96.87
PRK08727		233	hypothetical protein; Validated	96.79
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	96.73
PHA02533		534	17 large terminase protein; Provisional	96.66
PRK08116		268	hypothetical protein; Validated	96.62
PRK06921		266	hypothetical protein; Provisional	96.61
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	96.57
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	96.51
PRK07952		244	DNA replication protein DnaC; Validated	96.51
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	96.51
PHA03333		752	putative ATPase subunit of terminase; Provisional	96.44
smart00382		148	AAA ATPases associated with a variety of cellular	96.43
PRK12377		248	putative replication protein; Provisional	96.4
PRK09183		259	transposase/IS protein; Provisional	96.37
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	96.36
PRK05642		234	DNA replication initiation factor; Validated	96.27
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	96.26
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	96.26
KOG1131\|consensus		755		96.2
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.19
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.18
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	96.17
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	96.16
PHA03368		738	DNA packaging terminase subunit 1; Provisional	96.13
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.13
PRK06835		329	DNA replication protein DnaC; Validated	96.11
PRK11054		684	helD DNA helicase IV; Provisional	96.05
PRK14974		336	cell division protein FtsY; Provisional	96.01
PRK06893		229	DNA replication initiation factor; Validated	95.97
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	95.86
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.85
KOG0989\|consensus		346		95.79
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	95.76
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	95.71
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	95.67
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	95.63
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	95.61
PRK00149		450	dnaA chromosomal replication initiation protein; R	95.6
COG1484		254	DnaC DNA replication protein [DNA replication, rec	95.56
PRK08084		235	DNA replication initiation factor; Provisional	95.53
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	95.49
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	95.47
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	95.47
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	95.43
PHA02544		316	44 clamp loader, small subunit; Provisional	95.4
PRK12422		445	chromosomal replication initiation protein; Provis	95.36
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	95.36
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	95.31
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	95.29
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	95.24
PRK13833		323	conjugal transfer protein TrbB; Provisional	95.23
PTZ00112		1164	origin recognition complex 1 protein; Provisional	95.23
PF13871		278	Helicase_C_4: Helicase_C-like	95.12
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	95.12
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	95.09
PHA03372		668	DNA packaging terminase subunit 1; Provisional	95.03
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	94.99
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	94.99
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.98
PRK14088		440	dnaA chromosomal replication initiation protein; P	94.96
PF00004		132	AAA: ATPase family associated with various cellula	94.89
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	94.87
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.87
PRK14086		617	dnaA chromosomal replication initiation protein; P	94.84
PRK00411		394	cdc6 cell division control protein 6; Reviewed	94.78
KOG0991\|consensus		333		94.76
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	94.74
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	94.71
PRK08903		227	DnaA regulatory inactivator Hda; Validated	94.69
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	94.66
PRK05580		679	primosome assembly protein PriA; Validated	94.6
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	94.6
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	94.59
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	94.55
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	94.53
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	94.52
KOG0298\|consensus		1394		94.51
PRK08769		319	DNA polymerase III subunit delta'; Validated	94.47
PRK05707		328	DNA polymerase III subunit delta'; Validated	94.46
COG3973		747	Superfamily I DNA and RNA helicases [General funct	94.43
PRK08939		306	primosomal protein DnaI; Reviewed	94.39
KOG1001\|consensus		674		94.39
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	94.38
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	94.36
PLN03025		319	replication factor C subunit; Provisional	94.34
PRK13851		344	type IV secretion system protein VirB11; Provision	94.28
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	94.28
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	94.22
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	94.19
PRK12402		337	replication factor C small subunit 2; Reviewed	94.19
COG2109		198	BtuR ATP:corrinoid adenosyltransferase [Coenzyme m	94.1
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	94.08
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	94.02
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	94.02
TIGR00595		505	priA primosomal protein N'. All proteins in this f	93.98
PRK06904		472	replicative DNA helicase; Validated	93.95
PRK09112		351	DNA polymerase III subunit delta'; Validated	93.89
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	93.88
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	93.81
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	93.81
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	93.8
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	93.78
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	93.74
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	93.72
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	93.7
PRK14873		665	primosome assembly protein PriA; Provisional	93.69
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	93.65
PF05729		166	NACHT: NACHT domain	93.64
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	93.64
KOG1133\|consensus		821		93.59
PHA00729		226	NTP-binding motif containing protein	93.59
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	93.59
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	93.57
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	93.55
PF13173		128	AAA_14: AAA domain	93.52
PRK04195		482	replication factor C large subunit; Provisional	93.52
PRK11823		446	DNA repair protein RadA; Provisional	93.49
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	93.48
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	93.43
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	93.42
PRK08533		230	flagellar accessory protein FlaH; Reviewed	93.34
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	93.33
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	93.27
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	93.27
KOG1133\|consensus		821		93.24
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	93.21
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	93.16
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	93.12
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	93.1
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	93.09
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	93.09
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	93.03
PRK00771		437	signal recognition particle protein Srp54; Provisi	93.0
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	92.84
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	92.82
CHL00181		287	cbbX CbbX; Provisional	92.75
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	92.72
PRK08699		325	DNA polymerase III subunit delta'; Validated	92.69
COG1198		730	PriA Primosomal protein N' (replication factor Y)	92.39
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	92.36
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	92.35
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	92.34
PRK08840		464	replicative DNA helicase; Provisional	92.33
PRK06871		325	DNA polymerase III subunit delta'; Validated	92.3
PRK07940		394	DNA polymerase III subunit delta'; Validated	92.23
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	92.17
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	92.16
PRK07399		314	DNA polymerase III subunit delta'; Validated	92.12
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	92.04
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	92.03
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	92.02
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	91.96
TIGR03819		340	heli_sec_ATPase helicase/secretion neighborhood AT	91.93
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	91.89
PRK10689		1147	transcription-repair coupling factor; Provisional	91.87
PRK08006		471	replicative DNA helicase; Provisional	91.85
PRK04328		249	hypothetical protein; Provisional	91.83
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	91.83
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	91.82
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	91.78
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	91.76
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	91.76
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	91.63
PRK07471		365	DNA polymerase III subunit delta'; Validated	91.62
PRK13342		413	recombination factor protein RarA; Reviewed	91.6
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	91.54
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	91.53
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	91.33
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	91.23
PRK06067		234	flagellar accessory protein FlaH; Validated	91.21
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	91.15
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	91.13
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	91.11
PRK10865		857	protein disaggregation chaperone; Provisional	91.09
COG4626		546	Phage terminase-like protein, large subunit [Gener	91.08
COG0593		408	DnaA ATPase involved in DNA replication initiation	91.07
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	91.01
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	91.0
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	90.97
PTZ00293		211	thymidine kinase; Provisional	90.94
KOG0701\|consensus		1606		90.83
PRK00440		319	rfc replication factor C small subunit; Reviewed	90.67
PRK07993		334	DNA polymerase III subunit delta'; Validated	90.62
PRK13341		725	recombination factor protein RarA/unknown domain f	90.61
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	90.55
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	90.53
PRK08506		472	replicative DNA helicase; Provisional	90.51
PRK10436		462	hypothetical protein; Provisional	90.4
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	90.38
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	90.34
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	90.34
PRK07004		460	replicative DNA helicase; Provisional	90.29
PF02572		172	CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase	90.28
TIGR00064		272	ftsY signal recognition particle-docking protein F	90.19
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	90.18
KOG1513\|consensus		1300		90.17
PRK05748		448	replicative DNA helicase; Provisional	90.02
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	89.99
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	89.95
PRK05973		237	replicative DNA helicase; Provisional	89.94
TIGR00665		434	DnaB replicative DNA helicase. This model describe	89.91
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	89.86
PRK06090		319	DNA polymerase III subunit delta'; Validated	89.86
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	89.83
PHA00350		399	putative assembly protein	89.7
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	89.7
KOG0733\|consensus		802		89.68
PRK06964		342	DNA polymerase III subunit delta'; Validated	89.55
TIGR02538		564	type_IV_pilB type IV-A pilus assembly ATPase PilB.	89.47
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	89.4
TIGR02533		486	type_II_gspE general secretory pathway protein E.	89.27
CHL00095		821	clpC Clp protease ATP binding subunit	89.23
KOG0741\|consensus		744		89.13
PRK08760		476	replicative DNA helicase; Provisional	89.1
PRK08058		329	DNA polymerase III subunit delta'; Validated	89.09
PRK10867		433	signal recognition particle protein; Provisional	89.09
PRK06321		472	replicative DNA helicase; Provisional	89.08
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	89.06
KOG0739\|consensus		439		89.05
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	89.03
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	88.97
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	88.96
PF12846		304	AAA_10: AAA-like domain	88.91
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	88.89
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	88.79
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	88.74
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	88.74
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	88.72
PRK04841		903	transcriptional regulator MalT; Provisional	88.64
COG2256		436	MGS1 ATPase related to the helicase subunit of the	88.38
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	88.28
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	88.15
PF10412		386	TrwB_AAD_bind: Type IV secretion-system coupling p	88.11
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	87.94
PF13555		62	AAA_29: P-loop containing region of AAA domain	87.89
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	87.83
PRK05595		444	replicative DNA helicase; Provisional	87.75
PRK13897		606	type IV secretion system component VirD4; Provisio	87.64
PRK13764		602	ATPase; Provisional	87.64
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	87.59
TIGR00959		428	ffh signal recognition particle protein. This mode	87.54
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	87.42
cd03115		173	SRP The signal recognition particle (SRP) mediates	87.38
KOG0741\|consensus		744		87.22
KOG0742\|consensus		630		87.21
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	87.1
PRK14701		1638	reverse gyrase; Provisional	87.06
PRK05636		505	replicative DNA helicase; Provisional	86.97
cd01127		410	TrwB Bacterial conjugation protein TrwB, ATP bindi	86.72
KOG0732\|consensus		1080		86.71
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	86.71
KOG2028\|consensus		554		86.65
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	86.64
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	86.64
PRK05416		288	glmZ(sRNA)-inactivating NTPase; Provisional	86.27
COG1074		1139	RecB ATP-dependent exoDNAse (exonuclease V) beta s	86.26
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	86.15
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	86.11
PRK13695		174	putative NTPase; Provisional	86.08
PRK09165		497	replicative DNA helicase; Provisional	86.07
PF14516		331	AAA_35: AAA-like domain	86.02
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	85.75
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	85.69
PF02456		369	Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR	85.67
KOG2004\|consensus		906		85.66
PF10593		239	Z1: Z1 domain; InterPro: IPR018310 This entry repr	85.65
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	85.62
PF01935		229	DUF87: Domain of unknown function DUF87; InterPro:	85.52
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	85.5
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	85.34
PHA00012		361	I assembly protein	85.3
PRK09087		226	hypothetical protein; Validated	85.25
PF03668		284	ATP_bind_2: P-loop ATPase protein family; InterPro	85.25
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	85.25
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	85.25
PRK13850		670	type IV secretion system protein VirD4; Provisiona	85.24
TIGR03743		634	SXT_TraD conjugative coupling factor TraD, SXT/TOL	85.22
cd03239		178	ABC_SMC_head The structural maintenance of chromos	84.69
COG0467		260	RAD55 RecA-superfamily ATPases implicated in signa	84.53
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	84.46
PRK10416		318	signal recognition particle-docking protein FtsY;	84.45
PF04665		241	Pox_A32: Poxvirus A32 protein; InterPro: IPR006758	84.4
TIGR03754		643	conj_TOL_TraD conjugative coupling factor TraD, TO	84.36
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	84.34
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	84.26
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	84.15
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	83.96
COG0210		655	UvrD Superfamily I DNA and RNA helicases [DNA repl	83.72
PHA02244		383	ATPase-like protein	83.67
PF03266		168	NTPase_1: NTPase; InterPro: IPR004948 This entry r	83.58
TIGR00767		415	rho transcription termination factor Rho. Members	83.56
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	82.98
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	82.9
PHA02542		473	41 41 helicase; Provisional	82.86
PRK05917		290	DNA polymerase III subunit delta'; Validated	82.75
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	82.67
TIGR02784		1141	addA_alphas double-strand break repair helicase Ad	82.62
PRK07413		382	hypothetical protein; Validated	82.59

>KOG0346\|consensus	Back alignment and domain information

Probab=100.00  E-value=7.4e-109  Score=798.68  Aligned_cols=472  Identities=51%  Similarity=0.854  Sum_probs=436.8

Q ss_pred             CCc-cCCCCHHHHHHHHHCCCCCChHHHHHHHHHHhcCCcEEEEcCCCchHHHHHHHHHHHHHHhhccc-ccCCCeEEEE
Q psy16633         19 LPF-TFTLFCIPLQAIAKLGWLEPTLIQERAIPLILQNKDVLVRARTGSGKTGAFAIPMIQKIINLKQT-AQVQETKALV   96 (540)
Q Consensus        19 ~~~-~~~L~~~i~~~l~~~g~~~pt~~Q~~ai~~il~gkd~li~a~TGsGKT~a~~ipil~~l~~~~~~-~~~~~~~vli   96 (540)
                      ..| +||||++|++|+.++||.+||.+|+.|||.+++|||++++|.||||||+||++|+++.++..+.. ....++.++|
T Consensus        19 ktFe~~gLD~RllkAi~~lG~ekpTlIQs~aIplaLEgKDvvarArTGSGKT~AYliPllqkll~~k~t~~~e~~~sa~i   98 (569)
T KOG0346|consen   19 KTFEEFGLDSRLLKAITKLGWEKPTLIQSSAIPLALEGKDVVARARTGSGKTAAYLIPLLQKLLAEKKTNDGEQGPSAVI   98 (569)
T ss_pred             ccHHHhCCCHHHHHHHHHhCcCCcchhhhcccchhhcCcceeeeeccCCCchHHHHHHHHHHHHHhhhcccccccceeEE
Confidence            455 79999999999999999999999999999999999999999999999999999999999987664 4578999999


Q ss_pred             EcCcHHHHHHHHHHHHHHHhhcCCCceEEEeecCcccccchhhhhCCCCEEEEChHHHHHHHhcCcCCccCCccEEEEcC
Q psy16633         97 LSPSKELCNQLHKNIQELTMKCSRDVKCVDISEQVDVSVQEPLLVERPDIVVATPARALAHLKAKTLDLKSSLEIVIIDE  176 (540)
Q Consensus        97 l~Pt~~La~q~~~~l~~l~~~~~~~i~~~~~~~~~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~~~~~l~~lViDE  176 (540)
                      +|||+|||+|++..+.++..+|+..++...++.+.+.......+.+.|+|||+||++++.++..+....+..++++|+||
T Consensus        99 LvPTkEL~qQvy~viekL~~~c~k~lr~~nl~s~~sdsv~~~~L~d~pdIvV~TP~~ll~~~~~~~~~~~~~l~~LVvDE  178 (569)
T KOG0346|consen   99 LVPTKELAQQVYKVIEKLVEYCSKDLRAINLASSMSDSVNSVALMDLPDIVVATPAKLLRHLAAGVLEYLDSLSFLVVDE  178 (569)
T ss_pred             EechHHHHHHHHHHHHHHHHHHHHhhhhhhhhcccchHHHHHHHccCCCeEEeChHHHHHHHhhccchhhhheeeEEech
Confidence            99999999999999999999999899999998877777778899999999999999999999998865559999999999


Q ss_pred             ccccccCCcHHHHHHHHHhCCcccceeeEeeeccHHHHHHHHHhcCCCeEEEecCCCCCCCCCeEEEEEEcCcccHHHHH
Q psy16633        177 ADLVFSFGYEDDMKAVLKFLPKLYQAILASATLSEDVLSLKHLILRNPVILKLEEPAIAPVSQLAHYHILAQEDEKATIL  256 (540)
Q Consensus       177 ah~l~~~~~~~~l~~i~~~l~~~~q~il~SATl~~~~~~~~~~~l~~p~~i~~~~~~~~~~~~l~~~~~~~~~~~k~~~l  256 (540)
                      ||+++++||++++..+.+.+|+.+|+++||||+++++..++++++++|+++.+.+.+.+..+++.||++.|++.+|+.++
T Consensus       179 ADLllsfGYeedlk~l~~~LPr~~Q~~LmSATl~dDv~~LKkL~l~nPviLkl~e~el~~~dqL~Qy~v~cse~DKflll  258 (569)
T KOG0346|consen  179 ADLLLSFGYEEDLKKLRSHLPRIYQCFLMSATLSDDVQALKKLFLHNPVILKLTEGELPNPDQLTQYQVKCSEEDKFLLL  258 (569)
T ss_pred             hhhhhhcccHHHHHHHHHhCCchhhheeehhhhhhHHHHHHHHhccCCeEEEeccccCCCcccceEEEEEeccchhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcccCCcEEEEecChhhHHHHHHHHHhCCCceEEeCCCCCHHHHHHHHHHHhcCCccEEEeCCCCcc----CCc-
Q psy16633        257 YTLLKLNLVQGKTIIFVNTVDKCYKLKLYLEQFKISTCVLNSELPAKARCHAVYQFNQGLYDVIIASDEKAL----ETP-  331 (540)
Q Consensus       257 ~~ll~~~~~~~k~IIF~~s~~~~~~l~~~L~~~~~~~~~l~~~l~~~~r~~i~~~F~~g~~~iLIaT~~~~~----~~~-  331 (540)
                      ++++++....||+|||||++++||+|..+|++||+++|++||+||.+.|.||+++||.|.|+++||||+++.    +++ 
T Consensus       259 yallKL~LI~gKsliFVNtIdr~YrLkLfLeqFGiksciLNseLP~NSR~Hii~QFNkG~YdivIAtD~s~~~~~~eee~  338 (569)
T KOG0346|consen  259 YALLKLRLIRGKSLIFVNTIDRCYRLKLFLEQFGIKSCILNSELPANSRCHIIEQFNKGLYDIVIATDDSADGDKLEEEV  338 (569)
T ss_pred             HHHHHHHHhcCceEEEEechhhhHHHHHHHHHhCcHhhhhcccccccchhhHHHHhhCcceeEEEEccCccchhhhhccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999996643    222 


Q ss_pred             -------ccccccccccccCccccccccCCCCCcCEEEeCCCCCCcccchhccccccCCCCCceEEEEeccccccccccc
Q psy16633        332 -------QINSTNNRKRKRDKESGVSRGIDFQFVSNVINFDFPLDIQCYIHRAGRTARGKNQGTALSFVSLREQDLMNDG  404 (540)
Q Consensus       332 -------~~~~~~~~~~~~~~~~~~~~GiD~~~v~~Vi~~d~p~s~~~yiqr~GRagR~g~~g~~i~~~~~~e~~~~~~~  404 (540)
                             ..+..|+++++.|+|++++|||||.+|.+|+|||+|.+..+|+||+|||||++++|.+++|+.|.+...    
T Consensus       339 kgk~~e~~~kndkkskkK~D~E~GVsRGIDF~~V~~VlNFD~P~t~~sYIHRvGRTaRg~n~GtalSfv~P~e~~g----  414 (569)
T KOG0346|consen  339 KGKSDEKNPKNDKKSKKKLDKESGVSRGIDFHHVSNVLNFDFPETVTSYIHRVGRTARGNNKGTALSFVSPKEEFG----  414 (569)
T ss_pred             cccccccCCCCccccccccCchhchhccccchheeeeeecCCCCchHHHHHhccccccCCCCCceEEEecchHHhh----
Confidence                   133344566688999999999999999999999999999999999999999999999999999998876    


Q ss_pred             cchhhhhhhhhHHHHHHHHHHhhc-cccccccccccccchhhhhhhhhhHHHHHHh------------------------
Q psy16633        405 TALSFVSLREQDLMNDVNEYLMTN-LHEDDFIIKPYQFNLDEVKGFEYRAKDAWRS------------------------  459 (540)
Q Consensus       405 ~~~~~~~~~~~~~~~~i~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~r~~d~~~~------------------------  459 (540)
                                   ...++..+... ..++..+++||+|+++++++|+||++|++++                        
T Consensus       415 -------------~~~le~~~~d~~~~~~~qilqPY~f~~eevesfryR~eD~~ravTkvAvreaR~kEikqEll~SeKL  481 (569)
T KOG0346|consen  415 -------------KESLESILKDENRQEGRQILQPYQFRMEEVESFRYRAEDALRAVTKVAVREARLKEIKQELLNSEKL  481 (569)
T ss_pred             -------------hhHHHHHHhhHHhhcCccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Confidence                         45555555442 2234558999999999999999999999998                        


Q ss_pred             -hhcccCcchhhhhccccccccccccCCCCCCCCccCChhhhhcccccc
Q psy16633        460 -NYFEDNPTDLETLRHDKALYTVRIQSHLADVPDYIVPPALKKLARIED  507 (540)
Q Consensus       460 -~~f~~~~~~l~~l~~~~~l~~~~~~~~l~~~p~yl~p~~~~~~~~~~~  507 (540)
                       +||++||+||.+|+||+++++...+|||+|||+||+|++++++...++
T Consensus       482 K~~FeeNprdl~lLrhDkpl~~~~~qphL~dvpeYlvp~alr~~~~~~k  530 (569)
T KOG0346|consen  482 KAFFEENPRDLQLLRHDKPLRLAIVQPHLKDVPEYLVPEALRGVVKSVK  530 (569)
T ss_pred             HHHHhcChHHHHHhhcCCcccccccchhhccCchhhCCHHHhhcccccc
Confidence             999999999999999999999999999999999999999999886654

>KOG0330\|consensus	Back alignment and domain information

>KOG0331\|consensus	Back alignment and domain information

>KOG0338\|consensus	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0340\|consensus	Back alignment and domain information

>KOG0342\|consensus	Back alignment and domain information

>KOG0333\|consensus	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0328\|consensus	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0345\|consensus	Back alignment and domain information

>KOG0343\|consensus	Back alignment and domain information

>KOG0326\|consensus	Back alignment and domain information

>KOG0348\|consensus	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0336\|consensus	Back alignment and domain information

>KOG0335\|consensus	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0339\|consensus	Back alignment and domain information

>KOG0341\|consensus	Back alignment and domain information

>KOG0347\|consensus	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0332\|consensus	Back alignment and domain information

>KOG0337\|consensus	Back alignment and domain information

>KOG0334\|consensus	Back alignment and domain information

>KOG0327\|consensus	Back alignment and domain information

>KOG0350\|consensus	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0344\|consensus	Back alignment and domain information

>KOG4284\|consensus	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0329\|consensus	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>KOG0948\|consensus	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0349\|consensus	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0352\|consensus	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0351\|consensus	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>KOG0947\|consensus	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>KOG0354\|consensus	Back alignment and domain information

>KOG0353\|consensus	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0952\|consensus	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0951\|consensus	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0950\|consensus	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>KOG0922\|consensus	Back alignment and domain information

>KOG0920\|consensus	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0923\|consensus	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0926\|consensus	Back alignment and domain information

>KOG0949\|consensus	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0924\|consensus	Back alignment and domain information

>KOG4150\|consensus	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0953\|consensus	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>KOG0385\|consensus	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0925\|consensus	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG0387\|consensus	Back alignment and domain information

>KOG1123\|consensus	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0390\|consensus	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>KOG0951\|consensus	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG1000\|consensus	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>KOG0384\|consensus	Back alignment and domain information

>KOG0392\|consensus	Back alignment and domain information

>KOG0389\|consensus	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>KOG2340\|consensus	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>KOG0386\|consensus	Back alignment and domain information

>KOG0921\|consensus	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1002\|consensus	Back alignment and domain information

>KOG4439\|consensus	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>KOG0388\|consensus	Back alignment and domain information

>KOG1015\|consensus	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>KOG0952\|consensus	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>KOG1803\|consensus	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>KOG1802\|consensus	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>KOG0391\|consensus	Back alignment and domain information

>KOG0391\|consensus	Back alignment and domain information

>KOG1016\|consensus	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>KOG1132\|consensus	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>KOG1805\|consensus	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>KOG1131\|consensus	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>KOG0989\|consensus	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PHA03372 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>KOG0991\|consensus	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>KOG0298\|consensus	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>KOG1001\|consensus	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>KOG1133\|consensus	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1133\|consensus	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>KOG0701\|consensus	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>KOG1513\|consensus	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PHA00350 putative assembly protein	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0733\|consensus	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>KOG0739\|consensus	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>KOG0741\|consensus	Back alignment and domain information

>KOG0742\|consensus	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain	Back alignment and domain information

>KOG0732\|consensus	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028\|consensus	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional	Back alignment and domain information

>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>PRK09165 replicative DNA helicase; Provisional	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []	Back alignment and domain information

>KOG2004\|consensus	Back alignment and domain information

>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PHA00012 I assembly protein	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein	Back alignment and domain information

>TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency []	Back alignment and domain information

>TIGR00767 rho transcription termination factor Rho	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PHA02542 41 41 helicase; Provisional	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type	Back alignment and domain information

>PRK07413 hypothetical protein; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		540
2z0m_A		337	Crystal Structure Of Hypothetical Atp-Dependent Rna		1e-41
1s2m_A		400	Crystal Structure Of The Dead Box Protein Dhh1p Len		2e-36
2j0q_A		410	The Crystal Structure Of The Exon Junction Complex		4e-36
2hyi_C		413	Structure Of The Human Exon Junction Complex With A		4e-36
2xb2_A		411	Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar		4e-36
2hxy_A		391	Crystal Structure Of Human Apo-Eif4aiii Length = 39		5e-36
2j0u_A		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		1e-35
2j0u_B		374	The Crystal Structure Of Eif4aiii-Barentsz Complex		1e-34
2vso_A		395	Crystal Structure Of A Translation Initiation Compl		2e-34
1fuu_A		394	Yeast Initiation Factor 4a Length = 394		6e-33
3eiq_A		414	Crystal Structure Of Pdcd4-eif4a Length = 414		4e-32
2zu6_A		388	Crystal Structure Of The Eif4a-Pdcd4 Complex Length		6e-32
1hv8_A		367	Crystal Structure Of A Dead Box Protein From The Hy		3e-31
2i4i_A		417	Crystal Structure Of Human Dead-Box Rna Helicase Dd		7e-30
1xtk_A		390	Structure Of Decd To Dead Mutation Of Human Uap56 L		8e-30
1xti_A		391	Structure Of Wildtype Human Uap56 Length = 391		2e-29
1xtj_A		386	Structure Of Human Uap56 In Complex With Adp Length		3e-29
3pey_A		395	S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length		7e-29
3ber_A		249	Human Dead-Box Rna-Helicase Ddx47, Conserved Domain		1e-28
3pew_A		395	S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3		2e-28
2db3_A		434	Structural Basis For Rna Unwinding By The Dead-Box		2e-28
2gxq_A		207	Hera N-Terminal Domain In Complex With Amp, Crystal		4e-27
3g0h_A		424	Human Dead-box Rna Helicase Ddx19, In Complex With		5e-27
3ews_A		445	Human Dead-Box Rna-Helicase Ddx19 In Complex With A		5e-27
3fht_A		412	Crystal Structure Of Human Dbp5 In Complex With Amp		6e-27
3fmp_B		479	Crystal Structure Of The Nucleoporin Nup214 In Comp		7e-27
3mwj_A		207	Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap		1e-26
3fho_B		508	Structure Of S. Pombe Dbp5 Length = 508		5e-26
3sqw_A		579	Structure Of Mss116p (Nte Deletion) Bound To Ssrna		4e-23
3i5x_A		563	Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len		6e-23
3ly5_A		262	Ddx18 Dead-Domain Length = 262		8e-23
1qva_A		223	Yeast Initiation Factor 4a N-Terminal Domain Length		1e-22
1qde_A		224	Crystal Structure Of The Atpase Domain Of Translati		1e-22
3sqx_A		512	Structure Of Mss116p (Nte And C-Tail Double Deletio		1e-22
3bor_A		237	Crystal Structure Of The Deadc Domain Of Human Tran		2e-22
2pl3_A		236	Human Dead-Box Rna Helicase Ddx10, Dead Domain In C		2e-21
2g9n_A		221	Structure Of The Dead Domain Of Human Eukaryotic In		5e-20
1q0u_A		219	Crystal Structure Of The Bstdead N-Terminal Domain		3e-19
1vec_A		206	Crystal Structure Of The N-Terminal Domain Of RckP5		4e-17
3dkp_A		245	Human Dead-Box Rna-Helicase Ddx52, Conserved Domain		3e-16
2kbe_A		226	Solution Structure Of Amino-Terminal Domain Of Dbp5		4e-15
1wrb_A		253	Crystal Structure Of The N-Terminal Reca-Like Domai		7e-15
3iuy_A		228	Crystal Structure Of Ddx53 Dead-Box Domain Length =		9e-15
1t6n_A		220	Crystal Structure Of The N-Terminal Domain Of Human		2e-14
4a4d_A		253	Crystal Structure Of The N-Terminal Domain Of The H		2e-14
3fhc_B		235	Crystal Structure Of Human Dbp5 In Complex With Nup		3e-14
3fe2_A		242	Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D		4e-14
3fmo_B		300	Crystal Structure Of The Nucleoporin Nup214 In Comp		6e-14
2yjt_D		170	Crystal Structure Of E. Coli Dead-Box Protein Srmb		2e-12
2jgn_A		185	Ddx3 Helicase Domain Length = 185		3e-11
2hjv_A		163	Structure Of The Second Domain (Residues 207-368) O		2e-10
2oxc_A		230	Human Dead-Box Rna Helicase Ddx20, Dead Domain In C		2e-10
2wax_A		193	Structure Of The Human Ddx6 C-Terminal Domain In Co		1e-08
2p6n_A		191	Human Dead-box Rna Helicase Ddx41, Helicase Domain		2e-08
1t5i_A		172	Crystal Structure Of The C-Terminal Domain Of Uap56		4e-08
3gfp_A		189	Structure Of The C-Terminal Domain Of The Dead-Box		1e-07
2kbf_A		187	Solution Structure Of Carboxyl-Terminal Domain Of D		2e-07
3peu_A		188	S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To		3e-07
2rb4_A		175	Crystal Structure Of The Helicase Domain Of Human D		2e-06
1fuk_A		165	Crystal Structure Of The Carboxy Terminal Domain Of		8e-06
4db2_A		257	Mss116p Dead-Box Helicase Domain 2 Bound To An Rna		2e-05
4db4_A		256	Mss116p Dead-Box Helicase Domain 2 Bound To A Chima		2e-05
4db2_C		257	Mss116p Dead-Box Helicase Domain 2 Bound To An Rna		2e-05

>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337