Psyllid ID: psy16651

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
ccccccEEEEEccccHHHHHHHHHHHHHcccEEcEEEEEccEEEEEEEHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccEEEcccccHHHHHHHHcHHHccEEEEEcccHHHHHHHHHcccccccccccc
cccccccEEEEccccHHHHHHHHHHHHcccccEEEEEEccccEEHHHHEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEccHHHHHHHHHHHHHcccccEEEEcc
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMlfsinpckhpivilkdvqfkDLKTLIDFIYfgevnvsqehlpsllkprvrfppgvdfilmg
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSqehlpsllkprvrfppgvdfilmg
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
******QFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFIL**
*****QQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINIC*****************SL**********NPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
****TQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPPGVDFILMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
P17789 643 Protein tramtrack, beta i no N/A 0.692 0.164 0.463 8e-30
P42282 813 Protein tramtrack, alpha no N/A 0.692 0.130 0.463 8e-30
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.660 0.094 0.458 2e-28
Q9V5M3 878 Longitudinals lacking pro no N/A 0.660 0.115 0.458 3e-27
Q9V5M6 963 Longitudinals lacking pro no N/A 0.660 0.104 0.458 3e-27
Q867Z4 970 Longitudinals lacking pro no N/A 0.660 0.104 0.458 3e-27
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.660 0.128 0.458 3e-27
P42284 549 Longitudinals lacking pro no N/A 0.660 0.183 0.458 3e-27
P42283 891 Longitudinals lacking pro no N/A 0.660 0.113 0.458 3e-27
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.660 0.103 0.421 1e-26
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function desciption
 Score =  129 bits (323), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 81/138 (58%), Gaps = 32/138 (23%)

Query: 1   MATPTQQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQV 60
           M   +Q+FCLRWNNHQ N ++VF  LL +ET  DVTLA EG+H+ AHK+VLSACS YF  
Sbjct: 1   MKMASQRFCLRWNNHQSNLLSVFDQLLHAETFTDVTLAVEGQHLKAHKMVLSACSPYFNT 60

Query: 61  AYHINICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDF 120
                                           LF  +P KHPIVILKDV + D+K+L+DF
Sbjct: 61  --------------------------------LFVSHPEKHPIVILKDVPYSDMKSLLDF 88

Query: 121 IYFGEVNVSQEHLPSLLK 138
           +Y GEV+V QE L + L+
Sbjct: 89  MYRGEVSVDQERLTAFLR 106
Binds to a number of sites in the transcriptional regulatory region of ftz. Isoform beta is required to repress inappropriate segmentation gene transcription and repress genes incompatible with development of photoreceptor cell fates. Probable repressor of the transcription of the segmentation genes ftz, eve, h, odd, run, and en. Inhibits Trl-dependent activation of eve. May bind to the region AGGGC/TGG. Degradation of ttk is directed by binding of sinah or sina, via the adapter molecule phyl which binds to the BTB domain of ttk. A second method of degradation exists that is phyl-independent, this is mediated by recognition of motifs in the C-terminus of ttk.
Drosophila melanogaster (taxid: 7227)
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function description
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
307204530 509 Longitudinals lacking protein, isoform G 0.660 0.198 0.541 4e-38
189235417 489 PREDICTED: similar to AGAP006454-PA [Tri 0.660 0.206 0.563 5e-38
383861324 766 PREDICTED: uncharacterized protein LOC10 0.660 0.131 0.556 5e-38
383861322 758 PREDICTED: uncharacterized protein LOC10 0.660 0.133 0.556 5e-38
328779721 772 PREDICTED: hypothetical protein LOC72481 0.660 0.130 0.548 1e-37
350402521 763 PREDICTED: hypothetical protein LOC10074 0.660 0.132 0.548 2e-37
340711964 763 PREDICTED: hypothetical protein LOC10064 0.660 0.132 0.548 2e-37
442629890 747 BTB-protein-VII, isoform I [Drosophila m 0.660 0.135 0.571 4e-37
442629888 748 BTB-protein-VII, isoform H [Drosophila m 0.660 0.135 0.571 4e-37
442629886 816 BTB-protein-VII, isoform G [Drosophila m 0.660 0.123 0.571 4e-37
>gi|307204530|gb|EFN83210.1| Longitudinals lacking protein, isoform G [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 72/133 (54%), Positives = 93/133 (69%), Gaps = 32/133 (24%)

Query: 6   QQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHIN 65
           QQFCLRWNNHQPNFI+VFS+LL +ET+ DVTLA EG+H+ AHK+VLSACS+YFQ      
Sbjct: 4   QQFCLRWNNHQPNFISVFSNLLNNETLVDVTLAAEGRHLQAHKVVLSACSTYFQ------ 57

Query: 66  ICELFIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGE 125
                                      LF++NPC+HPIVILKD++F DLK ++DF+Y+GE
Sbjct: 58  --------------------------SLFTVNPCQHPIVILKDIKFSDLKIMVDFMYYGE 91

Query: 126 VNVSQEHLPSLLK 138
           VN+SQ+ LPS++K
Sbjct: 92  VNISQDQLPSIIK 104

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189235417|ref|XP_001812349.1| PREDICTED: similar to AGAP006454-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383861324|ref|XP_003706136.1| PREDICTED: uncharacterized protein LOC100879573 isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383861322|ref|XP_003706135.1| PREDICTED: uncharacterized protein LOC100879573 isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328779721|ref|XP_001120712.2| PREDICTED: hypothetical protein LOC724810 [Apis mellifera] Back     alignment and taxonomy information
>gi|350402521|ref|XP_003486515.1| PREDICTED: hypothetical protein LOC100744284 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711964|ref|XP_003394535.1| PREDICTED: hypothetical protein LOC100644245 [Bombus terrestris] Back     alignment and taxonomy information
>gi|442629890|ref|NP_001261356.1| BTB-protein-VII, isoform I [Drosophila melanogaster] gi|440215235|gb|AGB94051.1| BTB-protein-VII, isoform I [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442629888|ref|NP_001261355.1| BTB-protein-VII, isoform H [Drosophila melanogaster] gi|440215234|gb|AGB94050.1| BTB-protein-VII, isoform H [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442629886|ref|NP_001137880.2| BTB-protein-VII, isoform G [Drosophila melanogaster] gi|440215233|gb|ACL83236.2| BTB-protein-VII, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.372 0.059 0.578 3.8e-24
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.718 0.137 0.495 9.5e-21
FB|FBgn0029824 676 CG3726 [Drosophila melanogaste 0.346 0.078 0.547 3.2e-20
FB|FBgn0029822 553 CG12236 [Drosophila melanogast 0.418 0.115 0.430 3.6e-19
FB|FBgn0052121 648 CG32121 [Drosophila melanogast 0.346 0.081 0.509 2.1e-18
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.718 0.103 0.427 7.5e-16
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.405 0.076 0.596 8.3e-16
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.477 0.074 0.479 2.9e-15
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.490 0.077 0.546 3.7e-15
FB|FBgn0013263 581 Trl "Trithorax-like" [Drosophi 0.346 0.091 0.446 1.6e-12
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 190 (71.9 bits), Expect = 3.8e-24, Sum P(2) = 3.8e-24
 Identities = 33/57 (57%), Positives = 42/57 (73%)

Query:     6 QQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAY 62
             QQFCLRWNNH  N   V +SLL+ E +CDVTLA EG+ + AH+ +LSACS YF+  +
Sbjct:   104 QQFCLRWNNHPTNLTGVLTSLLQREALCDVTLACEGETVKAHQTILSACSPYFETIF 160
GO:0016545 "male courtship behavior, veined wing vibration" evidence=IMP
GO:0008049 "male courtship behavior" evidence=NAS;IMP;TAS
GO:0007618 "mating" evidence=IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;TAS
GO:0045433 "male courtship behavior, veined wing generated song production" evidence=IMP;TAS
GO:0007517 "muscle organ development" evidence=IMP
GO:0007530 "sex determination" evidence=IMP;TAS
GO:0007275 "multicellular organismal development" evidence=IMP
GO:0005634 "nucleus" evidence=NAS
GO:0007617 "mating behavior" evidence=IMP
GO:0016543 "male courtship behavior, orientation prior to leg tapping and wing vibration" evidence=NAS
GO:0007620 "copulation" evidence=NAS;TAS
GO:0007417 "central nervous system development" evidence=IMP;TAS
GO:0046661 "male sex differentiation" evidence=TAS
GO:0048047 "mating behavior, sex discrimination" evidence=IGI;IMP;TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0002118 "aggressive behavior" evidence=IMP
GO:0016199 "axon midline choice point recognition" evidence=IMP
GO:0048813 "dendrite morphogenesis" evidence=IMP
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029824 CG3726 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0029822 CG12236 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052121 CG32121 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0013263 Trl "Trithorax-like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
pfam00651101 pfam00651, BTB, BTB/POZ domain 1e-15
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 7e-12
PHA02713 557 PHA02713, PHA02713, hypothetical protein; Provisio 0.004
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information 
 Score = 67.3 bits (165), Expect = 1e-15
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 34/116 (29%)

Query: 23  FSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQ 82
            + L  +  +CDVTL    K   AHK VL+ACS YF+                       
Sbjct: 1   LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFK----------------------- 37

Query: 83  YTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLK 138
                     LF+ N      + L+DV  +D + L++FIY G++ +++E++  LL 
Sbjct: 38  ---------ALFTGNKEVE--ITLEDVSPEDFEALLEFIYTGKLEITEENVDDLLA 82

The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG4441|consensus 571 99.9
PHA02713 557 hypothetical protein; Provisional 99.9
PHA02790 480 Kelch-like protein; Provisional 99.86
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.81
PHA03098 534 kelch-like protein; Provisional 99.77
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.71
KOG4350|consensus 620 99.67
KOG2075|consensus 521 99.42
KOG4591|consensus 280 99.36
KOG4682|consensus 488 98.99
KOG0783|consensus 1267 98.63
KOG0783|consensus 1267 98.25
KOG2838|consensus 401 98.09
KOG0511|consensus 516 97.68
KOG3473|consensus112 97.36
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 97.34
KOG2838|consensus401 97.31
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.04
KOG0511|consensus 516 96.72
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.42
KOG2716|consensus 230 94.42
KOG1987|consensus 297 91.63
KOG2714|consensus 465 91.58
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 91.53
KOG1724|consensus162 90.19
KOG1665|consensus 302 89.11
>KOG4441|consensus Back     alignment and domain information 
Probab=99.90  E-value=2.6e-24  Score=189.69  Aligned_cols=109  Identities=26%  Similarity=0.462  Sum_probs=103.6

Q ss_pred             eeEEEeCCChHHHHHHHHHHHhcCCcccEEEEeCCeEEecchhhhhccCHHhHhhhhhhhhHHHHHHHHHHHhhhhhhhh
Q psy16651          7 QFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSL   86 (153)
Q Consensus         7 ~~~~~~~~~~~~~l~~l~~l~~~~~~~DV~l~v~~~~~~aHr~vLaa~S~yF~~mf~~~~~e~~~~~~~~~~~~~~~~~~   86 (153)
                      ...+..+.|...+++.++.+|+.+.+|||++.+++++|+|||+||||+|+||++||+.+++|                  
T Consensus        11 ~~~~~~~~h~~~~l~~l~~lr~~~~lcDv~L~v~~~~~~aHR~VLAa~S~YFraMFt~~l~e------------------   72 (571)
T KOG4441|consen   11 TSEFTDPSHSKFLLQGLNELREEGLLCDVTLLVGDREFPAHRVVLAACSPYFRAMFTSGLKE------------------   72 (571)
T ss_pred             ccccccHHHHHHHHHHHHHHHHhCCCceEEEEECCeeechHHHHHHhccHHHHHHhcCCccc------------------
Confidence            34567789999999999999999999999999999999999999999999999999999988                  


Q ss_pred             hhhcccccccCCCCCCeEEeCCCCHHHHHHHhchHhCCccccCCCcHHHHHHHhccCCc
Q psy16651         87 CLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPP  145 (153)
Q Consensus        87 ~~~~~~~~~~~~~~~~~i~l~~v~~~~f~~vl~fiYtg~l~i~~~nv~~ll~aA~~lq~  145 (153)
                                  ..+.+|.+.++++++++.+++|+|||++.|+.+||++|+++|++||+
T Consensus        73 ------------~~~~~i~l~~v~~~~l~~ll~y~Yt~~i~i~~~nVq~ll~aA~~lQi  119 (571)
T KOG4441|consen   73 ------------SKQKEINLEGVDPETLELLLDYAYTGKLEISEDNVQELLEAASLLQI  119 (571)
T ss_pred             ------------ccceEEEEecCCHHHHHHHHHHhhcceEEechHhHHHHHHHHHHhhh
Confidence                        77889999999999999999999999999999999999999999984

>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG3473|consensus Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>KOG2716|consensus Back     alignment and domain information
>KOG1987|consensus Back     alignment and domain information
>KOG2714|consensus Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>KOG1724|consensus Back     alignment and domain information
>KOG1665|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
2z8h_A138 Structure Of Mouse Bach1 Btb Domain Length = 138 5e-05
2ihc_A124 Crystal Structure Of The Bric-A-Brac (Btb) Domain O 5e-05
3ohu_A125 Crystal Structure Of The Human Bach2 Poz Domain, Fo 4e-04
>pdb|2Z8H|A Chain A, Structure Of Mouse Bach1 Btb Domain Length = 138 Back     alignment and structure 
Iteration: 1

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)
Query: 8  FCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYF 58
          F    + H  N +   +   + + +CDVT+  EG+   AH+ VL+ACSSYF
Sbjct: 12 FAYESSVHSTNVLLSLNDQRKKDVLCDVTVLVEGQRFRAHRSVLAACSSYF 62
>pdb|2IHC|A Chain A, Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1 Length = 124 Back     alignment and structure
>pdb|3OHU|A Chain A, Crystal Structure Of The Human Bach2 Poz Domain, Form I Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 4e-17
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 2e-16
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-16
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 4e-16
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-15
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 1e-15
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 1e-15
2vpk_A116 Myoneurin; transcription regulation, transcription 2e-15
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 9e-15
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-14
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 3e-14
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 4e-14
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 9e-14
3b84_A119 Zinc finger and BTB domain-containing protein 48; 2e-13
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 2e-13
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 3e-13
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 4e-12
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 7e-12
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 1e-11
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
 Score = 72.0 bits (177), Expect = 4e-17
 Identities = 20/136 (14%), Positives = 46/136 (33%), Gaps = 36/136 (26%)

Query: 6   QQFCLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHIN 65
           Q   +    H    +   SS       CD  L  +G+ I   K +L+A S Y +      
Sbjct: 21  QSMAVSDPQHAARLLRALSSFREESRFCDAHLVLDGEEIPVQKNILAAASPYIR------ 74

Query: 66  ICELFIFVLVILKRQLQYTSLCLTAWMLFSINP----CKHPIVILKDVQFKDLKTLIDFI 121
                                        + NP         + L+ +    ++ ++D+I
Sbjct: 75  --------------------------TKLNYNPPKDDGSTYKIELEGISVMVMREILDYI 108

Query: 122 YFGEVNVSQEHLPSLL 137
           + G++ ++++ +  ++
Sbjct: 109 FSGQIRLNEDTIQDVV 124
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.95
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.95
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.95
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.95
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.95
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.94
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.94
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.94
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.93
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.93
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.93
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.92
2vpk_A116 Myoneurin; transcription regulation, transcription 99.92
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.92
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.92
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.91
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.91
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.91
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.91
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.86
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.53
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.39
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 98.93
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.82
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.79
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.78
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.26
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.02
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 97.42
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.77
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 94.73
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 94.33
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 94.08
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 93.84
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 93.03
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
Probab=99.95  E-value=2.1e-28  Score=173.33  Aligned_cols=107  Identities=21%  Similarity=0.415  Sum_probs=97.6

Q ss_pred             EEEeCCChHHHHHHHHHHHhcCCcccEEEEeCCeEEecchhhhhccCHHhHhhhhhhhhHHHHHHHHHHHhhhhhhhhhh
Q psy16651          9 CLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCL   88 (153)
Q Consensus         9 ~~~~~~~~~~~l~~l~~l~~~~~~~DV~l~v~~~~~~aHr~vLaa~S~yF~~mf~~~~~e~~~~~~~~~~~~~~~~~~~~   88 (153)
                      +++|++|+..+++.++++++++.+|||+|.++|+.|+|||.|||++|+||++||.+++.|                    
T Consensus         2 ~~~~~~h~~~l~~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~~f~~~~~e--------------------   61 (120)
T 2if5_A            2 GIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVV--------------------   61 (120)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHHC------------------------
T ss_pred             CcCccchHHHHHHHHHHHHhcCCCCCeEEEECCEEEeHHHHHHHHhCHHHHHHhcCCccc--------------------
Confidence            357899999999999999999999999999999999999999999999999999888777                    


Q ss_pred             hcccccccCCCCCCeEEeCCCCHHHHHHHhchHhCCccccCCCcHHHHHHHhccCCc
Q psy16651         89 TAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPP  145 (153)
Q Consensus        89 ~~~~~~~~~~~~~~~i~l~~v~~~~f~~vl~fiYtg~l~i~~~nv~~ll~aA~~lq~  145 (153)
                                .....|.++++++++|+.+|+|+|||++.++.+++.+++.+|++|++
T Consensus        62 ----------~~~~~i~l~~~~~~~f~~ll~~~Yt~~~~~~~~~~~~ll~~A~~~~i  108 (120)
T 2if5_A           62 ----------DQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEI  108 (120)
T ss_dssp             -----------CCSEEECCSSCHHHHHHHHHHHHHSCCCCCGGGHHHHHHHHHHTTC
T ss_pred             ----------cCCceEEeCCCCHHHHHHHHHHHcCCCCccCHHHHHHHHHHHHHhCC
Confidence                      55678999999999999999999999999999999999999999976
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 153
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 4e-13
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-11
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.1 bits (145), Expect = 4e-13
 Identities = 19/129 (14%), Positives = 45/129 (34%), Gaps = 30/129 (23%)

Query: 10  LRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICEL 69
           +++  H  + +   + L   + + DV +    +   AHK VL ACS  F           
Sbjct: 3   IQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFY---------- 52

Query: 70  FIFVLVILKRQLQYTSLCLTAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVS 129
                               +     +      I +  ++  +    L+DF+Y   +N+ 
Sbjct: 53  --------------------SIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLR 92

Query: 130 QEHLPSLLK 138
           + ++ +++ 
Sbjct: 93  EGNIMAVMA 101
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.95
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.95
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.99
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.47
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.26
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.26
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 95.95
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 95.78
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=5e-29  Score=176.53  Aligned_cols=107  Identities=18%  Similarity=0.358  Sum_probs=99.2

Q ss_pred             EEEeCCChHHHHHHHHHHHhcCCcccEEEEeCCeEEecchhhhhccCHHhHhhhhhhhhHHHHHHHHHHHhhhhhhhhhh
Q psy16651          9 CLRWNNHQPNFIAVFSSLLRSETMCDVTLATEGKHILAHKIVLSACSSYFQVAYHINICELFIFVLVILKRQLQYTSLCL   88 (153)
Q Consensus         9 ~~~~~~~~~~~l~~l~~l~~~~~~~DV~l~v~~~~~~aHr~vLaa~S~yF~~mf~~~~~e~~~~~~~~~~~~~~~~~~~~   88 (153)
                      +++|++|+.++++.|+++|+++.+|||++.++|++|+|||+||+++|+||++||..++.|                    
T Consensus         2 ~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~~Hk~vLa~~S~~F~~~f~~~~~e--------------------   61 (122)
T d1r29a_           2 QIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKR--------------------   61 (122)
T ss_dssp             CCCCTTHHHHHHHHHHHHHHTTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTSTTTT--------------------
T ss_pred             CcccchHHHHHHHHHHHHHhcCCCeEEEEEECCEEEEEehHHhhhCCHHHHHHhccchhh--------------------
Confidence            467899999999999999999999999999999999999999999999999998877666                    


Q ss_pred             hcccccccCCCCCCeEEeCCCCHHHHHHHhchHhCCccccCCCcHHHHHHHhccCCc
Q psy16651         89 TAWMLFSINPCKHPIVILKDVQFKDLKTLIDFIYFGEVNVSQEHLPSLLKPRVRFPP  145 (153)
Q Consensus        89 ~~~~~~~~~~~~~~~i~l~~v~~~~f~~vl~fiYtg~l~i~~~nv~~ll~aA~~lq~  145 (153)
                                .....+.++++++++|+.+++|+|||++.++.+++.+++.+|++|++
T Consensus        62 ----------~~~~~~~~~~v~~~~f~~ll~~~Ytg~~~i~~~~v~~ll~~A~~l~i  108 (122)
T d1r29a_          62 ----------NLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYLQM  108 (122)
T ss_dssp             ----------TCSEEECCTTSCHHHHHHHHHHHHHSCCCCCTTTHHHHHHHHHHTTC
T ss_pred             ----------hcceeeeecccCHHHHHHHHhhhcCCeecCchhhHHHHHHHHHHHCc
Confidence                      44556667899999999999999999999999999999999999986
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure