Psyllid ID: psy16665


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL
ccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHEEHHHHHEEcccccccc
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLknsgsdvssiafLPLISVIMFIVMFsipwgdknl
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL
MGLSVVLVDKAGrrlllllSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL
***SVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWG****
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKN*
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL
*GLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDK**
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
Q7PIR5793 Facilitated trehalose tra no N/A 0.901 0.080 0.434 2e-10
B3NSE1856 Facilitated trehalose tra N/A N/A 0.901 0.074 0.449 5e-10
A1Z8N1857 Facilitated trehalose tra yes N/A 0.901 0.074 0.449 6e-10
B4HNS0857 Facilitated trehalose tra N/A N/A 0.901 0.074 0.449 7e-10
B4LPX5911 Facilitated trehalose tra N/A N/A 0.901 0.070 0.420 7e-10
Q17NV8806 Facilitated trehalose tra N/A N/A 0.901 0.079 0.391 1e-09
A5LGM7504 Facilitated trehalose tra N/A N/A 0.887 0.125 0.441 2e-09
B4J913929 Facilitated trehalose tra N/A N/A 0.901 0.068 0.434 2e-09
B4KR05863 Facilitated trehalose tra N/A N/A 0.901 0.074 0.420 2e-09
B4P624856 Facilitated trehalose tra N/A N/A 0.901 0.074 0.434 4e-09
>sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 Back     alignment and function desciption
 Score = 64.7 bits (156), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 5/69 (7%)

Query: 3   LSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMF 62
           ++ VL+D+ GR++LL +S + M + L  LG +F++KN+G DVS I +LPL + ++F+V F
Sbjct: 625 IATVLIDRLGRKILLYISDVAMIITLMTLGTFFYMKNNGDDVSEIGWLPLAAFVVFVVGF 684

Query: 63  S-----IPW 66
           S     IPW
Sbjct: 685 SLGFGPIPW 693




High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Anopheles gambiae (taxid: 7165)
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 Back     alignment and function description
>sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 Back     alignment and function description
>sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 Back     alignment and function description
>sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
291461567 478 sugar transporter 4 [Nilaparvata lugens] 0.887 0.131 0.602 3e-14
157126364 488 sugar transporter [Aedes aegypti] 0.901 0.131 0.594 3e-12
312385699 529 hypothetical protein AND_00446 [Anophele 0.887 0.119 0.602 6e-12
347969985 480 AGAP003492-PB [Anopheles gambiae str. PE 0.887 0.131 0.588 1e-11
347969989 492 AGAP003492-PA [Anopheles gambiae str. PE 0.887 0.128 0.588 1e-11
195144544 512 GL24034 [Drosophila persimilis] gi|19845 0.845 0.117 0.523 1e-11
390178340 518 GA26484, isoform B [Drosophila pseudoobs 0.845 0.115 0.523 1e-11
170054020 479 sugar transporter [Culex quinquefasciatu 0.901 0.133 0.579 4e-11
357619298 500 hypothetical protein KGM_13187 [Danaus p 0.901 0.128 0.536 4e-11
383858089 472 PREDICTED: facilitated trehalose transpo 0.901 0.135 0.507 1e-10
>gi|291461567|dbj|BAI83418.1| sugar transporter 4 [Nilaparvata lugens] Back     alignment and taxonomy information
 Score = 82.8 bits (203), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 51/68 (75%), Gaps = 5/68 (7%)

Query: 4   SVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFS 63
           S VLVDKAGRR+LLL+S  +M LCLG LG+YF L+  G DVS+I  +PL+SV +FIV+FS
Sbjct: 318 SAVLVDKAGRRILLLISSSVMALCLGCLGYYFHLQQKGEDVSNIGMIPLVSVCVFIVVFS 377

Query: 64  -----IPW 66
                IPW
Sbjct: 378 LGFGPIPW 385




Source: Nilaparvata lugens

Species: Nilaparvata lugens

Genus: Nilaparvata

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157126364|ref|XP_001660877.1| sugar transporter [Aedes aegypti] Back     alignment and taxonomy information
>gi|312385699|gb|EFR30128.1| hypothetical protein AND_00446 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347969985|ref|XP_003436493.1| AGAP003492-PB [Anopheles gambiae str. PEST] gi|347969987|ref|XP_003436494.1| AGAP003492-PC [Anopheles gambiae str. PEST] gi|347969991|ref|XP_003436495.1| AGAP003492-PD [Anopheles gambiae str. PEST] gi|333466667|gb|EGK96332.1| AGAP003492-PB [Anopheles gambiae str. PEST] gi|333466668|gb|EGK96333.1| AGAP003492-PC [Anopheles gambiae str. PEST] gi|333466669|gb|EGK96334.1| AGAP003492-PD [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347969989|ref|XP_309674.5| AGAP003492-PA [Anopheles gambiae str. PEST] gi|333466666|gb|EAA05397.6| AGAP003492-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195144544|ref|XP_002013256.1| GL24034 [Drosophila persimilis] gi|198452802|ref|XP_002137541.1| GA26484, isoform A [Drosophila pseudoobscura pseudoobscura] gi|194102199|gb|EDW24242.1| GL24034 [Drosophila persimilis] gi|198132083|gb|EDY68099.1| GA26484, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|390178340|ref|XP_003736628.1| GA26484, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859411|gb|EIM52701.1| GA26484, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|170054020|ref|XP_001862938.1| sugar transporter [Culex quinquefasciatus] gi|167874408|gb|EDS37791.1| sugar transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357619298|gb|EHJ71927.1| hypothetical protein KGM_13187 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383858089|ref|XP_003704535.1| PREDICTED: facilitated trehalose transporter Tret1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
UNIPROTKB|A5LGM7504 Tret1 "Facilitated trehalose t 0.887 0.125 0.397 2e-07
UNIPROTKB|Q7PIR5793 Tret1 "Facilitated trehalose t 0.915 0.081 0.384 2.3e-07
UNIPROTKB|B0WC46517 Tret1 "Facilitated trehalose t 0.915 0.125 0.384 4.4e-07
UNIPROTKB|B4LPX5911 Tret1 "Facilitated trehalose t 0.915 0.071 0.369 1.2e-06
UNIPROTKB|B4HNS0857 Tret1-1 "Facilitated trehalose 0.915 0.075 0.4 1.8e-06
UNIPROTKB|Q17NV8806 Tret1 "Facilitated trehalose t 0.915 0.080 0.338 2.1e-06
UNIPROTKB|B3NSE1856 Tret1 "Facilitated trehalose t 0.915 0.075 0.4 2.3e-06
FB|FBgn0050035857 Tret1-1 "Trehalose transporter 0.915 0.075 0.4 2.3e-06
FB|FBgn0036316539 CG10960 [Drosophila melanogast 0.915 0.120 0.393 2.6e-06
FB|FBgn0037386502 CG1208 [Drosophila melanogaste 0.887 0.125 0.415 3e-06
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 2.0e-07, P = 2.0e-07
 Identities = 27/68 (39%), Positives = 42/68 (61%)

Query:     4 SVVLVDKAGXXXXXXXSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFS 63
             + VL+D+ G       S + M + L  LG +F+ KNSG+DVS+I +LPL S +++++ FS
Sbjct:   337 ATVLIDRLGRKILLYISEVAMVITLLTLGTFFYYKNSGNDVSNIGWLPLASFVIYVIGFS 396

Query:    64 -----IPW 66
                  IPW
Sbjct:   397 SGVGPIPW 404




GO:0015574 "trehalose transmembrane transporter activity" evidence=IDA
GO:0015771 "trehalose transport" evidence=IDA
GO:0044459 "plasma membrane part" evidence=IDA
GO:0015767 "lactose transport" evidence=IDA
GO:0015768 "maltose transport" evidence=IDA
GO:0015770 "sucrose transport" evidence=IDA
UNIPROTKB|Q7PIR5 Tret1 "Facilitated trehalose transporter Tret1" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
UNIPROTKB|B4LPX5 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS0 Tret1-1 "Facilitated trehalose transporter Tret1-1" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|Q17NV8 Tret1 "Facilitated trehalose transporter Tret1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B3NSE1 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
FB|FBgn0050035 Tret1-1 "Trehalose transporter 1-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0036316 CG10960 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0037386 CG1208 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 2e-05
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 0.001
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 0.004
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score = 40.0 bits (94), Expect = 2e-05
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 3   LSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMF 62
           +++ LVD+ GRR LLL+    M +CL VLG       +GS   S   + ++ +++FI  F
Sbjct: 338 VAIFLVDRFGRRPLLLIGAAGMAICLFVLGILGASFVTGSS-KSSGNVAIVFILLFIAFF 396

Query: 63  SIPWG 67
           ++ WG
Sbjct: 397 AMGWG 401


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
KOG0569|consensus485 99.37
KOG0254|consensus513 99.2
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.04
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 98.01
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.79
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.52
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.19
PRK10406 432 alpha-ketoglutarate transporter; Provisional 96.92
TIGR00880141 2_A_01_02 Multidrug resistance protein. 96.87
PRK10642 490 proline/glycine betaine transporter; Provisional 96.8
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 96.78
PRK10077 479 xylE D-xylose transporter XylE; Provisional 96.77
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.76
PRK15075 434 citrate-proton symporter; Provisional 96.75
TIGR00900 365 2A0121 H+ Antiporter protein. 96.75
PRK05122 399 major facilitator superfamily transporter; Provisi 96.68
PRK09952 438 shikimate transporter; Provisional 96.66
TIGR00891 405 2A0112 putative sialic acid transporter. 96.63
TIGR00898 505 2A0119 cation transport protein. 96.54
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 96.54
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 96.52
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.51
PRK09705 393 cynX putative cyanate transporter; Provisional 96.51
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 96.5
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 96.48
TIGR00898505 2A0119 cation transport protein. 96.44
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 96.39
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 96.38
PRK03699 394 putative transporter; Provisional 96.35
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 96.32
PRK12382 392 putative transporter; Provisional 96.32
KOG0253|consensus528 96.3
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 96.3
TIGR00895 398 2A0115 benzoate transport. 96.27
PRK15462 493 dipeptide/tripeptide permease D; Provisional 96.24
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 96.23
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 96.23
KOG0255|consensus 521 96.22
PRK11195 393 lysophospholipid transporter LplT; Provisional 96.22
PRK15403 413 multidrug efflux system protein MdtM; Provisional 96.2
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 96.18
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 96.17
TIGR00893 399 2A0114 d-galactonate transporter. 96.16
PRK03545 390 putative arabinose transporter; Provisional 96.15
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 96.14
PRK11663 434 regulatory protein UhpC; Provisional 96.12
PRK10642 490 proline/glycine betaine transporter; Provisional 96.09
PRK10473 392 multidrug efflux system protein MdtL; Provisional 96.08
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.05
PRK12307 426 putative sialic acid transporter; Provisional 96.04
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 96.03
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 96.0
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 95.97
PRK10213 394 nepI ribonucleoside transporter; Reviewed 95.95
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 95.93
PRK10133 438 L-fucose transporter; Provisional 95.93
PRK09952438 shikimate transporter; Provisional 95.9
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 95.88
PRK14995 495 methyl viologen resistance protein SmvA; Provision 95.85
PRK11646 400 multidrug resistance protein MdtH; Provisional 95.83
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 95.81
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 95.79
PRK10054 395 putative transporter; Provisional 95.76
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.72
PRK11652 394 emrD multidrug resistance protein D; Provisional 95.7
PRK03633 381 putative MFS family transporter protein; Provision 95.69
TIGR00901356 2A0125 AmpG-related permease. 95.66
PRK10091 382 MFS transport protein AraJ; Provisional 95.63
KOG0252|consensus 538 95.62
KOG0254|consensus 513 95.59
PRK03893 496 putative sialic acid transporter; Provisional 95.57
PLN00028 476 nitrate transmembrane transporter; Provisional 95.53
TIGR00897 402 2A0118 polyol permease family. This family of prot 95.47
PRK09584 500 tppB putative tripeptide transporter permease; Rev 95.47
PRK11043 401 putative transporter; Provisional 95.46
KOG0252|consensus 538 95.41
PRK09874 408 drug efflux system protein MdtG; Provisional 95.34
TIGR00892 455 2A0113 monocarboxylate transporter 1. 95.3
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 95.29
PRK10504 471 putative transporter; Provisional 95.21
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 95.16
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 95.11
TIGR00896 355 CynX cyanate transporter. This family of proteins 95.09
PRK10489 417 enterobactin exporter EntS; Provisional 95.08
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 95.07
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 95.01
PRK10473392 multidrug efflux system protein MdtL; Provisional 95.0
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 94.95
PRK09528 420 lacY galactoside permease; Reviewed 94.76
KOG2615|consensus 451 94.76
PRK14995 495 methyl viologen resistance protein SmvA; Provision 94.68
PTZ00207 591 hypothetical protein; Provisional 94.62
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 94.55
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 94.47
PRK12307426 putative sialic acid transporter; Provisional 94.4
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 94.38
PRK05122399 major facilitator superfamily transporter; Provisi 94.37
TIGR00891405 2A0112 putative sialic acid transporter. 94.32
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 94.21
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 94.17
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 94.16
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 94.04
PRK09874408 drug efflux system protein MdtG; Provisional 94.0
PRK11010 491 ampG muropeptide transporter; Validated 93.98
PRK15402406 multidrug efflux system translocase MdfA; Provisio 93.96
TIGR00889418 2A0110 nucleoside transporter. This family of prot 93.93
PRK09528420 lacY galactoside permease; Reviewed 93.74
PRK15011393 sugar efflux transporter B; Provisional 93.73
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 93.7
PRK10406432 alpha-ketoglutarate transporter; Provisional 93.63
PRK15075434 citrate-proton symporter; Provisional 93.62
PRK11902402 ampG muropeptide transporter; Reviewed 93.61
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 93.54
PRK03893496 putative sialic acid transporter; Provisional 93.54
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 93.41
KOG0569|consensus 485 93.37
COG2211 467 MelB Na+/melibiose symporter and related transport 93.34
PRK10504471 putative transporter; Provisional 93.29
PF13347428 MFS_2: MFS/sugar transport protein 93.25
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 93.24
PRK10091382 MFS transport protein AraJ; Provisional 93.11
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 93.09
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 92.95
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 92.32
PRK03699394 putative transporter; Provisional 92.27
PRK12382392 putative transporter; Provisional 92.2
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 92.19
TIGR01272310 gluP glucose/galactose transporter. Disruption of 92.12
TIGR00900365 2A0121 H+ Antiporter protein. 92.12
TIGR00902382 2A0127 phenyl proprionate permease family protein. 92.01
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 91.82
PRK10429 473 melibiose:sodium symporter; Provisional 91.82
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 91.65
TIGR00895398 2A0115 benzoate transport. 91.34
TIGR00897402 2A0118 polyol permease family. This family of prot 91.27
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 91.23
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 91.14
PRK11902 402 ampG muropeptide transporter; Reviewed 90.77
TIGR00901 356 2A0125 AmpG-related permease. 90.65
PRK10429 473 melibiose:sodium symporter; Provisional 90.61
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 90.58
PRK09848448 glucuronide transporter; Provisional 90.52
PRK03633381 putative MFS family transporter protein; Provision 90.51
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 90.19
PRK10133438 L-fucose transporter; Provisional 90.07
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 89.87
PRK11043401 putative transporter; Provisional 89.69
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 89.59
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 89.59
PRK09669444 putative symporter YagG; Provisional 89.49
KOG3764|consensus 464 89.17
PF1283277 MFS_1_like: MFS_1 like family 88.5
PLN00028 476 nitrate transmembrane transporter; Provisional 88.48
TIGR00805 633 oat sodium-independent organic anion transporter. 87.81
PRK11010 491 ampG muropeptide transporter; Validated 87.57
KOG2504|consensus 509 86.94
PRK09705393 cynX putative cyanate transporter; Provisional 86.88
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 86.82
PRK09669 444 putative symporter YagG; Provisional 86.12
PF13347 428 MFS_2: MFS/sugar transport protein 85.96
PRK15011 393 sugar efflux transporter B; Provisional 85.65
TIGR00896355 CynX cyanate transporter. This family of proteins 85.64
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 85.0
PF11947153 DUF3464: Protein of unknown function (DUF3464); In 84.83
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 84.7
TIGR00893399 2A0114 d-galactonate transporter. 83.93
PF06813 250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 83.7
KOG0255|consensus521 83.7
PRK11462 460 putative transporter; Provisional 83.18
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 82.51
PF0178840 PsbJ: PsbJ; InterPro: IPR002682 Oxygenic photosynt 82.26
PRK03545390 putative arabinose transporter; Provisional 81.88
PF06898 385 YqfD: Putative stage IV sporulation protein YqfD; 81.08
>KOG0569|consensus Back     alignment and domain information
Probab=99.37  E-value=7.2e-13  Score=84.30  Aligned_cols=68  Identities=34%  Similarity=0.515  Sum_probs=57.8

Q ss_pred             chhhhhhhhhchhHHHHHHHHHHHHHHHHHHHHhhcccCCCCcccccHHHHHHHHHHHHHhhcccccccC
Q psy16665          2 GLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL   71 (71)
Q Consensus         2 ~~~~~l~d~~gRR~lll~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~   71 (71)
                      +++.+++||.|||++++.+..++.++.+.+.+.....+..  .....+..+++.++|.++|+.|+||+||
T Consensus       323 ~~~~~lid~~gRRpLll~~~~~~~~~~~~~~~~~~l~~~~--~~~~~y~~i~~~~~~~~~f~~G~gpi~~  390 (485)
T KOG0569|consen  323 LVSPFLIDRLGRRPLLLISLSLMAVALLLMSIALFLSNSF--GSWLSYLCIAAIFLFIISFAIGPGPIPW  390 (485)
T ss_pred             HHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHHHHHHHHh--hhHHHHHHHHHHHHHHHhhhcCCCchhH
Confidence            5678999999999999999999999999998776554432  1356677889999999999999999997



>KOG0254|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PF11947 DUF3464: Protein of unknown function (DUF3464); InterPro: IPR021855 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF01788 PsbJ: PsbJ; InterPro: IPR002682 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PF06898 YqfD: Putative stage IV sporulation protein YqfD; InterPro: IPR010690 This family consists of several putative bacterial stage IV sporulation (SpoIV) proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.55
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 97.21
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 96.75
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 96.73
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 96.18
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.05
2xut_A 524 Proton/peptide symporter family protein; transport 95.87
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 95.71
2cfq_A417 Lactose permease; transport, transport mechanism, 95.3
2cfq_A 417 Lactose permease; transport, transport mechanism, 94.62
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 94.17
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 91.74
3arc_J40 Photosystem II reaction center protein J; PSII, me 85.99
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=98.55  E-value=1.7e-07  Score=57.46  Aligned_cols=63  Identities=25%  Similarity=0.549  Sum_probs=48.8

Q ss_pred             chhhhhhhhhchhHHHHHHHHHHHHHHHHHHHHhhcccCCCCcccccHHHHHHHHHHHHHhhcccccccC
Q psy16665          2 GLSVVLVDKAGRRLLLLLSVIIMGLCLGVLGFYFFLKNSGSDVSSIAFLPLISVIMFIVMFSIPWGDKNL   71 (71)
Q Consensus         2 ~~~~~l~d~~gRR~lll~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~   71 (71)
                      +++.+++||+|||+.++.+...+.++++.++.....       ....+..+..++++..+++.+++|++|
T Consensus       330 ~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~  392 (491)
T 4gc0_A          330 VLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAFYT-------QAPGIVALLSMLFYVAAFAMSWGPVCW  392 (491)
T ss_dssp             HHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHHHT-------TCCHHHHHHHHHHHHHHHHTTTTHHHH
T ss_pred             HHHHHHHHhhcCcchhccchHHHHHHHHHHHHHHhc-------ccchHHHHHHHHHHHHHHHhHHHHHHH
Confidence            356788999999999999999999988877754322       234566777777888889988888754



>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3arc_J Photosystem II reaction center protein J; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 1s5l_J* 3a0b_J* 3a0h_J* 2axt_J* 3bz1_J* 3bz2_J* 3kzi_J* 3prq_J* 3prr_J* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 97.02
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 96.89
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 95.17
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 87.79
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=97.02  E-value=0.00062  Score=39.34  Aligned_cols=31  Identities=19%  Similarity=0.403  Sum_probs=26.0

Q ss_pred             hhhhhhhhhchhHHHHHHHHHHHHHHHHHHH
Q psy16665          3 LSVVLVDKAGRRLLLLLSVIIMGLCLGVLGF   33 (71)
Q Consensus         3 ~~~~l~d~~gRR~lll~g~~~~~~~~~~~~~   33 (71)
                      +...+.||+|||+.++.+.....++.+..+.
T Consensus        78 ~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~  108 (447)
T d1pw4a_          78 IMGSVSDRSNPRVFLPAGLILAAAVMLFMGF  108 (447)
T ss_dssp             HHHHHHHHSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHcCchHHHHHHHHHHHHHHhhccc
Confidence            4567899999999999999888888776654



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure