Psyllid ID: psy16666


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
MIKNSPTSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYYYCNNKGRTD
ccccccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccccHEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcHcHcEEEEEEccccccc
miknsptsgigepsVYHALVVIFLEFFAWGLLTMPIISvlnrtfpdhtfLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTclpiplmtldTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLvssetnqysspsltpfyyycnnkgrtd
miknsptsgigepSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVssetnqysspsltpfyyycnnkgrtd
MIKNSPTSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYYYCNNKGRTD
*************SVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSS*******PSLTPFYYYCN******
****************HALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYY*********
**********GEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYYYCNNKGRTD
*****PTSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYYYCNNK****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKNSPTSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEEHERSLAYGLVSSETNQYSSPSLTPFYYYCNNKGRTD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
P70187 490 Hippocampus abundant tran yes N/A 0.856 0.291 0.756 3e-59
Q96MC6 490 Hippocampus abundant tran yes N/A 0.856 0.291 0.756 3e-59
A4IF94 502 Hippocampus abundant tran no N/A 0.892 0.296 0.708 1e-56
Q5SR56 506 Hippocampus abundant tran no N/A 0.892 0.294 0.701 2e-56
Q8CIA9 507 Hippocampus abundant tran no N/A 0.874 0.287 0.709 7e-56
B2RYH9 507 Hippocampus abundant tran no N/A 0.940 0.309 0.664 1e-55
Q5VZR4134 Hippocampus abundant tran no N/A 0.556 0.694 0.741 2e-34
P02981 396 Tetracycline resistance p yes N/A 0.670 0.282 0.310 2e-08
P02982 399 Tetracycline resistance p yes N/A 0.670 0.280 0.275 8e-07
Q07282 405 Tetracycline resistance p yes N/A 0.772 0.318 0.291 3e-05
>sp|P70187|HIAT1_MOUSE Hippocampus abundant transcript 1 protein OS=Mus musculus GN=Hiat1 PE=2 SV=3 Back     alignment and function desciption
 Score =  227 bits (579), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 109/144 (75%), Positives = 126/144 (87%), Gaps = 1/144 (0%)

Query: 1   MIKNSPT-SGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIK 59
           +IK+  T  GIG PSVYHA++VIFLEFFAWGLLT P + VL+ TFP HTFLMNGLI G+K
Sbjct: 22  IIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHTFLMNGLIQGVK 81

Query: 60  GFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFS 119
           G LSFLSAPLIGALSD+WGRK FLL+TVF TC PIPLM +  WW+FA+IS+SGVFAVTFS
Sbjct: 82  GLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFS 141

Query: 120 VVFAYVADVTEEHERSLAYGLVSS 143
           VVFAYVAD+T+EHERS+AYGLVS+
Sbjct: 142 VVFAYVADITQEHERSMAYGLVSA 165





Mus musculus (taxid: 10090)
>sp|Q96MC6|HIAT1_HUMAN Hippocampus abundant transcript 1 protein OS=Homo sapiens GN=HIAT1 PE=2 SV=2 Back     alignment and function description
>sp|A4IF94|HIAL1_BOVIN Hippocampus abundant transcript-like protein 1 OS=Bos taurus GN=HIATL1 PE=2 SV=1 Back     alignment and function description
>sp|Q5SR56|HIAL1_HUMAN Hippocampus abundant transcript-like protein 1 OS=Homo sapiens GN=HIATL1 PE=2 SV=3 Back     alignment and function description
>sp|Q8CIA9|HIAL1_MOUSE Hippocampus abundant transcript-like protein 1 OS=Mus musculus GN=Hiatl1 PE=2 SV=3 Back     alignment and function description
>sp|B2RYH9|HIAL1_RAT Hippocampus abundant transcript-like protein 1 OS=Rattus norvegicus GN=Hiatl1 PE=2 SV=1 Back     alignment and function description
>sp|Q5VZR4|HIAL2_HUMAN Hippocampus abundant transcript-like protein 2 OS=Homo sapiens GN=HIATL2 PE=2 SV=1 Back     alignment and function description
>sp|P02981|TCR3_ECOLX Tetracycline resistance protein, class C OS=Escherichia coli GN=tetA PE=1 SV=1 Back     alignment and function description
>sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 Back     alignment and function description
>sp|Q07282|TCR5_ECOLX Tetracycline resistance protein, class E OS=Escherichia coli GN=tetA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
242008091 399 Hippocampus abundant transcript 1 protei 0.802 0.335 0.910 7e-65
270008667 532 hypothetical protein TcasGA2_TC015216 [T 0.850 0.266 0.852 2e-63
357602333 455 hypothetical protein KGM_14170 [Danaus p 0.892 0.327 0.821 4e-63
170031034 660 hippocampus abundant 1 protein [Culex qu 0.820 0.207 0.854 5e-63
24656463 680 CG11537, isoform A [Drosophila melanogas 0.820 0.201 0.854 5e-63
307205753 524 Hippocampus abundant transcript 1 protei 0.844 0.269 0.858 6e-63
386770446 680 CG11537, isoform F [Drosophila melanogas 0.820 0.201 0.854 6e-63
195374620 676 GJ12706 [Drosophila virilis] gi|19415325 0.820 0.202 0.854 6e-63
195442368 712 GK18034 [Drosophila willistoni] gi|19416 0.820 0.192 0.854 6e-63
161080924 705 CG11537, isoform D [Drosophila melanogas 0.820 0.194 0.854 6e-63
>gi|242008091|ref|XP_002424846.1| Hippocampus abundant transcript 1 protein, putative [Pediculus humanus corporis] gi|212508396|gb|EEB12108.1| Hippocampus abundant transcript 1 protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  251 bits (641), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 129/134 (96%)

Query: 7   TSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLS 66
           TSGIGEP+VYHALVVIFLEFFAWGLLTMPII+VLN TFPDHTFLMNG+IMGIKGFLSFLS
Sbjct: 30  TSGIGEPNVYHALVVIFLEFFAWGLLTMPIIAVLNETFPDHTFLMNGIIMGIKGFLSFLS 89

Query: 67  APLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVA 126
           APLIGALSD+WGRK FLLITVF TC PIPLMT++TWWFFAMISISG+FAVTFSVVFAYVA
Sbjct: 90  APLIGALSDVWGRKFFLLITVFFTCAPIPLMTVNTWWFFAMISISGIFAVTFSVVFAYVA 149

Query: 127 DVTEEHERSLAYGL 140
           DVTEE ERSLAYGL
Sbjct: 150 DVTEESERSLAYGL 163




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270008667|gb|EFA05115.1| hypothetical protein TcasGA2_TC015216 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357602333|gb|EHJ63356.1| hypothetical protein KGM_14170 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170031034|ref|XP_001843392.1| hippocampus abundant 1 protein [Culex quinquefasciatus] gi|167868872|gb|EDS32255.1| hippocampus abundant 1 protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|24656463|ref|NP_728811.1| CG11537, isoform A [Drosophila melanogaster] gi|24656468|ref|NP_728812.1| CG11537, isoform B [Drosophila melanogaster] gi|7292310|gb|AAF47717.1| CG11537, isoform A [Drosophila melanogaster] gi|7292311|gb|AAF47718.1| CG11537, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307205753|gb|EFN83983.1| Hippocampus abundant transcript 1 protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|386770446|ref|NP_001246588.1| CG11537, isoform F [Drosophila melanogaster] gi|383291712|gb|AFH04259.1| CG11537, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195374620|ref|XP_002046101.1| GJ12706 [Drosophila virilis] gi|194153259|gb|EDW68443.1| GJ12706 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195442368|ref|XP_002068930.1| GK18034 [Drosophila willistoni] gi|194165015|gb|EDW79916.1| GK18034 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|161080924|ref|NP_001097489.1| CG11537, isoform D [Drosophila melanogaster] gi|161080926|ref|NP_001097490.1| CG11537, isoform E [Drosophila melanogaster] gi|442629880|ref|NP_001261354.1| CG11537, isoform G [Drosophila melanogaster] gi|45825071|gb|AAS77443.1| GH21943p [Drosophila melanogaster] gi|158028420|gb|ABW08449.1| CG11537, isoform D [Drosophila melanogaster] gi|158028421|gb|ABW08450.1| CG11537, isoform E [Drosophila melanogaster] gi|440215232|gb|AGB94049.1| CG11537, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
FB|FBgn0035400 705 CG11537 [Drosophila melanogast 0.820 0.194 0.854 1.8e-62
ZFIN|ZDB-GENE-030131-834 493 hiat1a "hippocampus abundant t 0.916 0.310 0.717 1.7e-57
UNIPROTKB|Q5ZJK7 492 HCN2 "Uncharacterized protein" 0.868 0.294 0.741 4.6e-57
UNIPROTKB|A6QLP5 490 HIAT1 "Uncharacterized protein 0.916 0.312 0.711 4.6e-57
UNIPROTKB|Q96MC6 490 HIAT1 "Hippocampus abundant tr 0.916 0.312 0.711 4.6e-57
MGI|MGI:1201609 490 Hiat1 "hippocampus abundant ge 0.916 0.312 0.711 4.6e-57
RGD|1305281 490 Hiat1 "hippocampus abundant tr 0.916 0.312 0.711 4.6e-57
UNIPROTKB|F1S559 462 LOC100622510 "Uncharacterized 0.868 0.313 0.734 1.6e-56
ZFIN|ZDB-GENE-040426-2935 485 hiat1b "hippocampus abundant t 0.856 0.294 0.736 2e-56
UNIPROTKB|F1PLI9 506 LOC476363 "Uncharacterized pro 0.868 0.286 0.727 2.3e-55
FB|FBgn0035400 CG11537 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 621 (223.7 bits), Expect = 1.8e-62, Sum P(2) = 1.8e-62
 Identities = 117/137 (85%), Positives = 127/137 (92%)

Query:     7 TSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLS 66
             +SGIGEPSV+HALVVIFLEFFAWGLLTMPIIS LN+TFPDHTFLMNGL+MGIKG LSFLS
Sbjct:   245 SSGIGEPSVHHALVVIFLEFFAWGLLTMPIISTLNQTFPDHTFLMNGLVMGIKGILSFLS 304

Query:    67 APLIGALSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVA 126
             APLIGALSD+WGRK FLL+TVF TCLPIPLM+++TWWFFAMISISG FAVTFSVVFAYVA
Sbjct:   305 APLIGALSDIWGRKFFLLVTVFFTCLPIPLMSINTWWFFAMISISGAFAVTFSVVFAYVA 364

Query:   127 DVTEEHERSLAYGLVSS 143
             DVT   ERS AYGL S+
Sbjct:   365 DVTTPEERSKAYGLASA 381


GO:0015144 "carbohydrate transmembrane transporter activity" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
ZFIN|ZDB-GENE-030131-834 hiat1a "hippocampus abundant transcript 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJK7 HCN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLP5 HIAT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96MC6 HIAT1 "Hippocampus abundant transcript 1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1201609 Hiat1 "hippocampus abundant gene transcript 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305281 Hiat1 "hippocampus abundant transcript 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S559 LOC100622510 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2935 hiat1b "hippocampus abundant transcript 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLI9 LOC476363 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96MC6HIAT1_HUMANNo assigned EC number0.75690.85620.2918yesN/A
P70187HIAT1_MOUSENo assigned EC number0.75690.85620.2918yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
pfam07690 346 pfam07690, MFS_1, Major Facilitator Superfamily 5e-08
cd06174 352 cd06174, MFS, The Major Facilitator Superfamily (M 2e-05
TIGR00880141 TIGR00880, 2_A_01_02, Multidrug resistance protein 6e-05
pfam07690346 pfam07690, MFS_1, Major Facilitator Superfamily 1e-04
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (M 0.001
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
 Score = 50.5 bits (121), Expect = 5e-08
 Identities = 33/128 (25%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 19  LVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWG 78
            +  FL      LL   +   L       +    GL++        L+ PL G LSD +G
Sbjct: 2   FLAAFLAGLGRSLLGPALPLYLAEDL-GISPTEIGLLLTAFSLGYALAQPLAGRLSDRFG 60

Query: 79  RKLFLLITVFVTCLP--IPLMTLDTWWFFAMISISGVF-AVTFSVVFAYVADVTEEHERS 135
           R+  LLI + +  L   + L     W    +  + G+     F    A +AD     ER 
Sbjct: 61  RRRVLLIGLLLFALGLLLLLFASSLWLLLVLRVLQGLGGGALFPAAAALIADWFPPEERG 120

Query: 136 LAYGLVSS 143
            A GL+S+
Sbjct: 121 RALGLLSA 128


Length = 346

>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|233166 TIGR00880, 2_A_01_02, Multidrug resistance protein Back     alignment and domain information
>gnl|CDD|219516 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
PRK12382 392 putative transporter; Provisional 99.79
PRK10054 395 putative transporter; Provisional 99.77
PRK05122 399 major facilitator superfamily transporter; Provisi 99.76
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.75
PRK09874 408 drug efflux system protein MdtG; Provisional 99.74
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.74
PRK03633 381 putative MFS family transporter protein; Provision 99.73
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.73
PRK03545 390 putative arabinose transporter; Provisional 99.73
KOG2615|consensus 451 99.72
PRK10504 471 putative transporter; Provisional 99.71
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.71
TIGR00891 405 2A0112 putative sialic acid transporter. 99.71
TIGR00900 365 2A0121 H+ Antiporter protein. 99.71
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.7
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.7
PRK12307 426 putative sialic acid transporter; Provisional 99.69
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.69
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.68
PRK10091 382 MFS transport protein AraJ; Provisional 99.68
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.68
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.67
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.67
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.67
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.66
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.65
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.64
PRK03699 394 putative transporter; Provisional 99.64
PRK10133 438 L-fucose transporter; Provisional 99.64
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.64
PRK10489 417 enterobactin exporter EntS; Provisional 99.64
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.64
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.64
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.63
PRK11663 434 regulatory protein UhpC; Provisional 99.63
TIGR00895 398 2A0115 benzoate transport. 99.63
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.63
PRK03893 496 putative sialic acid transporter; Provisional 99.63
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.62
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.62
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.62
KOG1330|consensus 493 99.61
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.61
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.6
PLN00028 476 nitrate transmembrane transporter; Provisional 99.6
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.6
PRK15075 434 citrate-proton symporter; Provisional 99.6
PRK11043 401 putative transporter; Provisional 99.6
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.59
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.59
PRK09705 393 cynX putative cyanate transporter; Provisional 99.59
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.59
TIGR00893 399 2A0114 d-galactonate transporter. 99.59
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.59
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.58
TIGR00900365 2A0121 H+ Antiporter protein. 99.57
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.57
PRK10642 490 proline/glycine betaine transporter; Provisional 99.56
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.56
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.55
KOG3764|consensus 464 99.55
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.54
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.54
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.53
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.53
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.53
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.53
TIGR00893399 2A0114 d-galactonate transporter. 99.52
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.52
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.52
TIGR00891405 2A0112 putative sialic acid transporter. 99.51
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.51
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.51
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.5
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.5
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.5
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.5
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.49
PRK15011393 sugar efflux transporter B; Provisional 99.49
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.49
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.49
TIGR00895398 2A0115 benzoate transport. 99.48
PRK03633381 putative MFS family transporter protein; Provision 99.48
PRK10504471 putative transporter; Provisional 99.47
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.47
PRK09952 438 shikimate transporter; Provisional 99.47
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.47
PRK10642490 proline/glycine betaine transporter; Provisional 99.47
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.46
PRK09952438 shikimate transporter; Provisional 99.46
PRK03699394 putative transporter; Provisional 99.46
PRK09528 420 lacY galactoside permease; Reviewed 99.46
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.46
PRK15011 393 sugar efflux transporter B; Provisional 99.46
TIGR00898 505 2A0119 cation transport protein. 99.46
PRK09705393 cynX putative cyanate transporter; Provisional 99.46
PRK10489417 enterobactin exporter EntS; Provisional 99.45
TIGR00897402 2A0118 polyol permease family. This family of prot 99.45
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.45
TIGR00896355 CynX cyanate transporter. This family of proteins 99.44
PRK03545390 putative arabinose transporter; Provisional 99.43
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.42
PRK03893496 putative sialic acid transporter; Provisional 99.42
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.42
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.42
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.41
PRK12382392 putative transporter; Provisional 99.41
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.4
PRK09874408 drug efflux system protein MdtG; Provisional 99.4
PRK15075434 citrate-proton symporter; Provisional 99.4
KOG4686|consensus459 99.39
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.39
TIGR00901356 2A0125 AmpG-related permease. 99.39
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.39
PRK05122399 major facilitator superfamily transporter; Provisi 99.38
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.38
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.37
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.37
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.37
PRK11902 402 ampG muropeptide transporter; Reviewed 99.36
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.36
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.36
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.35
KOG0255|consensus 521 99.35
PRK12307426 putative sialic acid transporter; Provisional 99.35
PRK09528420 lacY galactoside permease; Reviewed 99.35
PRK11663434 regulatory protein UhpC; Provisional 99.35
PRK11010 491 ampG muropeptide transporter; Validated 99.35
TIGR00805 633 oat sodium-independent organic anion transporter. 99.34
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.33
KOG2532|consensus 466 99.33
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.32
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.32
PTZ00207 591 hypothetical protein; Provisional 99.32
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.31
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.31
KOG0254|consensus 513 99.3
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.3
PRK11646400 multidrug resistance protein MdtH; Provisional 99.3
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.28
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.28
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.27
TIGR00901 356 2A0125 AmpG-related permease. 99.27
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.26
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.26
KOG2325|consensus 488 99.25
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.24
COG2270438 Permeases of the major facilitator superfamily [Ge 99.24
PRK09848448 glucuronide transporter; Provisional 99.24
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.24
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.23
PRK11010 491 ampG muropeptide transporter; Validated 99.22
PF13347428 MFS_2: MFS/sugar transport protein 99.21
PRK10091382 MFS transport protein AraJ; Provisional 99.2
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.2
KOG0569|consensus 485 99.19
TIGR00898505 2A0119 cation transport protein. 99.19
PRK10133438 L-fucose transporter; Provisional 99.18
PRK10054395 putative transporter; Provisional 99.18
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.18
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.17
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.16
PRK09669444 putative symporter YagG; Provisional 99.15
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.14
PRK11195393 lysophospholipid transporter LplT; Provisional 99.14
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 99.13
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.13
PRK10429473 melibiose:sodium symporter; Provisional 99.13
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.12
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 99.1
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.1
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.09
PLN00028476 nitrate transmembrane transporter; Provisional 99.08
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.07
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.07
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.06
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.05
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.03
KOG2504|consensus509 99.01
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.0
PRK11902402 ampG muropeptide transporter; Reviewed 99.0
PRK11043401 putative transporter; Provisional 98.99
KOG2816|consensus 463 98.97
PRK10473392 multidrug efflux system protein MdtL; Provisional 98.97
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.96
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 98.95
PRK10429 473 melibiose:sodium symporter; Provisional 98.95
PRK09669 444 putative symporter YagG; Provisional 98.94
KOG2533|consensus 495 98.93
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 98.93
PRK11462460 putative transporter; Provisional 98.92
PF1283277 MFS_1_like: MFS_1 like family 98.92
PRK11652394 emrD multidrug resistance protein D; Provisional 98.91
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 98.9
KOG3762|consensus618 98.82
KOG0569|consensus485 98.81
KOG0252|consensus 538 98.8
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.73
COG0477 338 ProP Permeases of the major facilitator superfamil 98.72
COG2211467 MelB Na+/melibiose symporter and related transport 98.7
KOG0253|consensus528 98.7
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.69
PRK11462 460 putative transporter; Provisional 98.65
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.64
PRK09848 448 glucuronide transporter; Provisional 98.61
KOG2532|consensus466 98.57
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.57
KOG2504|consensus 509 98.56
TIGR00788 468 fbt folate/biopterin transporter. The only functio 98.55
PF13347 428 MFS_2: MFS/sugar transport protein 98.54
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.52
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 98.51
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.5
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.45
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.44
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.43
KOG2615|consensus451 98.36
COG2211 467 MelB Na+/melibiose symporter and related transport 98.34
KOG0254|consensus513 98.33
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.3
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.26
KOG0637|consensus 498 98.23
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.14
PRK15462493 dipeptide/tripeptide permease D; Provisional 98.11
KOG3764|consensus464 98.05
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.0
KOG0253|consensus 528 97.93
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 97.91
KOG2533|consensus495 97.88
KOG2563|consensus 480 97.86
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.83
KOG2816|consensus463 97.75
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 97.72
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 97.69
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.61
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 97.6
TIGR00805 633 oat sodium-independent organic anion transporter. 97.58
KOG0255|consensus521 97.58
KOG3762|consensus 618 97.48
KOG1330|consensus493 97.44
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.39
KOG4686|consensus 459 97.34
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.33
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 97.32
PTZ00207591 hypothetical protein; Provisional 97.15
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 96.82
KOG0252|consensus538 96.72
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 96.71
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 96.66
KOG3098|consensus 461 96.59
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 96.53
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.42
KOG3098|consensus461 96.37
PRK03612 521 spermidine synthase; Provisional 96.32
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 96.2
KOG2563|consensus480 96.15
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 94.89
KOG3626|consensus 735 93.27
KOG3574|consensus 510 93.03
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 92.88
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 92.77
KOG4332|consensus 454 92.54
KOG2601|consensus 503 92.42
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 92.24
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 90.57
KOG3626|consensus 735 90.53
KOG4332|consensus454 89.95
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 89.33
KOG1479|consensus406 87.84
TIGR00880141 2_A_01_02 Multidrug resistance protein. 87.21
KOG4830|consensus 412 86.85
KOG3810|consensus433 85.67
PF11947153 DUF3464: Protein of unknown function (DUF3464); In 83.54
PF01733309 Nucleoside_tran: Nucleoside transporter; InterPro: 81.37
>PRK12382 putative transporter; Provisional Back     alignment and domain information
Probab=99.79  E-value=1.3e-17  Score=124.52  Aligned_cols=155  Identities=15%  Similarity=0.160  Sum_probs=120.5

Q ss_pred             CCCCCCCCchhHHHHHHHHHHHHHHHHhHHHHHHHHHHhhCCCchHHHHHHHHHHHHHHHHhhhhhhhhhhhhhcchHHH
Q psy16666          4 NSPTSGIGEPSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFL   83 (167)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~r~~~   83 (167)
                      +++.+.+.++.++.+.+..++...+.+. ..|.+|.+.++..+.+..+.|++.+...++..++++++|+++||+|||+++
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~p~l~~~l~~~lg~s~~~~g~~~s~~~~~~~i~~~~~G~l~Dr~g~r~~l   84 (392)
T PRK12382          6 QTETRSSANFSLFRIAFAVFLTYMTVGL-PLPVIPLFVHHDLGFGNTMVGIAVGIQFLATVLTRGYAGRLADQYGAKRSA   84 (392)
T ss_pred             cCcCCCcccccHHHHHHHHHHHHHHHHH-HhhhhhHHHHHhcCCcHHHHHHHHHHHHHHHHHHhhhhhHHHHhhcchHHH
Confidence            3445556667777777777777777656 689999887554445556779999999999999999999999999999999


Q ss_pred             HHHHHHHHhhHHh---h-------hHHHHHHHHHHHHHHHHHH-HHHHHHHHHhccccchhhHHHHHHHHHHHhh--hhc
Q psy16666         84 LITVFVTCLPIPL---M-------TLDTWWFFAMISISGVFAV-TFSVVFAYVADVTEEHERSLAYGLVSSETNQ--YSS  150 (167)
Q Consensus        84 ~~~~~~~~~~~~~---~-------~~~~~~~~~~~~~~g~~~~-~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~--~~g  150 (167)
                      ..+.+...++...   .       ..+.+.+++.++++|++.+ ..+...+++.|..|+|+|++++++.+...+.  .+|
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~r~l~G~~~~~~~~~~~~~~~~~~~~~~r~~a~~~~~~~~~~g~~~g  164 (392)
T PRK12382         85 LQGMLACGLAGLAYLLAAILPVSAPFKFALLVVGRLILGFGESQLLTGALTWGLGLVGPKHSGKVMSWNGMAMYGALAAG  164 (392)
T ss_pred             HHHHHHHHHHHHHHHhhhccccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCccccchhhhHHHHHHHHHHHHH
Confidence            8886554443221   1       1266778889999998654 5567788999999999999999998887776  889


Q ss_pred             cchhhHhhh
Q psy16666        151 PSLTPFYYY  159 (167)
Q Consensus       151 p~i~g~l~~  159 (167)
                      |.+++.+.+
T Consensus       165 ~~~~~~l~~  173 (392)
T PRK12382        165 APLGLLLHS  173 (392)
T ss_pred             HHHHHHHHh
Confidence            999888764



>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>KOG2601|consensus Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>KOG4830|consensus Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF11947 DUF3464: Protein of unknown function (DUF3464); InterPro: IPR021855 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PF01733 Nucleoside_tran: Nucleoside transporter; InterPro: IPR002259 Delayed-early response (DER) gene products include growth progression factors and several unknown products of novel cDNAs Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 42.9 bits (100), Expect = 2e-05
 Identities = 26/128 (20%), Positives = 41/128 (32%), Gaps = 30/128 (23%)

Query: 32  LTMPIISVLNRTFPDH-----TFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLIT 86
             + II+   R              + L   I+  L+ L             RK+F  ++
Sbjct: 328 RRLSIIAESIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEY--------RKMFDRLS 379

Query: 87  VFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVFAYVADVTEE-HERSLAYGLVSSET 145
           VF     IP + L   W F +I                V  V  + H+ SL       + 
Sbjct: 380 VFPPSAHIPTILLSLIW-FDVIKSD-------------VMVVVNKLHKYSLVEK--QPKE 423

Query: 146 NQYSSPSL 153
           +  S PS+
Sbjct: 424 STISIPSI 431


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.79
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.77
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.71
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.7
2xut_A 524 Proton/peptide symporter family protein; transport 99.69
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.68
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.54
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.49
2cfq_A417 Lactose permease; transport, transport mechanism, 99.48
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.39
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 99.31
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.27
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.22
2xut_A524 Proton/peptide symporter family protein; transport 98.44
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
Probab=99.79  E-value=1.4e-17  Score=124.14  Aligned_cols=136  Identities=16%  Similarity=0.122  Sum_probs=114.2

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHhhCCCchHHHHHHHHHHHHHHHHhhhhhhhhhhhhhcchHHHHHHHHHHHhhHHhh---
Q psy16666         21 VIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLM---   97 (167)
Q Consensus        21 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~r~~~~~~~~~~~~~~~~~---   97 (167)
                      ..+...+.... ..+.+|.+.++++.++. +.+++.+...++..++.+++|+++||+|||+++..+.++.+++....   
T Consensus        34 ~~~~~~~~~~~-~~~~~~~~~~~~g~s~~-~~g~~~~~~~~~~~i~~~~~G~l~dr~g~r~~l~~~~~~~~~~~~~~~~~  111 (438)
T 3o7q_A           34 LFFLWAVANNL-NDILLPQFQQAFTLTNF-QAGLIQSAFYFGYFIIPIPAGILMKKLSYKAGIITGLFLYALGAALFWPA  111 (438)
T ss_dssp             HHHHHHHHHHH-HHHHHHHHHHHSCCCSH-HHHHHHHHHHHHHHTTHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHh-HHHHHHHHHHHcCCCHH-HHHHHHHHHHHHHHHHHHhHHHHHHHhcchHHHHHHHHHHHHHHHHHHhc
Confidence            33444444333 67888888888877665 56999999999999999999999999999999999987777766655   


Q ss_pred             hH--HHHHHHHHHHHHHHHH-HHHHHHHHHHhccccchhhHHHHHHHHHHHhh--hhccchhhHhh
Q psy16666         98 TL--DTWWFFAMISISGVFA-VTFSVVFAYVADVTEEHERSLAYGLVSSETNQ--YSSPSLTPFYY  158 (167)
Q Consensus        98 ~~--~~~~~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~--~~gp~i~g~l~  158 (167)
                      ..  +.+.+++.+++.|++. ...+...+++.|++|+++|+++.++.+...++  .++|.+++.+.
T Consensus       112 ~~~~~~~~l~~~~~l~G~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~g~~~g~~~~~~l~  177 (438)
T 3o7q_A          112 AEIMNYTLFLVGLFIIAAGLGCLETAANPFVTVLGPESSGHFRLNLAQTFNSFGAIIAVVFGQSLI  177 (438)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCSTTHHHHHHHHHHHHHHHHHHHHHHTTHHH
T ss_pred             cccccHHHHHHHHHHHHhhHHHhhhhHHHHHHHHcCchhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            33  7888999999999965 56779999999999999999999999999888  99999999887



>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d1pv7a_ 417 f.38.1.2 (A:) Lactose permease {Escherichia coli [ 6e-04
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Length = 417 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: LacY-like proton/sugar symporter
domain: Lactose permease
species: Escherichia coli [TaxId: 562]
 Score = 37.1 bits (84), Expect = 6e-04
 Identities = 20/110 (18%), Positives = 34/110 (30%), Gaps = 1/110 (0%)

Query: 13  PSVYHALVVIFLEFFAWGLLTMPIISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGA 72
            + +   +  F  FF  G    P   +        +    G+I       S L  PL G 
Sbjct: 7   TNFWMFGLFFFFYFFIMGAY-FPFFPIWLHDINHISKSDTGIIFAAISLFSLLFQPLFGL 65

Query: 73  LSDLWGRKLFLLITVFVTCLPIPLMTLDTWWFFAMISISGVFAVTFSVVF 122
           LSD  G + +LL  +    +      +  +      +I     V    + 
Sbjct: 66  LSDKLGLRKYLLWIITGMLVMFAPFFIFIFGPLLQYNILVGSIVGGIYLG 115


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.73
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.52
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.39
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.34
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.73  E-value=4.4e-17  Score=119.52  Aligned_cols=127  Identities=13%  Similarity=0.059  Sum_probs=102.9

Q ss_pred             HHHHHHhhCCCchHHHHHHHHHHHHHHHHhhhhhhhhhhhhhcchHHHHHHHHHHHhhHHhhhH------HHHHHHHHHH
Q psy16666         36 IISVLNRTFPDHTFLMNGLIMGIKGFLSFLSAPLIGALSDLWGRKLFLLITVFVTCLPIPLMTL------DTWWFFAMIS  109 (167)
Q Consensus        36 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~l~dr~g~r~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~  109 (167)
                      ....++++.+.++ .+.|++.+...++..++++++|+++||+|||+++..+.++..++..+.+.      +.+.+++.++
T Consensus        46 ~~~p~~~~~g~s~-~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  124 (447)
T d1pw4a_          46 LAMPYLVEQGFSR-GDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLF  124 (447)
T ss_dssp             HHHHHTTSSTTCS-SCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHH
T ss_pred             HHHHHHHHhCcCH-HHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHH
Confidence            3334556665555 46699999999999999999999999999999999997777666555432      4567888889


Q ss_pred             HHHHHH-HHHHHHHHHHhccccchhhHHHHHHHHHHHhh--hhccchhhHhhhhccc
Q psy16666        110 ISGVFA-VTFSVVFAYVADVTEEHERSLAYGLVSSETNQ--YSSPSLTPFYYYCNNK  163 (167)
Q Consensus       110 ~~g~~~-~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~--~~gp~i~g~l~~~~~~  163 (167)
                      +.|++. ...+...+++.|++|+++|++++++.+....+  .++|.+++.+.....+
T Consensus       125 ~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~  181 (447)
T d1pw4a_         125 LCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFND  181 (447)
T ss_dssp             HHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCC
T ss_pred             HHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhc
Confidence            999864 56788999999999999999999999998888  8888888877665443



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure