Psyllid ID: psy16706
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| 156548504 | 439 | PREDICTED: aspartate aminotransferase, m | 0.809 | 0.261 | 0.669 | 2e-41 | |
| 322800334 | 430 | hypothetical protein SINV_02306 [Solenop | 0.880 | 0.290 | 0.628 | 3e-41 | |
| 332372484 | 424 | unknown [Dendroctonus ponderosae] | 0.880 | 0.294 | 0.636 | 4e-41 | |
| 332025582 | 430 | Aspartate aminotransferase, mitochondria | 0.880 | 0.290 | 0.628 | 4e-41 | |
| 201023323 | 424 | aspartate aminotransferase 2 [Acyrthosip | 0.887 | 0.297 | 0.639 | 2e-40 | |
| 91084123 | 423 | PREDICTED: similar to aspartate aminotra | 0.809 | 0.271 | 0.628 | 7e-39 | |
| 25147133 | 414 | Protein GOT-2.2, isoform a [Caenorhabdit | 0.880 | 0.301 | 0.606 | 7e-39 | |
| 307178208 | 429 | Aspartate aminotransferase, mitochondria | 0.880 | 0.291 | 0.613 | 7e-39 | |
| 268579721 | 414 | Hypothetical protein CBG05011 [Caenorhab | 0.880 | 0.301 | 0.613 | 1e-38 | |
| 383861654 | 432 | PREDICTED: aspartate aminotransferase, m | 0.880 | 0.289 | 0.598 | 1e-38 |
| >gi|156548504|ref|XP_001605831.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 173 bits (438), Expect = 2e-41, Method: Compositional matrix adjust.
Identities = 81/121 (66%), Positives = 100/121 (82%), Gaps = 6/121 (4%)
Query: 3 KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
KN G++ GERVGAF++V+ DKDEAAR LSQ+KILIR YS+PPI+GARIV EILG
Sbjct: 278 KNMGLY------GERVGAFTLVNGDKDEAARTLSQIKILIRPMYSNPPINGARIVTEILG 331
Query: 63 DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
+P+LK QWL +VKGMADRIIS+R +L+DNL+K GS + W+HITDQIGMFC+TGL A +V
Sbjct: 332 NPELKKQWLVDVKGMADRIISVRTTLRDNLKKNGSTRDWSHITDQIGMFCFTGLKAPEVE 391
Query: 123 R 123
R
Sbjct: 392 R 392
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322800334|gb|EFZ21338.1| hypothetical protein SINV_02306 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332372484|gb|AEE61384.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|332025582|gb|EGI65745.1| Aspartate aminotransferase, mitochondrial [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|201023323|ref|NP_001128403.1| aspartate aminotransferase 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|91084123|ref|XP_967224.1| PREDICTED: similar to aspartate aminotransferase [Tribolium castaneum] gi|270006661|gb|EFA03109.1| hypothetical protein TcasGA2_TC013019 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|25147133|ref|NP_741810.1| Protein GOT-2.2, isoform a [Caenorhabditis elegans] gi|351057935|emb|CCD64538.1| Protein GOT-2.2, isoform a [Caenorhabditis elegans] | Back alignment and taxonomy information |
|---|
| >gi|307178208|gb|EFN66993.1| Aspartate aminotransferase, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|268579721|ref|XP_002644843.1| Hypothetical protein CBG05011 [Caenorhabditis briggsae] | Back alignment and taxonomy information |
|---|
| >gi|383861654|ref|XP_003706300.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 142 | ||||||
| WB|WBGene00015778 | 414 | got-2.2 [Caenorhabditis elegan | 0.880 | 0.301 | 0.606 | 6.3e-37 | |
| FB|FBgn0001125 | 431 | Got2 "Glutamate oxaloacetate t | 0.887 | 0.292 | 0.563 | 6.5e-35 | |
| UNIPROTKB|Q5REB0 | 430 | GOT2 "Aspartate aminotransfera | 0.880 | 0.290 | 0.590 | 2.2e-34 | |
| UNIPROTKB|P12344 | 430 | GOT2 "Aspartate aminotransfera | 0.809 | 0.267 | 0.628 | 3.6e-34 | |
| MGI|MGI:95792 | 430 | Got2 "glutamate oxaloacetate t | 0.809 | 0.267 | 0.619 | 3.6e-34 | |
| RGD|2722 | 430 | Got2 "glutamic-oxaloacetic tra | 0.809 | 0.267 | 0.619 | 3.6e-34 | |
| UNIPROTKB|P08907 | 401 | GOT2 "Aspartate aminotransfera | 0.809 | 0.286 | 0.619 | 4.6e-34 | |
| UNIPROTKB|Q4R559 | 430 | GOT2 "Aspartate aminotransfera | 0.809 | 0.267 | 0.619 | 5.8e-34 | |
| UNIPROTKB|P00506 | 430 | GOT2 "Aspartate aminotransfera | 0.809 | 0.267 | 0.603 | 1.2e-33 | |
| UNIPROTKB|F1P180 | 401 | GOT2 "Aspartate aminotransfera | 0.809 | 0.286 | 0.595 | 1.5e-33 |
| WB|WBGene00015778 got-2.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 397 (144.8 bits), Expect = 6.3e-37, P = 6.3e-37
Identities = 80/132 (60%), Positives = 99/132 (75%)
Query: 3 KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
KN G++ GERVGAFS+V++D DEAAR+ SQ+KILIR YS+PP+HGARI IL
Sbjct: 263 KNMGLY------GERVGAFSVVTSDADEAARVASQVKILIRPLYSNPPVHGARIASRILA 316
Query: 63 DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
DP L QWL +VK MADRII+MR +LKD L KEGS + W HIT+QIGMFC+TG+N QV
Sbjct: 317 DPALNKQWLGDVKLMADRIITMRTTLKDLLAKEGSTRNWEHITNQIGMFCFTGINPQQVE 376
Query: 123 RKLIHDRSLKLS 134
KLI + S+ L+
Sbjct: 377 -KLIKEHSVYLT 387
|
|
| FB|FBgn0001125 Got2 "Glutamate oxaloacetate transaminase 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5REB0 GOT2 "Aspartate aminotransferase, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P12344 GOT2 "Aspartate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95792 Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2722 Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P08907 GOT2 "Aspartate aminotransferase, mitochondrial" [Equus caballus (taxid:9796)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4R559 GOT2 "Aspartate aminotransferase, mitochondrial" [Macaca fascicularis (taxid:9541)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00506 GOT2 "Aspartate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P180 GOT2 "Aspartate aminotransferase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| PLN02397 | 423 | PLN02397, PLN02397, aspartate transaminase | 2e-63 | |
| PTZ00376 | 404 | PTZ00376, PTZ00376, aspartate aminotransferase; Pr | 3e-55 | |
| PRK09257 | 396 | PRK09257, PRK09257, aromatic amino acid aminotrans | 3e-53 | |
| COG1448 | 396 | COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr | 4e-50 | |
| pfam00155 | 357 | pfam00155, Aminotran_1_2, Aminotransferase class I | 9e-22 | |
| cd00609 | 350 | cd00609, AAT_like, Aspartate aminotransferase fami | 1e-08 |
| >gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase | Back alignment and domain information |
|---|
Score = 199 bits (507), Expect = 2e-63
Identities = 71/121 (58%), Positives = 84/121 (69%), Gaps = 6/121 (4%)
Query: 3 KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
KN G++ GERVGA S+V D A R+ SQLK++ R YS+PPIHGA IV ILG
Sbjct: 269 KNMGLY------GERVGALSVVCKSADVAVRVKSQLKLIARPMYSNPPIHGASIVATILG 322
Query: 63 DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
DP+L S+W E+KGMADRIISMRQ L D L+ GS W+HIT QIGMF +TGLN QV
Sbjct: 323 DPELFSEWTKELKGMADRIISMRQKLYDALEARGSPGDWSHITKQIGMFSFTGLNKEQVD 382
Query: 123 R 123
R
Sbjct: 383 R 383
|
Length = 423 |
| >gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II | Back alignment and domain information |
|---|
| >gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| KOG1411|consensus | 427 | 100.0 | ||
| COG1448 | 396 | TyrB Aspartate/tyrosine/aromatic aminotransferase | 100.0 | |
| KOG1412|consensus | 410 | 100.0 | ||
| PLN02397 | 423 | aspartate transaminase | 99.87 | |
| PTZ00376 | 404 | aspartate aminotransferase; Provisional | 99.82 | |
| PRK09257 | 396 | aromatic amino acid aminotransferase; Provisional | 99.81 | |
| PRK08637 | 388 | hypothetical protein; Provisional | 99.22 | |
| PLN02607 | 447 | 1-aminocyclopropane-1-carboxylate synthase | 99.04 | |
| PF00155 | 363 | Aminotran_1_2: Aminotransferase class I and II 1-a | 99.03 | |
| TIGR01264 | 401 | tyr_amTase_E tyrosine aminotransferase, eukaryotic | 98.99 | |
| PRK06108 | 382 | aspartate aminotransferase; Provisional | 98.83 | |
| PRK08068 | 389 | transaminase; Reviewed | 98.81 | |
| PLN02450 | 468 | 1-aminocyclopropane-1-carboxylate synthase | 98.81 | |
| PRK05957 | 389 | aspartate aminotransferase; Provisional | 98.8 | |
| PRK08912 | 387 | hypothetical protein; Provisional | 98.73 | |
| COG0436 | 393 | Aspartate/tyrosine/aromatic aminotransferase [Amin | 98.73 | |
| PRK07550 | 386 | hypothetical protein; Provisional | 98.71 | |
| PRK07777 | 387 | aminotransferase; Validated | 98.69 | |
| PRK09082 | 386 | methionine aminotransferase; Validated | 98.68 | |
| PTZ00433 | 412 | tyrosine aminotransferase; Provisional | 98.67 | |
| PLN02231 | 534 | alanine transaminase | 98.66 | |
| PLN02376 | 496 | 1-aminocyclopropane-1-carboxylate synthase | 98.63 | |
| PRK09148 | 405 | aminotransferase; Validated | 98.62 | |
| PRK07682 | 378 | hypothetical protein; Validated | 98.61 | |
| TIGR03540 | 383 | DapC_direct LL-diaminopimelate aminotransferase. T | 98.58 | |
| PRK09276 | 385 | LL-diaminopimelate aminotransferase; Provisional | 98.57 | |
| PRK09105 | 370 | putative aminotransferase; Provisional | 98.57 | |
| PTZ00377 | 481 | alanine aminotransferase; Provisional | 98.56 | |
| PRK08636 | 403 | aspartate aminotransferase; Provisional | 98.55 | |
| PRK06348 | 384 | aspartate aminotransferase; Provisional | 98.55 | |
| PRK06836 | 394 | aspartate aminotransferase; Provisional | 98.54 | |
| PRK07681 | 399 | aspartate aminotransferase; Provisional | 98.53 | |
| PRK12414 | 384 | putative aminotransferase; Provisional | 98.52 | |
| PRK08960 | 387 | hypothetical protein; Provisional | 98.52 | |
| PLN02368 | 407 | alanine transaminase | 98.51 | |
| PRK07865 | 364 | N-succinyldiaminopimelate aminotransferase; Review | 98.51 | |
| PRK07683 | 387 | aminotransferase A; Validated | 98.48 | |
| PRK08175 | 395 | aminotransferase; Validated | 98.48 | |
| PRK07337 | 388 | aminotransferase; Validated | 98.48 | |
| PLN00175 | 413 | aminotransferase family protein; Provisional | 98.47 | |
| TIGR01140 | 330 | L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy | 98.46 | |
| TIGR01265 | 403 | tyr_nico_aTase tyrosine/nicotianamine aminotransfe | 98.46 | |
| PRK05764 | 393 | aspartate aminotransferase; Provisional | 98.46 | |
| PRK07568 | 397 | aspartate aminotransferase; Provisional | 98.43 | |
| PRK08361 | 391 | aspartate aminotransferase; Provisional | 98.43 | |
| TIGR03542 | 402 | DAPAT_plant LL-diaminopimelate aminotransferase. T | 98.43 | |
| PRK07590 | 409 | L,L-diaminopimelate aminotransferase; Validated | 98.41 | |
| PRK07366 | 388 | succinyldiaminopimelate transaminase; Validated | 98.4 | |
| cd00609 | 350 | AAT_like Aspartate aminotransferase family. This f | 98.4 | |
| PRK08363 | 398 | alanine aminotransferase; Validated | 98.4 | |
| TIGR03539 | 357 | DapC_actino succinyldiaminopimelate transaminase. | 98.38 | |
| PRK05942 | 394 | aspartate aminotransferase; Provisional | 98.37 | |
| PRK06290 | 410 | aspartate aminotransferase; Provisional | 98.36 | |
| PRK07324 | 373 | transaminase; Validated | 98.35 | |
| PRK07309 | 391 | aromatic amino acid aminotransferase; Validated | 98.33 | |
| PRK06855 | 433 | aminotransferase; Validated | 98.33 | |
| PRK06107 | 402 | aspartate aminotransferase; Provisional | 98.31 | |
| PRK08056 | 356 | threonine-phosphate decarboxylase; Provisional | 98.3 | |
| PRK09265 | 404 | aminotransferase AlaT; Validated | 98.27 | |
| PRK15481 | 431 | transcriptional regulatory protein PtsJ; Provision | 98.24 | |
| PLN00145 | 430 | tyrosine/nicotianamine aminotransferase; Provision | 98.22 | |
| PLN02656 | 409 | tyrosine transaminase | 98.2 | |
| TIGR03537 | 350 | DapC succinyldiaminopimelate transaminase. Note: t | 98.2 | |
| PRK09440 | 416 | avtA valine--pyruvate transaminase; Provisional | 98.2 | |
| PRK13355 | 517 | bifunctional HTH-domain containing protein/aminotr | 98.19 | |
| PRK03158 | 359 | histidinol-phosphate aminotransferase; Provisional | 98.18 | |
| PLN00143 | 409 | tyrosine/nicotianamine aminotransferase; Provision | 98.15 | |
| TIGR03538 | 393 | DapC_gpp succinyldiaminopimelate transaminase. Thi | 98.15 | |
| PRK06207 | 405 | aspartate aminotransferase; Provisional | 98.14 | |
| PRK05387 | 353 | histidinol-phosphate aminotransferase; Provisional | 98.13 | |
| PRK07392 | 360 | threonine-phosphate decarboxylase; Validated | 98.12 | |
| PLN03026 | 380 | histidinol-phosphate aminotransferase; Provisional | 98.07 | |
| PRK03317 | 368 | histidinol-phosphate aminotransferase; Provisional | 98.06 | |
| TIGR01141 | 346 | hisC histidinol-phosphate aminotransferase. Histid | 98.03 | |
| PRK02731 | 367 | histidinol-phosphate aminotransferase; Validated | 98.02 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 98.0 | |
| PRK08153 | 369 | histidinol-phosphate aminotransferase; Provisional | 97.99 | |
| PRK05166 | 371 | histidinol-phosphate aminotransferase; Provisional | 97.98 | |
| PRK06358 | 354 | threonine-phosphate decarboxylase; Provisional | 97.97 | |
| PRK09147 | 396 | succinyldiaminopimelate transaminase; Provisional | 97.97 | |
| PRK06959 | 339 | putative threonine-phosphate decarboxylase; Provis | 97.96 | |
| PRK03967 | 337 | histidinol-phosphate aminotransferase; Provisional | 97.95 | |
| PRK07908 | 349 | hypothetical protein; Provisional | 97.94 | |
| PRK04781 | 364 | histidinol-phosphate aminotransferase; Provisional | 97.89 | |
| PLN02187 | 462 | rooty/superroot1 | 97.89 | |
| PRK14808 | 335 | histidinol-phosphate aminotransferase; Provisional | 97.88 | |
| PRK03321 | 352 | putative aminotransferase; Provisional | 97.82 | |
| PRK04870 | 356 | histidinol-phosphate aminotransferase; Provisional | 97.82 | |
| PRK05664 | 330 | threonine-phosphate decarboxylase; Reviewed | 97.8 | |
| PRK14809 | 357 | histidinol-phosphate aminotransferase; Provisional | 97.8 | |
| PRK14807 | 351 | histidinol-phosphate aminotransferase; Provisional | 97.79 | |
| PRK01688 | 351 | histidinol-phosphate aminotransferase; Provisional | 97.79 | |
| PRK05839 | 374 | hypothetical protein; Provisional | 97.78 | |
| PRK09275 | 527 | aspartate aminotransferase; Provisional | 97.76 | |
| PRK02610 | 374 | histidinol-phosphate aminotransferase; Provisional | 97.73 | |
| PRK04635 | 354 | histidinol-phosphate aminotransferase; Provisional | 97.73 | |
| KOG0256|consensus | 471 | 97.73 | ||
| PRK06425 | 332 | histidinol-phosphate aminotransferase; Validated | 97.72 | |
| TIGR03801 | 521 | asp_4_decarbox aspartate 4-decarboxylase. This enz | 97.69 | |
| PRK00950 | 361 | histidinol-phosphate aminotransferase; Validated | 97.69 | |
| PRK01533 | 366 | histidinol-phosphate aminotransferase; Validated | 97.61 | |
| PRK06225 | 380 | aspartate aminotransferase; Provisional | 97.4 | |
| PRK08354 | 311 | putative aminotransferase; Provisional | 97.16 | |
| COG0079 | 356 | HisC Histidinol-phosphate/aromatic aminotransferas | 97.0 | |
| COG1167 | 459 | ARO8 Transcriptional regulators containing a DNA-b | 96.53 | |
| PRK10534 | 333 | L-threonine aldolase; Provisional | 96.38 | |
| TIGR00707 | 379 | argD acetylornithine and succinylornithine aminotr | 96.1 | |
| PRK13392 | 410 | 5-aminolevulinate synthase; Provisional | 95.99 | |
| PRK09064 | 407 | 5-aminolevulinate synthase; Validated | 95.97 | |
| PRK04073 | 396 | rocD ornithine--oxo-acid transaminase; Provisional | 95.93 | |
| cd00617 | 431 | Tnase_like Tryptophanase family (Tnase). This fami | 95.86 | |
| cd00378 | 402 | SHMT Serine-glycine hydroxymethyltransferase (SHMT | 95.67 | |
| PRK05093 | 403 | argD bifunctional N-succinyldiaminopimelate-aminot | 95.66 | |
| KOG0634|consensus | 472 | 95.43 | ||
| cd06454 | 349 | KBL_like KBL_like; this family belongs to the pyri | 95.35 | |
| TIGR00858 | 360 | bioF 8-amino-7-oxononanoate synthase. This model r | 95.22 | |
| TIGR01821 | 402 | 5aminolev_synth 5-aminolevulinic acid synthase. Th | 95.16 | |
| PRK04260 | 375 | acetylornithine aminotransferase; Provisional | 95.13 | |
| PRK13238 | 460 | tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d | 95.03 | |
| cd00610 | 413 | OAT_like Acetyl ornithine aminotransferase family. | 94.65 | |
| TIGR03576 | 346 | pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 | 94.59 | |
| COG1168 | 388 | MalY Bifunctional PLP-dependent enzyme with beta-c | 94.35 | |
| cd06502 | 338 | TA_like Low-specificity threonine aldolase (TA). T | 93.92 | |
| PRK05958 | 385 | 8-amino-7-oxononanoate synthase; Reviewed | 93.72 | |
| PLN02822 | 481 | serine palmitoyltransferase | 93.6 | |
| PRK00011 | 416 | glyA serine hydroxymethyltransferase; Reviewed | 93.5 | |
| PRK13393 | 406 | 5-aminolevulinate synthase; Provisional | 93.39 | |
| PRK02627 | 396 | acetylornithine aminotransferase; Provisional | 93.26 | |
| PRK02936 | 377 | argD acetylornithine aminotransferase; Provisional | 93.06 | |
| PLN02483 | 489 | serine palmitoyltransferase | 92.98 | |
| PRK06939 | 397 | 2-amino-3-ketobutyrate coenzyme A ligase; Provisio | 92.91 | |
| TIGR01825 | 385 | gly_Cac_T_rel pyridoxal phosphate-dependent acyltr | 92.87 | |
| TIGR03301 | 355 | PhnW-AepZ 2-aminoethylphosphonate aminotransferase | 92.28 | |
| TIGR01979 | 403 | sufS cysteine desulfurases, SufS subfamily. This m | 91.91 | |
| PTZ00125 | 400 | ornithine aminotransferase-like protein; Provision | 91.79 | |
| TIGR01822 | 393 | 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig | 91.16 | |
| PRK03244 | 398 | argD acetylornithine aminotransferase; Provisional | 91.02 | |
| PRK02948 | 381 | cysteine desulfurase; Provisional | 90.78 | |
| KOG0633|consensus | 375 | 90.61 | ||
| COG3977 | 417 | Alanine-alpha-ketoisovalerate (or valine-pyruvate) | 90.16 | |
| PRK12381 | 406 | bifunctional succinylornithine transaminase/acetyl | 89.71 | |
| PLN02721 | 353 | threonine aldolase | 89.6 | |
| KOG0257|consensus | 420 | 89.19 | ||
| TIGR03392 | 398 | FeS_syn_CsdA cysteine desulfurase, catalytic subun | 88.19 | |
| PRK01278 | 389 | argD acetylornithine transaminase protein; Provisi | 88.17 | |
| PRK00451 | 447 | glycine dehydrogenase subunit 1; Validated | 87.42 | |
| TIGR03812 | 373 | tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe | 86.84 | |
| cd06451 | 356 | AGAT_like Alanine-glyoxylate aminotransferase (AGA | 86.6 | |
| TIGR00713 | 423 | hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi | 86.58 | |
| TIGR01976 | 397 | am_tr_V_VC1184 cysteine desulfurase family protein | 86.43 | |
| PRK04612 | 408 | argD acetylornithine transaminase protein; Provisi | 86.01 | |
| PLN02242 | 418 | methionine gamma-lyase | 85.98 | |
| TIGR01365 | 374 | serC_2 phosphoserine aminotransferase, Methanosarc | 85.67 | |
| TIGR01885 | 401 | Orn_aminotrans ornithine aminotransferase. This mo | 84.55 | |
| PRK07179 | 407 | hypothetical protein; Provisional | 83.63 | |
| TIGR01366 | 361 | serC_3 phosphoserine aminotransferase, putative. T | 83.56 | |
| TIGR01977 | 376 | am_tr_V_EF2568 cysteine desulfurase family protein | 83.29 | |
| TIGR02539 | 370 | SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation | 83.03 | |
| TIGR02407 | 412 | ectoine_ectB diaminobutyrate--2-oxoglutarate amino | 82.94 | |
| PRK06777 | 421 | 4-aminobutyrate aminotransferase; Provisional | 81.62 | |
| PLN00144 | 382 | acetylornithine transaminase | 81.62 | |
| PRK13580 | 493 | serine hydroxymethyltransferase; Provisional | 80.95 | |
| PRK08088 | 425 | 4-aminobutyrate aminotransferase; Validated | 80.62 | |
| PRK00062 | 426 | glutamate-1-semialdehyde aminotransferase; Provisi | 80.04 |
| >KOG1411|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.9e-53 Score=358.53 Aligned_cols=135 Identities=61% Similarity=0.952 Sum_probs=133.2
Q ss_pred CCcccccccCCCCcccccceeEEEeCCHHHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHHHHH
Q psy16706 1 QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADR 80 (142)
Q Consensus 1 ~SKnfgL~~~~~~YgeRvGal~vv~~~~~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m~~r 80 (142)
|+||||| |||||||++|||+|++++.+|+||++.++|++|||||.|||+||++||+||+|+++|..|++.|.+|
T Consensus 271 yAKNMGL------YgERvGa~svvc~~ad~A~rV~SQlk~liRpmYSnPP~hGArIv~~Il~d~~l~~~W~~evk~MadR 344 (427)
T KOG1411|consen 271 YAKNMGL------YGERVGALSVVCKDADEAKRVESQLKILIRPMYSNPPLHGARIVATILSDPDLKNQWLGEVKGMADR 344 (427)
T ss_pred hhhhcch------hhhccceeEEEecCHHHHHHHHHHHHHHhcccccCCCccchhhhhhccCChHHHHHHHHHHHHHHHh
Confidence 6899999 9999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccCC
Q psy16706 81 IISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE 142 (142)
Q Consensus 81 i~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~~ 142 (142)
|+.||+.|++.|++.+++++|+||++|.||||||||+|+||+. |+++|||||+.|||||+.
T Consensus 345 i~~mR~~L~d~L~~~gs~~~W~hI~~QIGMF~fTgl~peQv~~-l~ke~~iYmT~dGRiS~a 405 (427)
T KOG1411|consen 345 IISMRQQLFDALEKEGSPGNWSHITKQIGMFCFTGLNPEQVDW-LTKEYHIYLTKDGRISMA 405 (427)
T ss_pred hhhhHHHHhHHhhcCCCCccHHHHHHhhheeeecCCCHHHHHH-HHhhheeeeccCceEeec
Confidence 9999999999999999999999999999999999999999999 999999999999999973
|
|
| >COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1412|consensus | Back alignment and domain information |
|---|
| >PLN02397 aspartate transaminase | Back alignment and domain information |
|---|
| >PTZ00376 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09257 aromatic amino acid aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08637 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02607 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue | Back alignment and domain information |
|---|
| >TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic | Back alignment and domain information |
|---|
| >PRK06108 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08068 transaminase; Reviewed | Back alignment and domain information |
|---|
| >PLN02450 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK05957 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08912 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07550 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07777 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK09082 methionine aminotransferase; Validated | Back alignment and domain information |
|---|
| >PTZ00433 tyrosine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02231 alanine transaminase | Back alignment and domain information |
|---|
| >PLN02376 1-aminocyclopropane-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PRK09148 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07682 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03540 DapC_direct LL-diaminopimelate aminotransferase | Back alignment and domain information |
|---|
| >PRK09276 LL-diaminopimelate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09105 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00377 alanine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08636 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06348 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06836 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07681 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK12414 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08960 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02368 alanine transaminase | Back alignment and domain information |
|---|
| >PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07683 aminotransferase A; Validated | Back alignment and domain information |
|---|
| >PRK08175 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07337 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN00175 aminotransferase family protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase | Back alignment and domain information |
|---|
| >TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases | Back alignment and domain information |
|---|
| >PRK05764 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07568 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08361 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase | Back alignment and domain information |
|---|
| >PRK07590 L,L-diaminopimelate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK07366 succinyldiaminopimelate transaminase; Validated | Back alignment and domain information |
|---|
| >cd00609 AAT_like Aspartate aminotransferase family | Back alignment and domain information |
|---|
| >PRK08363 alanine aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03539 DapC_actino succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK05942 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06290 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07324 transaminase; Validated | Back alignment and domain information |
|---|
| >PRK07309 aromatic amino acid aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06855 aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06107 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08056 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09265 aminotransferase AlaT; Validated | Back alignment and domain information |
|---|
| >PRK15481 transcriptional regulatory protein PtsJ; Provisional | Back alignment and domain information |
|---|
| >PLN00145 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02656 tyrosine transaminase | Back alignment and domain information |
|---|
| >TIGR03537 DapC succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK09440 avtA valine--pyruvate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03158 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00143 tyrosine/nicotianamine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03538 DapC_gpp succinyldiaminopimelate transaminase | Back alignment and domain information |
|---|
| >PRK06207 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05387 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07392 threonine-phosphate decarboxylase; Validated | Back alignment and domain information |
|---|
| >PLN03026 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03317 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01141 hisC histidinol-phosphate aminotransferase | Back alignment and domain information |
|---|
| >PRK02731 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PRK08153 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05166 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06358 threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09147 succinyldiaminopimelate transaminase; Provisional | Back alignment and domain information |
|---|
| >PRK06959 putative threonine-phosphate decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK03967 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07908 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04781 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02187 rooty/superroot1 | Back alignment and domain information |
|---|
| >PRK14808 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03321 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04870 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05664 threonine-phosphate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK14809 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14807 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01688 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09275 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02610 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04635 histidinol-phosphate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >KOG0256|consensus | Back alignment and domain information |
|---|
| >PRK06425 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >TIGR03801 asp_4_decarbox aspartate 4-decarboxylase | Back alignment and domain information |
|---|
| >PRK00950 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK01533 histidinol-phosphate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK06225 aspartate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08354 putative aminotransferase; Provisional | Back alignment and domain information |
|---|
| >COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10534 L-threonine aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00707 argD acetylornithine and succinylornithine aminotransferases | Back alignment and domain information |
|---|
| >PRK13392 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK09064 5-aminolevulinate synthase; Validated | Back alignment and domain information |
|---|
| >PRK04073 rocD ornithine--oxo-acid transaminase; Provisional | Back alignment and domain information |
|---|
| >cd00617 Tnase_like Tryptophanase family (Tnase) | Back alignment and domain information |
|---|
| >cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) | Back alignment and domain information |
|---|
| >PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0634|consensus | Back alignment and domain information |
|---|
| >cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) | Back alignment and domain information |
|---|
| >TIGR00858 bioF 8-amino-7-oxononanoate synthase | Back alignment and domain information |
|---|
| >TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase | Back alignment and domain information |
|---|
| >PRK04260 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional | Back alignment and domain information |
|---|
| >cd00610 OAT_like Acetyl ornithine aminotransferase family | Back alignment and domain information |
|---|
| >TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family | Back alignment and domain information |
|---|
| >COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06502 TA_like Low-specificity threonine aldolase (TA) | Back alignment and domain information |
|---|
| >PRK05958 8-amino-7-oxononanoate synthase; Reviewed | Back alignment and domain information |
|---|
| >PLN02822 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK00011 glyA serine hydroxymethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13393 5-aminolevulinate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK02627 acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02936 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02483 serine palmitoyltransferase | Back alignment and domain information |
|---|
| >PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional | Back alignment and domain information |
|---|
| >TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative | Back alignment and domain information |
|---|
| >TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase | Back alignment and domain information |
|---|
| >TIGR01979 sufS cysteine desulfurases, SufS subfamily | Back alignment and domain information |
|---|
| >PTZ00125 ornithine aminotransferase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase | Back alignment and domain information |
|---|
| >PRK03244 argD acetylornithine aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK02948 cysteine desulfurase; Provisional | Back alignment and domain information |
|---|
| >KOG0633|consensus | Back alignment and domain information |
|---|
| >COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02721 threonine aldolase | Back alignment and domain information |
|---|
| >KOG0257|consensus | Back alignment and domain information |
|---|
| >TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA | Back alignment and domain information |
|---|
| >PRK01278 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PRK00451 glycine dehydrogenase subunit 1; Validated | Back alignment and domain information |
|---|
| >TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA | Back alignment and domain information |
|---|
| >cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family | Back alignment and domain information |
|---|
| >TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase | Back alignment and domain information |
|---|
| >TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily | Back alignment and domain information |
|---|
| >PRK04612 argD acetylornithine transaminase protein; Provisional | Back alignment and domain information |
|---|
| >PLN02242 methionine gamma-lyase | Back alignment and domain information |
|---|
| >TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type | Back alignment and domain information |
|---|
| >TIGR01885 Orn_aminotrans ornithine aminotransferase | Back alignment and domain information |
|---|
| >PRK07179 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01366 serC_3 phosphoserine aminotransferase, putative | Back alignment and domain information |
|---|
| >TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein | Back alignment and domain information |
|---|
| >TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase | Back alignment and domain information |
|---|
| >TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase | Back alignment and domain information |
|---|
| >PRK06777 4-aminobutyrate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00144 acetylornithine transaminase | Back alignment and domain information |
|---|
| >PRK13580 serine hydroxymethyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08088 4-aminobutyrate aminotransferase; Validated | Back alignment and domain information |
|---|
| >PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 142 | ||||
| 3pd6_A | 401 | Crystal Structure Of Mouse Mitochondrial Aspartate | 2e-38 | ||
| 3hlm_A | 401 | Crystal Structure Of Mouse Mitochondrial Aspartate | 4e-38 | ||
| 7aat_A | 401 | X-Ray Structure Refinement And Comparison Of Three | 2e-37 | ||
| 1aka_A | 401 | Structural Basis For The Catalytic Activity Of Aspa | 4e-37 | ||
| 1aat_A | 411 | Oxoglutarate-Induced Conformational Changes In Cyto | 9e-28 | ||
| 2cst_A | 411 | Crystal Structure Of The Closed Form Of Chicken Cyt | 1e-27 | ||
| 1ajs_A | 412 | Refinement And Comparison Of The Crystal Structures | 1e-27 | ||
| 1ajr_A | 412 | Refinement And Comparison Of The Crystal Structures | 5e-27 | ||
| 4f4e_A | 420 | Crystal Structure Of Aromatic-Amino-Acid Aminotrans | 3e-26 | ||
| 4eff_A | 420 | Crystal Structure Of Aromatic-Amino-Acid Aminotrans | 3e-26 | ||
| 3ii0_A | 422 | Crystal Structure Of Human Glutamate Oxaloacetate T | 1e-25 | ||
| 3tat_A | 397 | Tyrosine Aminotransferase From E. Coli Length = 397 | 8e-24 | ||
| 3fsl_A | 397 | Crystal Structure Of Tyrosine Aminotransferase Trip | 1e-23 | ||
| 4eu1_A | 409 | Structure Of A Mitochondrial Aspartate Aminotransfe | 5e-23 | ||
| 1ahy_A | 396 | Aspartate Aminotransferase Hexamutant Length = 396 | 2e-22 | ||
| 1ari_A | 396 | Aspartate Aminotransferase, W140h Mutant, Maleate C | 5e-22 | ||
| 1ix6_A | 396 | Aspartate Aminotransferase Active Site Mutant V39f | 5e-22 | ||
| 1ix8_A | 396 | Aspartate Aminotransferase Active Site Mutant V39fN | 5e-22 | ||
| 1b4x_A | 396 | Aspartate Aminotransferase From E. Coli, C191s Muta | 5e-22 | ||
| 1g7w_A | 396 | Aspartate Aminotransferase Active Site Mutant N194a | 5e-22 | ||
| 1asb_A | 396 | The Structural Basis For The Reduced Activity Of Th | 6e-22 | ||
| 1asf_A | 396 | The Structural Basis For The Reduced Activity Of Th | 6e-22 | ||
| 3aat_A | 396 | Activity And Structure Of The Active-Site Mutants R | 6e-22 | ||
| 1g4v_A | 396 | Aspartate Aminotransferase Active Site Mutant N194a | 6e-22 | ||
| 1asl_A | 396 | Crystal Structures Of Escherichia Coli Aspartate Am | 6e-22 | ||
| 1qis_A | 396 | Aspartate Aminotransferase From Escherichia Coli, C | 6e-22 | ||
| 1qir_A | 396 | Aspartate Aminotransferase From Escherichia Coli, C | 6e-22 | ||
| 1arh_A | 396 | Aspartate Aminotransferase, Y225rR386A MUTANT Lengt | 6e-22 | ||
| 1qit_A | 396 | Aspartate Aminotransferase From Escherichia Coli, C | 6e-22 | ||
| 2d61_A | 396 | Aspartate Aminotransferase Mutant Ma With Maleic Ac | 7e-22 | ||
| 2d66_A | 396 | Aspartate Aminotransferase Mutant Mab Length = 396 | 7e-22 | ||
| 4f5i_A | 406 | Substrate Specificity Conversion Of E. Coli Pyridox | 1e-21 | ||
| 1bqd_A | 396 | Aspartate Aminotransferase P138aP195A DOUBLE MUTANT | 2e-21 | ||
| 1bqa_A | 396 | Aspartate Aminotransferase P195a Mutant Length = 39 | 2e-21 | ||
| 2q7w_A | 396 | Structural Studies Reveals The Inactivation Of E. C | 2e-21 | ||
| 2aat_A | 396 | 2.8-Angstroms-Resolution Crystal Structure Of An Ac | 2e-21 | ||
| 4f5m_A | 406 | Wild-type E. Coli Aspartate Aminotransferase: A Tem | 2e-21 | ||
| 4f5j_A | 406 | Rational Design And Directed Evolution For Conversi | 2e-21 | ||
| 1aia_A | 396 | Structural Basis For The Catalytic Activity Of Aspa | 2e-21 | ||
| 4f5f_A | 406 | Structure Of Aspartate Aminotransferase Conversion | 2e-21 | ||
| 4f5h_A | 406 | Intercoversion Of Substrate Specificity: E. Coli As | 2e-21 | ||
| 3zzj_A | 396 | Structure Of An Engineered Aspartate Aminotransfera | 4e-21 | ||
| 1aam_A | 396 | The Structural Basis For The Altered Substrate Spec | 4e-21 | ||
| 1toe_A | 396 | Unliganded Structure Of Hexamutant + A293d Mutant O | 4e-21 | ||
| 1yoo_A | 396 | Aspartate Aminotransferase Mutant Atb17 With Isoval | 4e-21 | ||
| 1g7x_A | 396 | Aspartate Aminotransferase Active Site Mutant N194a | 4e-21 | ||
| 1toj_A | 396 | Hydrocinnamic Acid-Bound Structure Of Srhept Mutant | 4e-21 | ||
| 1czc_A | 396 | Aspartate Aminotransferase Mutant Atb17139S142N WIT | 4e-21 | ||
| 1g4x_A | 396 | Aspartate Aminotransferase Active Site Mutant N194a | 4e-21 | ||
| 2d5y_A | 396 | Aspartate Aminotransferase Mutant Mc With Isovaleri | 7e-21 | ||
| 4f5g_A | 406 | Rational Design And Directed Evolution Of E. Coli A | 8e-21 | ||
| 2d64_A | 396 | Aspartate Aminotransferase Mutant Mabc With Isovale | 8e-21 | ||
| 4f5k_A | 406 | Substrate Specificity Conversion Of Aspartate Amino | 1e-20 | ||
| 1tog_A | 396 | Hydrocinnamic Acid-Bound Structure Of Srhept + A293 | 2e-20 | ||
| 1yaa_A | 412 | Aspartate Aminotransferase From Saccharomyces Cerev | 6e-20 | ||
| 4h51_A | 420 | Crystal Structure Of A Putative Aspartate Aminotran | 1e-18 | ||
| 3uak_A | 406 | Crystal Structure Of De Novo Designed Cysteine Este | 7e-16 | ||
| 3meb_A | 448 | Structure Of Cytoplasmic Aspartate Aminotransferase | 6e-14 | ||
| 1ay4_A | 394 | Aromatic Amino Acid Aminotransferase Without Substr | 2e-12 | ||
| 3k7y_A | 405 | Aspartate Aminotransferase Of Plasmodium Falciparum | 7e-10 |
| >pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 | Back alignment and structure |
|
| >pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 | Back alignment and structure |
| >pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 | Back alignment and structure |
| >pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 | Back alignment and structure |
| >pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 | Back alignment and structure |
| >pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 | Back alignment and structure |
| >pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 | Back alignment and structure |
| >pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 | Back alignment and structure |
| >pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 | Back alignment and structure |
| >pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 | Back alignment and structure |
| >pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 | Back alignment and structure |
| >pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 | Back alignment and structure |
| >pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 | Back alignment and structure |
| >pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 | Back alignment and structure |
| >pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 | Back alignment and structure |
| >pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 | Back alignment and structure |
| >pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 | Back alignment and structure |
| >pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 | Back alignment and structure |
| >pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 | Back alignment and structure |
| >pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 | Back alignment and structure |
| >pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 | Back alignment and structure |
| >pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 | Back alignment and structure |
| >pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 | Back alignment and structure |
| >pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 | Back alignment and structure |
| >pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 | Back alignment and structure |
| >pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 | Back alignment and structure |
| >pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 | Back alignment and structure |
| >pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 | Back alignment and structure |
| >pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 | Back alignment and structure |
| >pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 | Back alignment and structure |
| >pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 | Back alignment and structure |
| >pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 | Back alignment and structure |
| >pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 | Back alignment and structure |
| >pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 | Back alignment and structure |
| >pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 | Back alignment and structure |
| >pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 | Back alignment and structure |
| >pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 | Back alignment and structure |
| >pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 | Back alignment and structure |
| >pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 | Back alignment and structure |
| >pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 | Back alignment and structure |
| >pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 | Back alignment and structure |
| >pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 | Back alignment and structure |
| >pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 | Back alignment and structure |
| >pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 | Back alignment and structure |
| >pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 | Back alignment and structure |
| >pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 | Back alignment and structure |
| >pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 | Back alignment and structure |
| >pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 | Back alignment and structure |
| >pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 | Back alignment and structure |
| >pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 | Back alignment and structure |
| >pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 | Back alignment and structure |
| >pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 | Back alignment and structure |
| >pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 | Back alignment and structure |
| >pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 142 | |||
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 5e-64 | |
| 7aat_A | 401 | Aspartate aminotransferase; transferase(aminotrans | 8e-64 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 9e-64 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 9e-64 | |
| 4eu1_A | 409 | Mitochondrial aspartate aminotransferase; ssgcid, | 1e-63 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 3e-63 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 6e-63 | |
| 3k7y_A | 405 | Aspartate aminotransferase; aminotrans pyridoxal p | 1e-61 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 6e-61 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 2e-57 | |
| 3meb_A | 448 | Aspartate aminotransferase; pyridoxal PHOS transfe | 2e-57 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 3e-54 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 3e-40 |
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 | Back alignment and structure |
|---|
Score = 199 bits (508), Expect = 5e-64
Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 6/121 (4%)
Query: 3 KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
KN+GI+ ER G + AD + L R YS PP HGA+IV +L
Sbjct: 243 KNFGIY------RERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLT 296
Query: 63 DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
P+L++ W+ E++ + ++ +R+ L L+ + + + + GMF G QV+
Sbjct: 297 TPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVK 356
Query: 123 R 123
R
Sbjct: 357 R 357
|
| >7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 | Back alignment and structure |
|---|
| >4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 | Back alignment and structure |
|---|
| >3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 | Back alignment and structure |
|---|
| >3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| 4h51_A | 420 | Aspartate aminotransferase; ssgcid, structural gen | 100.0 | |
| 3k7y_A | 405 | Aspartate aminotransferase; aminotrans pyridoxal p | 99.92 | |
| 3meb_A | 448 | Aspartate aminotransferase; pyridoxal PHOS transfe | 99.89 | |
| 4f4e_A | 420 | Aromatic-amino-acid aminotransferase; ssgcid, stru | 99.84 | |
| 7aat_A | 401 | Aspartate aminotransferase; transferase(aminotrans | 99.82 | |
| 4eu1_A | 409 | Mitochondrial aspartate aminotransferase; ssgcid, | 99.81 | |
| 3fsl_A | 397 | Aromatic-amino-acid aminotransferase; tyrosine ami | 99.75 | |
| 1yaa_A | 412 | Aspartate aminotransferase; HET: PLP; 2.05A {Sacch | 99.63 | |
| 2ay1_A | 394 | Aroat, aromatic amino acid aminotransferase; HET: | 99.62 | |
| 3rq1_A | 418 | Aminotransferase class I and II; structural genomi | 99.61 | |
| 1ajs_A | 412 | Aspartate aminotransferase; PIG, in the presence o | 99.61 | |
| 2q7w_A | 396 | Aspartate aminotransferase; mechanism-based inhibi | 99.6 | |
| 3t18_A | 413 | Aminotransferase class I and II; PSI-biology, MCSG | 99.52 | |
| 3tcm_A | 500 | Alanine aminotransferase 2; pyridoxal phosphate (P | 99.39 | |
| 3dyd_A | 427 | Tyrosine aminotransferase; PLP, SGC, structural ge | 99.3 | |
| 2x5f_A | 430 | Aspartate_tyrosine_phenylalanine pyridoxal-5' phos | 99.25 | |
| 3ihj_A | 498 | Alanine aminotransferase 2; helix, structural geno | 99.19 | |
| 3qgu_A | 449 | LL-diaminopimelate aminotransferase; L-lysine, pyr | 98.97 | |
| 3ei9_A | 432 | LL-diaminopimelate aminotransferase; lysine biosyn | 98.83 | |
| 3nra_A | 407 | Aspartate aminotransferase; structural genomics, j | 98.82 | |
| 3piu_A | 435 | 1-aminocyclopropane-1-carboxylate synthase; fruit | 98.78 | |
| 1iay_A | 428 | ACC synthase 2, 1-aminocyclopropane-1-carboxylate | 98.72 | |
| 3f6t_A | 533 | Aspartate aminotransferase; YP_194538.1, STRU geno | 98.72 | |
| 1b5p_A | 385 | Protein (aspartate aminotransferase); pyridoxal en | 98.71 | |
| 3bwn_A | 391 | AT1G70560, L-tryptophan aminotransferase; auxin sy | 98.67 | |
| 3e2y_A | 410 | Kynurenine-oxoglutarate transaminase 3; alpha beta | 98.66 | |
| 3fvs_A | 422 | Kynurenine--oxoglutarate transaminase 1; alpha bet | 98.59 | |
| 3g7q_A | 417 | Valine-pyruvate aminotransferase; NP_462565.1, str | 98.55 | |
| 3get_A | 365 | Histidinol-phosphate aminotransferase; NP_281508.1 | 98.54 | |
| 3h14_A | 391 | Aminotransferase, classes I and II; YP_167802.1, S | 98.51 | |
| 3jtx_A | 396 | Aminotransferase; NP_283882.1, structural genomics | 98.5 | |
| 1o4s_A | 389 | Aspartate aminotransferase; TM1255, structural gen | 98.5 | |
| 2x5d_A | 412 | Probable aminotransferase; HET: LLP PLP; 2.25A {Ps | 98.48 | |
| 3kax_A | 383 | Aminotransferase, classes I and II; PLP, C-S lyase | 98.47 | |
| 3d6k_A | 422 | Putative aminotransferase; APC82464, corynebacteri | 98.46 | |
| 3p1t_A | 337 | Putative histidinol-phosphate aminotransferase; PL | 98.45 | |
| 3ele_A | 398 | Amino transferase; RER070207001803, structural gen | 98.44 | |
| 1gd9_A | 389 | Aspartate aminotransferase; pyridoxal enzyme, temp | 98.42 | |
| 1xi9_A | 406 | Putative transaminase; alanine aminotransferase, s | 98.41 | |
| 1fg7_A | 356 | Histidinol phosphate aminotransferase; HISC, histi | 98.41 | |
| 3ppl_A | 427 | Aspartate aminotransferase; dimer, PLP-dependent t | 98.41 | |
| 2o1b_A | 404 | Aminotransferase, class I; aminotrasferase; HET: P | 98.4 | |
| 1j32_A | 388 | Aspartate aminotransferase; HET: PLP; 2.10A {Phorm | 98.39 | |
| 4dq6_A | 391 | Putative pyridoxal phosphate-dependent transferas; | 98.38 | |
| 3g0t_A | 437 | Putative aminotransferase; NP_905498.1, putative a | 98.37 | |
| 3ly1_A | 354 | Putative histidinol-phosphate aminotransferase; st | 98.37 | |
| 3dzz_A | 391 | Putative pyridoxal 5'-phosphate-dependent C-S LYA; | 98.35 | |
| 1c7n_A | 399 | Cystalysin; transferase, aminotransferase, pyridox | 98.33 | |
| 2z61_A | 370 | Probable aspartate aminotransferase 2; amino acid | 98.33 | |
| 3ez1_A | 423 | Aminotransferase MOCR family; YP_604413.1, struct | 98.33 | |
| 2hox_A | 427 | ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA | 98.31 | |
| 3ffh_A | 363 | Histidinol-phosphate aminotransferase; APC88260, l | 98.3 | |
| 3hdo_A | 360 | Histidinol-phosphate aminotransferase; PSI-II, his | 98.29 | |
| 2gb3_A | 409 | Aspartate aminotransferase; TM1698, structural gen | 98.28 | |
| 1uu1_A | 335 | Histidinol-phosphate aminotransferase; histidine b | 98.28 | |
| 3ezs_A | 376 | Aminotransferase ASPB; NP_207418.1, structural gen | 98.28 | |
| 3b46_A | 447 | Aminotransferase BNA3; kynurenine aminotransferase | 98.27 | |
| 3fdb_A | 377 | Beta C-S lyase, putative PLP-dependent beta-cystat | 98.26 | |
| 2o0r_A | 411 | RV0858C (N-succinyldiaminopimelate aminotransfera; | 98.26 | |
| 1u08_A | 386 | Hypothetical aminotransferase YBDL; alpha beta pro | 98.26 | |
| 2dou_A | 376 | Probable N-succinyldiaminopimelate aminotransfera; | 98.23 | |
| 1bw0_A | 416 | TAT, protein (tyrosine aminotransferase); tyrosine | 98.23 | |
| 3asa_A | 400 | LL-diaminopimelate aminotransferase; PLP dependent | 98.22 | |
| 1d2f_A | 390 | MALY protein; aminotransferase fold, large PLP-bin | 98.14 | |
| 3l8a_A | 421 | METC, putative aminotransferase, probable beta-cys | 98.14 | |
| 1yiz_A | 429 | Kynurenine aminotransferase; glutamine transaminas | 98.14 | |
| 3cq5_A | 369 | Histidinol-phosphate aminotransferase; PLP, PMP, a | 98.13 | |
| 3if2_A | 444 | Aminotransferase; YP_265399.1, structura genomics, | 98.11 | |
| 3op7_A | 375 | Aminotransferase class I and II; PLP-dependent tra | 98.08 | |
| 3euc_A | 367 | Histidinol-phosphate aminotransferase 2; YP_297314 | 98.06 | |
| 1v2d_A | 381 | Glutamine aminotransferase; PLP, riken structural | 98.01 | |
| 3aow_A | 448 | Putative uncharacterized protein PH0207; protein-P | 98.0 | |
| 3fkd_A | 350 | L-threonine-O-3-phosphate decarboxylase; structura | 97.97 | |
| 3ftb_A | 361 | Histidinol-phosphate aminotransferase; structural | 97.95 | |
| 2zc0_A | 407 | Alanine glyoxylate transaminase; alanine:glyoxylat | 97.94 | |
| 2zyj_A | 397 | Alpha-aminodipate aminotransferase; alpha-aminoadi | 97.89 | |
| 3b1d_A | 392 | Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ | 96.94 | |
| 1vp4_A | 425 | Aminotransferase, putative; structural genomics, j | 97.74 | |
| 2r2n_A | 425 | Kynurenine/alpha-aminoadipate aminotransferase mit | 97.58 | |
| 1lc5_A | 364 | COBD, L-threonine-O-3-phosphate decarboxylase; PLP | 97.55 | |
| 2dr1_A | 386 | PH1308 protein, 386AA long hypothetical serine ami | 97.32 | |
| 2huf_A | 393 | Alanine glyoxylate aminotransferase; alpha and bet | 97.27 | |
| 1iug_A | 352 | Putative aspartate aminotransferase; wild type, py | 97.09 | |
| 3a2b_A | 398 | Serine palmitoyltransferase; vitamin B6-dependent | 97.02 | |
| 3zrp_A | 384 | Serine-pyruvate aminotransferase (AGXT); HET: PLP; | 97.01 | |
| 2bwn_A | 401 | 5-aminolevulinate synthase; tetrapyrrole biosynthe | 96.99 | |
| 1vjo_A | 393 | Alanine--glyoxylate aminotransferase; 17130350, AL | 96.95 | |
| 2zy4_A | 546 | L-aspartate beta-decarboxylase; pyridoxal 5'-phosp | 96.91 | |
| 1elu_A | 390 | L-cysteine/L-cystine C-S lyase; FES cluster biosyn | 96.81 | |
| 2fyf_A | 398 | PSAT, phosphoserine aminotransferase; PLP-dependen | 96.8 | |
| 2dkj_A | 407 | Serine hydroxymethyltransferase; PLP dependent enz | 96.6 | |
| 3kgw_A | 393 | Alanine-glyoxylate aminotransferase; AAH25799.1, p | 96.54 | |
| 2yrr_A | 353 | Aminotransferase, class V; structural genomics, NP | 96.42 | |
| 1fc4_A | 401 | 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino | 96.41 | |
| 3tqx_A | 399 | 2-amino-3-ketobutyrate coenzyme A ligase; energy m | 96.4 | |
| 3n0l_A | 417 | Serine hydroxymethyltransferase; alpha beta class, | 96.36 | |
| 1bs0_A | 384 | Protein (8-amino-7-oxonanoate synthase); PLP-depen | 96.25 | |
| 2z9v_A | 392 | Aspartate aminotransferase; pyridoxamine, pyruvate | 96.24 | |
| 3gbx_A | 420 | Serine hydroxymethyltransferase; structural genomi | 96.21 | |
| 3nnk_A | 411 | Ureidoglycine-glyoxylate aminotransferase; PLP-dep | 96.11 | |
| 1eg5_A | 384 | Aminotransferase; PLP-dependent enzymes, iron-sulf | 96.05 | |
| 1kmj_A | 406 | Selenocysteine lyase; persulfide perselenide NIFS | 96.03 | |
| 2vi8_A | 405 | Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, | 96.01 | |
| 1t3i_A | 420 | Probable cysteine desulfurase; PLP-binding enzyme, | 96.0 | |
| 3isl_A | 416 | Purine catabolism protein PUCG; pyridoxalphosphate | 95.89 | |
| 3f0h_A | 376 | Aminotransferase; RER070207000802, structural geno | 95.84 | |
| 4eb5_A | 382 | Probable cysteine desulfurase 2; scaffold, transfe | 95.67 | |
| 1sff_A | 426 | 4-aminobutyrate aminotransferase; enzyme complexes | 95.56 | |
| 1svv_A | 359 | Threonine aldolase; structural genomics, structura | 95.49 | |
| 1pff_A | 331 | Methionine gamma-lyase; homocysteine; 2.50A {Trich | 95.44 | |
| 1w23_A | 360 | Phosphoserine aminotransferase; pyridoxal-5'-phosp | 95.31 | |
| 2eh6_A | 375 | Acoat, acetylornithine aminotransferase; ARGD, str | 95.27 | |
| 3cai_A | 406 | Possible aminotransferase; RV3778C; 1.80A {Mycobac | 95.1 | |
| 3ffr_A | 362 | Phosphoserine aminotransferase SERC; structural ge | 95.07 | |
| 3ruy_A | 392 | Ornithine aminotransferase; structural genomics, c | 94.79 | |
| 2e7u_A | 424 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 94.77 | |
| 2c0r_A | 362 | PSAT, phosphoserine aminotransferase; pyridoxal-5' | 94.68 | |
| 1vef_A | 395 | Acetylornithine/acetyl-lysine aminotransferase; PL | 94.67 | |
| 2bkw_A | 385 | Alanine-glyoxylate aminotransferase 1; analine-gly | 94.61 | |
| 3ecd_A | 425 | Serine hydroxymethyltransferase 2; ssgcid, decode, | 94.52 | |
| 2w8t_A | 427 | SPT, serine palmitoyltransferase; HET: LLP; 1.25A | 94.31 | |
| 4e77_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase; structur | 94.26 | |
| 3k28_A | 429 | Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn | 94.21 | |
| 2ch1_A | 396 | 3-hydroxykynurenine transaminase; PLP-enzyme, kynu | 94.17 | |
| 4adb_A | 406 | Succinylornithine transaminase; transferase, PLP e | 94.12 | |
| 3fq8_A | 427 | Glutamate-1-semialdehyde 2,1-aminomutase; drug res | 94.11 | |
| 2po3_A | 424 | 4-dehydrase; external aldimine, PLP, aminotransfer | 93.97 | |
| 3lvm_A | 423 | Cysteine desulfurase; structural genomics, montrea | 93.83 | |
| 4a6r_A | 459 | Omega transaminase; transferase, PLP-binding enzym | 93.72 | |
| 1qz9_A | 416 | Kynureninase; kynurenine, tryptophan, PLP, vitamin | 93.62 | |
| 3gju_A | 460 | Putative aminotransferase; pyridoxal phosphate, PL | 93.57 | |
| 2eo5_A | 419 | 419AA long hypothetical aminotransferase; PLP enzy | 93.55 | |
| 2epj_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy | 93.34 | |
| 4hvk_A | 382 | Probable cysteine desulfurase 2; transferase and I | 93.28 | |
| 1m32_A | 366 | 2-aminoethylphosphonate-pyruvate aminotransferase; | 93.17 | |
| 2oga_A | 399 | Transaminase; PLP-dependent enzyme, desosamine, de | 93.14 | |
| 2cy8_A | 453 | D-phgat, D-phenylglycine aminotransferase; structu | 93.04 | |
| 1zod_A | 433 | DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, | 92.67 | |
| 1e5e_A | 404 | MGL, methionine gamma-lyase; methionine biosynthes | 92.57 | |
| 3nyt_A | 367 | Aminotransferase WBPE; PLP binding, nucleotide-sug | 92.49 | |
| 1ax4_A | 467 | Tryptophanase; tryptophan biosynthesis, tryptophan | 92.2 | |
| 3kki_A | 409 | CAI-1 autoinducer synthase; quorum sensing, CQSA, | 92.12 | |
| 3pj0_A | 359 | LMO0305 protein; structural genomics, joint center | 91.69 | |
| 1v72_A | 356 | Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 | 91.63 | |
| 3i4j_A | 430 | Aminotransferase, class III; structural GENOMICS,N | 91.52 | |
| 3h7f_A | 447 | Serine hydroxymethyltransferase 1; cytoplasm, one- | 91.2 | |
| 3lws_A | 357 | Aromatic amino acid beta-eliminating lyase/threoni | 91.14 | |
| 3l44_A | 434 | Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha | 90.94 | |
| 3f9t_A | 397 | TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L | 90.7 | |
| 2oqx_A | 467 | Tryptophanase; lyase, pyridoxal phosphate, tryptop | 90.58 | |
| 3dxv_A | 439 | Alpha-amino-epsilon-caprolactam racemase; fold-TYP | 90.47 | |
| 1s0a_A | 429 | Adenosylmethionine-8-amino-7-oxononanoate aminotra | 90.39 | |
| 1rv3_A | 483 | Serine hydroxymethyltransferase, cytosolic; one-ca | 90.3 | |
| 3acz_A | 389 | Methionine gamma-lyase; L-methionine; HET: LLP; 1. | 88.39 | |
| 2pb2_A | 420 | Acetylornithine/succinyldiaminopimelate aminotran; | 88.17 | |
| 3hmu_A | 472 | Aminotransferase, class III; structural genomics, | 87.97 | |
| 3nx3_A | 395 | Acoat, acetylornithine aminotransferase; csgid, st | 87.35 | |
| 2ez2_A | 456 | Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend | 87.0 | |
| 2e7j_A | 371 | SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st | 86.99 | |
| 3n5m_A | 452 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 86.49 | |
| 2oat_A | 439 | Ornithine aminotransferase; 5-fluoromethylornithin | 86.19 | |
| 1mdo_A | 393 | ARNB aminotransferase; type 1 aminotransferase fol | 86.15 | |
| 1wyu_A | 438 | Glycine dehydrogenase (decarboxylating) subunit 1; | 85.55 | |
| 1b9h_A | 388 | AHBA synthase, protein (3-amino-5-hydroxybenzoic a | 84.26 | |
| 2yky_A | 465 | Beta-transaminase; transferase; HET: PLP SFE; 1.69 | 84.64 | |
| 3cog_A | 403 | Cystathionine gamma-lyase; CTH, PLP, propargylglyc | 84.11 | |
| 2aeu_A | 374 | Hypothetical protein MJ0158; selenocysteine syntha | 84.11 | |
| 1jg8_A | 347 | L-ALLO-threonine aldolase; glycine biosynthesis, p | 83.73 | |
| 3i5t_A | 476 | Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N | 83.3 | |
| 2a7v_A | 490 | Serine hydroxymethyltransferase; structural genomi | 83.0 | |
| 3a8u_X | 449 | Omega-amino acid--pyruvate aminotransferase; large | 82.92 | |
| 4ffc_A | 453 | 4-aminobutyrate aminotransferase (GABT); structura | 82.91 | |
| 3tfu_A | 457 | Adenosylmethionine-8-amino-7-oxononanoate aminotr; | 82.71 | |
| 2ord_A | 397 | Acoat, acetylornithine aminotransferase; TM1785, a | 81.87 | |
| 3oks_A | 451 | 4-aminobutyrate transaminase; ssgcid, transferase, | 80.61 |
| >4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.7e-37 Score=260.69 Aligned_cols=133 Identities=33% Similarity=0.624 Sum_probs=129.9
Q ss_pred CCcccccccCCCCcccccceeEEEeCCHHHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHHHHH
Q psy16706 1 QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADR 80 (142)
Q Consensus 1 ~SKnfgL~~~~~~YgeRvGal~vv~~~~~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m~~r 80 (142)
.||+||| ||+|+|++++++++.+.+.++.++++.++|++||+||.+|+++++.+|+||+++++|++|++.|++|
T Consensus 263 ~SK~~~~------~G~RvG~~~~~~~~~~~~~~~~~~l~~~~r~~~s~~p~~~a~~~~~~l~d~~l~~~~~~~~~~m~~r 336 (420)
T 4h51_A 263 FSKNMGL------YSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAER 336 (420)
T ss_dssp CTTTSCC------GGGCEEEEEEECSCHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHH
T ss_pred ccccccc------ccCceEEEEecccCHHHHHHHHHHHHHhhhcccCcchHHHHHHHHHHhcCHHHHHHHHHHHHHHHHH
Confidence 4999999 9999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccC
Q psy16706 81 IISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQ 141 (142)
Q Consensus 81 i~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~ 141 (142)
++.+|+.|.++|++.|++++|+||+.|.|||+++||+++||+. | +++|||++++||||+
T Consensus 337 ~~~~R~~l~~~L~~~g~~~~~~~i~~q~GmF~~~gls~e~v~~-L-~e~~Vy~~~~gRis~ 395 (420)
T 4h51_A 337 IRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEY-C-QNHNIFITVSGRANM 395 (420)
T ss_dssp HHHHHHHHHHHHHHTTCSSCCTHHHHCCSSEEECCCCHHHHHH-H-HHTTEECCTTCEEEG
T ss_pred HHHHHHHHHHHHHHhCCCCCCCeecCCCceEEecCcCHHHHHH-H-HhCCEEEcCCCEEEe
Confidence 9999999999999999999999999999999999999999987 8 689999999999986
|
| >3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} | Back alignment and structure |
|---|
| >4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* | Back alignment and structure |
|---|
| >7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* | Back alignment and structure |
|---|
| >4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* | Back alignment and structure |
|---|
| >1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* | Back alignment and structure |
|---|
| >3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} | Back alignment and structure |
|---|
| >1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* | Back alignment and structure |
|---|
| >2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... | Back alignment and structure |
|---|
| >3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* | Back alignment and structure |
|---|
| >2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* | Back alignment and structure |
|---|
| >3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* | Back alignment and structure |
|---|
| >1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* | Back alignment and structure |
|---|
| >3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* | Back alignment and structure |
|---|
| >3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* | Back alignment and structure |
|---|
| >3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* | Back alignment and structure |
|---|
| >3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* | Back alignment and structure |
|---|
| >3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} | Back alignment and structure |
|---|
| >1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* | Back alignment and structure |
|---|
| >1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* | Back alignment and structure |
|---|
| >3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* | Back alignment and structure |
|---|
| >3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} | Back alignment and structure |
|---|
| >3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* | Back alignment and structure |
|---|
| >2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} | Back alignment and structure |
|---|
| >3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} | Back alignment and structure |
|---|
| >2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* | Back alignment and structure |
|---|
| >3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* | Back alignment and structure |
|---|
| >3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* | Back alignment and structure |
|---|
| >1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* | Back alignment and structure |
|---|
| >3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A | Back alignment and structure |
|---|
| >3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} | Back alignment and structure |
|---|
| >3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* | Back alignment and structure |
|---|
| >3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* | Back alignment and structure |
|---|
| >3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* | Back alignment and structure |
|---|
| >3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} | Back alignment and structure |
|---|
| >2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* | Back alignment and structure |
|---|
| >3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* | Back alignment and structure |
|---|
| >1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* | Back alignment and structure |
|---|
| >1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* | Back alignment and structure |
|---|
| >2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* | Back alignment and structure |
|---|
| >1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} | Back alignment and structure |
|---|
| >3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* | Back alignment and structure |
|---|
| >2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* | Back alignment and structure |
|---|
| >1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* | Back alignment and structure |
|---|
| >1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* | Back alignment and structure |
|---|
| >2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* | Back alignment and structure |
|---|
| >2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* | Back alignment and structure |
|---|
| >2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* | Back alignment and structure |
|---|
| >1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 | Back alignment and structure |
|---|
| >3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* | Back alignment and structure |
|---|
| >2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* | Back alignment and structure |
|---|
| >3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* | Back alignment and structure |
|---|
| >3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* | Back alignment and structure |
|---|
| >1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* | Back alignment and structure |
|---|
| >2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... | Back alignment and structure |
|---|
| >1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} | Back alignment and structure |
|---|
| >4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* | Back alignment and structure |
|---|
| >1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* | Back alignment and structure |
|---|
| >1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* | Back alignment and structure |
|---|
| >2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* | Back alignment and structure |
|---|
| >1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* | Back alignment and structure |
|---|
| >2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* | Back alignment and structure |
|---|
| >4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} | Back alignment and structure |
|---|
| >3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* | Back alignment and structure |
|---|
| >2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* | Back alignment and structure |
|---|
| >4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A | Back alignment and structure |
|---|
| >3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* | Back alignment and structure |
|---|
| >2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* | Back alignment and structure |
|---|
| >4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* | Back alignment and structure |
|---|
| >1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* | Back alignment and structure |
|---|
| >2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* | Back alignment and structure |
|---|
| >4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* | Back alignment and structure |
|---|
| >1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 | Back alignment and structure |
|---|
| >2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* | Back alignment and structure |
|---|
| >2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} | Back alignment and structure |
|---|
| >1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* | Back alignment and structure |
|---|
| >1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* | Back alignment and structure |
|---|
| >3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* | Back alignment and structure |
|---|
| >1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 | Back alignment and structure |
|---|
| >3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A | Back alignment and structure |
|---|
| >3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 | Back alignment and structure |
|---|
| >3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 | Back alignment and structure |
|---|
| >3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* | Back alignment and structure |
|---|
| >3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* | Back alignment and structure |
|---|
| >1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* | Back alignment and structure |
|---|
| >1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* | Back alignment and structure |
|---|
| >3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* | Back alignment and structure |
|---|
| >2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* | Back alignment and structure |
|---|
| >3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* | Back alignment and structure |
|---|
| >2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* | Back alignment and structure |
|---|
| >3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* | Back alignment and structure |
|---|
| >1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* | Back alignment and structure |
|---|
| >1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* | Back alignment and structure |
|---|
| >1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* | Back alignment and structure |
|---|
| >2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* | Back alignment and structure |
|---|
| >3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B | Back alignment and structure |
|---|
| >2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* | Back alignment and structure |
|---|
| >1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* | Back alignment and structure |
|---|
| >3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A | Back alignment and structure |
|---|
| >3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} | Back alignment and structure |
|---|
| >4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* | Back alignment and structure |
|---|
| >2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* | Back alignment and structure |
|---|
| >3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 142 | ||||
| d1ajsa_ | 412 | c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig | 4e-22 | |
| d2q7wa1 | 396 | c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT | 1e-20 | |
| d1yaaa_ | 412 | c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak | 2e-20 | |
| d7aata_ | 401 | c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi | 3e-20 | |
| d3tata_ | 397 | c.67.1.1 (A:) Aromatic aminoacid aminotransferase, | 4e-20 | |
| d2ay1a_ | 394 | c.67.1.1 (A:) Aromatic aminoacid aminotransferase, | 1e-19 |
| >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: AAT-like domain: Aspartate aminotransferase, AAT species: Pig (Sus scrofa), cytosolic form [TaxId: 9823]
Score = 88.1 bits (217), Expect = 4e-22
Identities = 53/111 (47%), Positives = 72/111 (64%)
Query: 15 GERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEV 74
ERVG ++V+ + D R+LSQ++ ++R +S+PP GARIV L DP+L +W V
Sbjct: 264 NERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNV 323
Query: 75 KGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKL 125
K MADRI+SMR L+ L+ + WNHITDQIGMF +TGLN QV +
Sbjct: 324 KTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLI 374
|
| >d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 | Back information, alignment and structure |
|---|
| >d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 | Back information, alignment and structure |
|---|
| >d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 | Back information, alignment and structure |
|---|
| >d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 | Back information, alignment and structure |
|---|
| >d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 142 | |||
| d1yaaa_ | 412 | Aspartate aminotransferase, AAT {Baker's yeast (Sa | 99.94 | |
| d2ay1a_ | 394 | Aromatic aminoacid aminotransferase, AroAT {Paraco | 99.94 | |
| d1ajsa_ | 412 | Aspartate aminotransferase, AAT {Pig (Sus scrofa), | 99.94 | |
| d2q7wa1 | 396 | Aspartate aminotransferase, AAT {Escherichia coli | 99.93 | |
| d7aata_ | 401 | Aspartate aminotransferase, AAT {Chicken (Gallus g | 99.93 | |
| d3tata_ | 397 | Aromatic aminoacid aminotransferase, AroAT {Escher | 99.92 | |
| d1w7la_ | 418 | Kynurenine--oxoglutarate transaminase I {Human (Ho | 98.83 | |
| d1iaya_ | 428 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 98.8 | |
| d1gdea_ | 388 | Aromatic aminoacid aminotransferase, AroAT {Archae | 98.78 | |
| d1m7ya_ | 431 | 1-aminocyclopropane-1-carboxylate synthase (ACC sy | 98.77 | |
| d1bw0a_ | 412 | Tyrosine aminotransferase (TAT) {Trypanosoma cruzi | 98.67 | |
| d1j32a_ | 388 | Aspartate aminotransferase, AAT {Phormidium lapide | 98.65 | |
| d1xi9a_ | 395 | Putative alanine aminotransferase {Pyrococcus furi | 98.55 | |
| d2r5ea1 | 418 | Kynurenine--oxoglutarate transaminase I {Yellowfev | 98.5 | |
| d1u08a_ | 382 | Putative methionine aminotransferase YdbL {Escheri | 98.48 | |
| d1b5pa_ | 382 | Aspartate aminotransferase, AAT {Thermus thermophi | 98.47 | |
| d1v2da_ | 368 | Glutamine aminotransferase {Thermus thermophilus [ | 98.37 | |
| d1o4sa_ | 375 | Aspartate aminotransferase, AAT {Thermotoga mariti | 98.12 | |
| d1c7na_ | 394 | Cystalysin {Treponema denticola [TaxId: 158]} | 98.09 | |
| d1fg7a_ | 354 | Histidinol-phosphate aminotransferase HisC {Escher | 98.08 | |
| d1lc5a_ | 355 | L-threonine-O-3-phosphate decarboxylase CobD {Salm | 98.03 | |
| d2gb3a1 | 389 | AAT homologue TM1698 {Thermotoga maritima [TaxId: | 98.01 | |
| d1wsta1 | 403 | Multiple substrate aminotransferase, MSAT {Thermoc | 98.01 | |
| d1d2fa_ | 361 | Modulator in mal gene expression, MalY {Escherichi | 98.0 | |
| d2f8ja1 | 334 | Histidinol-phosphate aminotransferase HisC {Thermo | 97.99 | |
| d1vp4a_ | 420 | Putative aminotransferase TM1131 {Thermotoga marit | 97.97 | |
| d2hoxa1 | 425 | Alliinase {Garlic (Allium sativum) [TaxId: 4682]} | 96.61 | |
| d2bwna1 | 396 | 5-aminolevulinate synthase {Rhodobacter capsulatus | 87.15 | |
| d1bs0a_ | 383 | PLP-dependent acyl-CoA synthase (8-amino-7-oxonano | 83.48 |
| >d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: PLP-dependent transferase-like superfamily: PLP-dependent transferases family: AAT-like domain: Aspartate aminotransferase, AAT species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]
Probab=99.94 E-value=2.6e-27 Score=196.38 Aligned_cols=133 Identities=38% Similarity=0.657 Sum_probs=125.4
Q ss_pred CcccccccCCCCcccccceeEEEeCCH----HHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHH
Q psy16706 2 KKNYGIHFTCLPVGERVGAFSIVSADK----DEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGM 77 (142)
Q Consensus 2 SKnfgL~~~~~~YgeRvGal~vv~~~~----~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m 77 (142)
||+||+ ||.|+|.+++..+.. +..+.+.+++...+|++|++||.+++.++..++.|+.++++|.++++.|
T Consensus 253 SK~~~~------~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~ 326 (412)
T d1yaaa_ 253 AKNAGM------YGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTM 326 (412)
T ss_dssp TTTSCC------GGGCEEEEEEECCSCTTHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHH
T ss_pred CCcccc------CcCceEEEEEchhhhhhHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHhcChHHHHHHHHHHHHH
Confidence 899999 999999999987653 4556677888889999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccC
Q psy16706 78 ADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQ 141 (142)
Q Consensus 78 ~~ri~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~ 141 (142)
+++++++|..|.+.|++++.+++|++++.|.|||+++|++++++++ |+++++||+++++|||.
T Consensus 327 ~~~~~~~r~~l~~~L~~~g~~~~~~~~~~~gG~F~~~~ls~e~~~~-L~~e~~V~~~~g~Ris~ 389 (412)
T d1yaaa_ 327 SSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKR-LEETHAVYLVASGRASI 389 (412)
T ss_dssp HHHHHHHHHHHHHHHHHHTCSSCCTHHHHCCSSEEECCCCHHHHHH-HHHHHCEECCTTSEEEG
T ss_pred HHHHHHHHHHHHHHHHHhCCCCCCceeCCCceEEEecCcCHHHHHH-HHHhCCEEECCCCEEEe
Confidence 9999999999999999999999999999999999999999999998 99999999999999985
|
| >d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} | Back information, alignment and structure |
|---|
| >d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} | Back information, alignment and structure |
|---|
| >d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} | Back information, alignment and structure |
|---|
| >d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} | Back information, alignment and structure |
|---|
| >d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} | Back information, alignment and structure |
|---|
| >d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} | Back information, alignment and structure |
|---|
| >d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|