Psyllid ID: psy16706

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE
ccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccEEEccccccccc
ccccccccccccccHHcEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccEEEccccHHHHHHHHHHccEEEEEccccEccc
qkknygihftclpvgervgafsiVSADKDEAARILSQLKILIRAFyssppihgaRIVQEIlgdpklksqWLTEVKGMADRIISMRQSLKDNlqkegsnkpwnhitdqIGMFCYTGLNATQVRRKLIHdrslklsnvekcsqe
qkknygihftclpvgerVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIhdrslklsnvekcsqe
QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE
****YGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIIS****************PWNHITDQIGMFCYTGLNATQVRRKLIHD**************
QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKC***
QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE
****YGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNV******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
Q5REB0430 Aspartate aminotransferas yes N/A 0.880 0.290 0.590 2e-37
P12344430 Aspartate aminotransferas yes N/A 0.809 0.267 0.628 2e-37
P05202430 Aspartate aminotransferas yes N/A 0.809 0.267 0.619 2e-37
P00507430 Aspartate aminotransferas yes N/A 0.809 0.267 0.619 2e-37
P08907401 Aspartate aminotransferas yes N/A 0.809 0.286 0.619 2e-37
Q4R559430 Aspartate aminotransferas N/A N/A 0.809 0.267 0.619 3e-37
P00506430 Aspartate aminotransferas yes N/A 0.809 0.267 0.603 1e-36
P00508423 Aspartate aminotransferas yes N/A 0.809 0.271 0.595 2e-36
P00505430 Aspartate aminotransferas yes N/A 0.880 0.290 0.583 2e-36
Q28F67427 Aspartate aminotransferas yes N/A 0.880 0.292 0.568 2e-36
>sp|Q5REB0|AATM_PONAB Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1 Back     alignment and function desciption
 Score =  154 bits (389), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 93/132 (70%), Gaps = 7/132 (5%)

Query: 3   KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
           KN G++      GERVGAF++V  D DEA R+ SQLKILIR  YS+PP++GARI   IL 
Sbjct: 279 KNMGLY------GERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILN 332

Query: 63  DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
            P L+ QWL EVKGMADRII MR  L  NL+KEGS   W HITDQIGMFC+TGL   QV 
Sbjct: 333 TPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVE 392

Query: 123 RKLIHDRSLKLS 134
           R LI + S+ ++
Sbjct: 393 R-LIKEFSIYMT 403
Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
Pongo abelii (taxid: 9601)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial OS=Bos taurus GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 Back     alignment and function description
>sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 Back     alignment and function description
>sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 Back     alignment and function description
>sp|Q4R559|AATM_MACFA Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=3 Back     alignment and function description
>sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
156548504 439 PREDICTED: aspartate aminotransferase, m 0.809 0.261 0.669 2e-41
322800334 430 hypothetical protein SINV_02306 [Solenop 0.880 0.290 0.628 3e-41
332372484 424 unknown [Dendroctonus ponderosae] 0.880 0.294 0.636 4e-41
332025582 430 Aspartate aminotransferase, mitochondria 0.880 0.290 0.628 4e-41
201023323 424 aspartate aminotransferase 2 [Acyrthosip 0.887 0.297 0.639 2e-40
91084123 423 PREDICTED: similar to aspartate aminotra 0.809 0.271 0.628 7e-39
25147133 414 Protein GOT-2.2, isoform a [Caenorhabdit 0.880 0.301 0.606 7e-39
307178208 429 Aspartate aminotransferase, mitochondria 0.880 0.291 0.613 7e-39
268579721 414 Hypothetical protein CBG05011 [Caenorhab 0.880 0.301 0.613 1e-38
383861654 432 PREDICTED: aspartate aminotransferase, m 0.880 0.289 0.598 1e-38
>gi|156548504|ref|XP_001605831.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 81/121 (66%), Positives = 100/121 (82%), Gaps = 6/121 (4%)

Query: 3   KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
           KN G++      GERVGAF++V+ DKDEAAR LSQ+KILIR  YS+PPI+GARIV EILG
Sbjct: 278 KNMGLY------GERVGAFTLVNGDKDEAARTLSQIKILIRPMYSNPPINGARIVTEILG 331

Query: 63  DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
           +P+LK QWL +VKGMADRIIS+R +L+DNL+K GS + W+HITDQIGMFC+TGL A +V 
Sbjct: 332 NPELKKQWLVDVKGMADRIISVRTTLRDNLKKNGSTRDWSHITDQIGMFCFTGLKAPEVE 391

Query: 123 R 123
           R
Sbjct: 392 R 392

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322800334|gb|EFZ21338.1| hypothetical protein SINV_02306 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332372484|gb|AEE61384.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|332025582|gb|EGI65745.1| Aspartate aminotransferase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|201023323|ref|NP_001128403.1| aspartate aminotransferase 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91084123|ref|XP_967224.1| PREDICTED: similar to aspartate aminotransferase [Tribolium castaneum] gi|270006661|gb|EFA03109.1| hypothetical protein TcasGA2_TC013019 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|25147133|ref|NP_741810.1| Protein GOT-2.2, isoform a [Caenorhabditis elegans] gi|351057935|emb|CCD64538.1| Protein GOT-2.2, isoform a [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|307178208|gb|EFN66993.1| Aspartate aminotransferase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|268579721|ref|XP_002644843.1| Hypothetical protein CBG05011 [Caenorhabditis briggsae] Back     alignment and taxonomy information
>gi|383861654|ref|XP_003706300.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
WB|WBGene00015778414 got-2.2 [Caenorhabditis elegan 0.880 0.301 0.606 6.3e-37
FB|FBgn0001125431 Got2 "Glutamate oxaloacetate t 0.887 0.292 0.563 6.5e-35
UNIPROTKB|Q5REB0430 GOT2 "Aspartate aminotransfera 0.880 0.290 0.590 2.2e-34
UNIPROTKB|P12344430 GOT2 "Aspartate aminotransfera 0.809 0.267 0.628 3.6e-34
MGI|MGI:95792430 Got2 "glutamate oxaloacetate t 0.809 0.267 0.619 3.6e-34
RGD|2722430 Got2 "glutamic-oxaloacetic tra 0.809 0.267 0.619 3.6e-34
UNIPROTKB|P08907401 GOT2 "Aspartate aminotransfera 0.809 0.286 0.619 4.6e-34
UNIPROTKB|Q4R559430 GOT2 "Aspartate aminotransfera 0.809 0.267 0.619 5.8e-34
UNIPROTKB|P00506430 GOT2 "Aspartate aminotransfera 0.809 0.267 0.603 1.2e-33
UNIPROTKB|F1P180401 GOT2 "Aspartate aminotransfera 0.809 0.286 0.595 1.5e-33
WB|WBGene00015778 got-2.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 397 (144.8 bits), Expect = 6.3e-37, P = 6.3e-37
 Identities = 80/132 (60%), Positives = 99/132 (75%)

Query:     3 KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
             KN G++      GERVGAFS+V++D DEAAR+ SQ+KILIR  YS+PP+HGARI   IL 
Sbjct:   263 KNMGLY------GERVGAFSVVTSDADEAARVASQVKILIRPLYSNPPVHGARIASRILA 316

Query:    63 DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
             DP L  QWL +VK MADRII+MR +LKD L KEGS + W HIT+QIGMFC+TG+N  QV 
Sbjct:   317 DPALNKQWLGDVKLMADRIITMRTTLKDLLAKEGSTRNWEHITNQIGMFCFTGINPQQVE 376

Query:   123 RKLIHDRSLKLS 134
              KLI + S+ L+
Sbjct:   377 -KLIKEHSVYLT 387
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
FB|FBgn0001125 Got2 "Glutamate oxaloacetate transaminase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5REB0 GOT2 "Aspartate aminotransferase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
UNIPROTKB|P12344 GOT2 "Aspartate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:95792 Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2722 Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P08907 GOT2 "Aspartate aminotransferase, mitochondrial" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R559 GOT2 "Aspartate aminotransferase, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P00506 GOT2 "Aspartate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P180 GOT2 "Aspartate aminotransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46643AAT1_ARATH2, ., 6, ., 1, ., 10.52060.80980.2674yesN/A
P74861TYRB_SALTY2, ., 6, ., 1, ., 5, 70.50450.76760.2745yesN/A
P05202AATM_MOUSE2, ., 6, ., 1, ., 10.61980.80980.2674yesN/A
O94320AATM_SCHPO2, ., 6, ., 1, ., 10.5750.79570.2585yesN/A
Q28F67AATM_XENTR2, ., 6, ., 1, ., 10.56810.88020.2927yesN/A
Q5REB0AATM_PONAB2, ., 6, ., 1, ., 10.59090.88020.2906yesN/A
P12344AATM_BOVIN2, ., 6, ., 1, ., 10.62800.80980.2674yesN/A
P00508AATM_CHICK2, ., 6, ., 1, ., 10.59500.80980.2718yesN/A
P00507AATM_RAT2, ., 6, ., 1, ., 10.61980.80980.2674yesN/A
P00506AATM_PIG2, ., 6, ., 1, ., 10.60330.80980.2674yesN/A
P00505AATM_HUMAN2, ., 6, ., 1, ., 10.58330.88020.2906yesN/A
Q55F21AATM_DICDI2, ., 6, ., 1, ., 10.56190.80980.2699yesN/A
P08907AATM_HORSE2, ., 6, ., 1, ., 10.61980.80980.2867yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
PLN02397423 PLN02397, PLN02397, aspartate transaminase 2e-63
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 3e-55
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 3e-53
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 4e-50
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 9e-22
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 1e-08
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information 
 Score =  199 bits (507), Expect = 2e-63
 Identities = 71/121 (58%), Positives = 84/121 (69%), Gaps = 6/121 (4%)

Query: 3   KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
           KN G++      GERVGA S+V    D A R+ SQLK++ R  YS+PPIHGA IV  ILG
Sbjct: 269 KNMGLY------GERVGALSVVCKSADVAVRVKSQLKLIARPMYSNPPIHGASIVATILG 322

Query: 63  DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
           DP+L S+W  E+KGMADRIISMRQ L D L+  GS   W+HIT QIGMF +TGLN  QV 
Sbjct: 323 DPELFSEWTKELKGMADRIISMRQKLYDALEARGSPGDWSHITKQIGMFSFTGLNKEQVD 382

Query: 123 R 123
           R
Sbjct: 383 R 383

Length = 423
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
KOG1411|consensus427 100.0
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
KOG1412|consensus410 100.0
PLN02397423 aspartate transaminase 99.87
PTZ00376404 aspartate aminotransferase; Provisional 99.82
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.81
PRK08637388 hypothetical protein; Provisional 99.22
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.04
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.03
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 98.99
PRK06108382 aspartate aminotransferase; Provisional 98.83
PRK08068389 transaminase; Reviewed 98.81
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 98.81
PRK05957389 aspartate aminotransferase; Provisional 98.8
PRK08912387 hypothetical protein; Provisional 98.73
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 98.73
PRK07550386 hypothetical protein; Provisional 98.71
PRK07777387 aminotransferase; Validated 98.69
PRK09082386 methionine aminotransferase; Validated 98.68
PTZ00433412 tyrosine aminotransferase; Provisional 98.67
PLN02231534 alanine transaminase 98.66
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 98.63
PRK09148405 aminotransferase; Validated 98.62
PRK07682378 hypothetical protein; Validated 98.61
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 98.58
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 98.57
PRK09105370 putative aminotransferase; Provisional 98.57
PTZ00377481 alanine aminotransferase; Provisional 98.56
PRK08636403 aspartate aminotransferase; Provisional 98.55
PRK06348384 aspartate aminotransferase; Provisional 98.55
PRK06836394 aspartate aminotransferase; Provisional 98.54
PRK07681399 aspartate aminotransferase; Provisional 98.53
PRK12414384 putative aminotransferase; Provisional 98.52
PRK08960387 hypothetical protein; Provisional 98.52
PLN02368407 alanine transaminase 98.51
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 98.51
PRK07683387 aminotransferase A; Validated 98.48
PRK08175395 aminotransferase; Validated 98.48
PRK07337388 aminotransferase; Validated 98.48
PLN00175413 aminotransferase family protein; Provisional 98.47
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 98.46
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 98.46
PRK05764393 aspartate aminotransferase; Provisional 98.46
PRK07568397 aspartate aminotransferase; Provisional 98.43
PRK08361391 aspartate aminotransferase; Provisional 98.43
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 98.43
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 98.41
PRK07366388 succinyldiaminopimelate transaminase; Validated 98.4
cd00609350 AAT_like Aspartate aminotransferase family. This f 98.4
PRK08363398 alanine aminotransferase; Validated 98.4
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 98.38
PRK05942394 aspartate aminotransferase; Provisional 98.37
PRK06290410 aspartate aminotransferase; Provisional 98.36
PRK07324373 transaminase; Validated 98.35
PRK07309391 aromatic amino acid aminotransferase; Validated 98.33
PRK06855433 aminotransferase; Validated 98.33
PRK06107402 aspartate aminotransferase; Provisional 98.31
PRK08056356 threonine-phosphate decarboxylase; Provisional 98.3
PRK09265404 aminotransferase AlaT; Validated 98.27
PRK15481431 transcriptional regulatory protein PtsJ; Provision 98.24
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 98.22
PLN02656409 tyrosine transaminase 98.2
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 98.2
PRK09440416 avtA valine--pyruvate transaminase; Provisional 98.2
PRK13355517 bifunctional HTH-domain containing protein/aminotr 98.19
PRK03158359 histidinol-phosphate aminotransferase; Provisional 98.18
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 98.15
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 98.15
PRK06207405 aspartate aminotransferase; Provisional 98.14
PRK05387353 histidinol-phosphate aminotransferase; Provisional 98.13
PRK07392360 threonine-phosphate decarboxylase; Validated 98.12
PLN03026380 histidinol-phosphate aminotransferase; Provisional 98.07
PRK03317368 histidinol-phosphate aminotransferase; Provisional 98.06
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 98.03
PRK02731367 histidinol-phosphate aminotransferase; Validated 98.02
PLN026721082 methionine S-methyltransferase 98.0
PRK08153369 histidinol-phosphate aminotransferase; Provisional 97.99
PRK05166371 histidinol-phosphate aminotransferase; Provisional 97.98
PRK06358354 threonine-phosphate decarboxylase; Provisional 97.97
PRK09147396 succinyldiaminopimelate transaminase; Provisional 97.97
PRK06959339 putative threonine-phosphate decarboxylase; Provis 97.96
PRK03967337 histidinol-phosphate aminotransferase; Provisional 97.95
PRK07908349 hypothetical protein; Provisional 97.94
PRK04781364 histidinol-phosphate aminotransferase; Provisional 97.89
PLN02187462 rooty/superroot1 97.89
PRK14808335 histidinol-phosphate aminotransferase; Provisional 97.88
PRK03321352 putative aminotransferase; Provisional 97.82
PRK04870356 histidinol-phosphate aminotransferase; Provisional 97.82
PRK05664330 threonine-phosphate decarboxylase; Reviewed 97.8
PRK14809357 histidinol-phosphate aminotransferase; Provisional 97.8
PRK14807351 histidinol-phosphate aminotransferase; Provisional 97.79
PRK01688351 histidinol-phosphate aminotransferase; Provisional 97.79
PRK05839374 hypothetical protein; Provisional 97.78
PRK09275527 aspartate aminotransferase; Provisional 97.76
PRK02610374 histidinol-phosphate aminotransferase; Provisional 97.73
PRK04635354 histidinol-phosphate aminotransferase; Provisional 97.73
KOG0256|consensus471 97.73
PRK06425332 histidinol-phosphate aminotransferase; Validated 97.72
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 97.69
PRK00950361 histidinol-phosphate aminotransferase; Validated 97.69
PRK01533366 histidinol-phosphate aminotransferase; Validated 97.61
PRK06225380 aspartate aminotransferase; Provisional 97.4
PRK08354311 putative aminotransferase; Provisional 97.16
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 97.0
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 96.53
PRK10534333 L-threonine aldolase; Provisional 96.38
TIGR00707379 argD acetylornithine and succinylornithine aminotr 96.1
PRK13392410 5-aminolevulinate synthase; Provisional 95.99
PRK09064407 5-aminolevulinate synthase; Validated 95.97
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 95.93
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 95.86
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 95.67
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 95.66
KOG0634|consensus472 95.43
cd06454349 KBL_like KBL_like; this family belongs to the pyri 95.35
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 95.22
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 95.16
PRK04260375 acetylornithine aminotransferase; Provisional 95.13
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 95.03
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 94.65
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 94.59
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 94.35
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 93.92
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 93.72
PLN02822481 serine palmitoyltransferase 93.6
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 93.5
PRK13393406 5-aminolevulinate synthase; Provisional 93.39
PRK02627396 acetylornithine aminotransferase; Provisional 93.26
PRK02936377 argD acetylornithine aminotransferase; Provisional 93.06
PLN02483489 serine palmitoyltransferase 92.98
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 92.91
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 92.87
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 92.28
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 91.91
PTZ00125400 ornithine aminotransferase-like protein; Provision 91.79
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 91.16
PRK03244398 argD acetylornithine aminotransferase; Provisional 91.02
PRK02948381 cysteine desulfurase; Provisional 90.78
KOG0633|consensus375 90.61
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 90.16
PRK12381406 bifunctional succinylornithine transaminase/acetyl 89.71
PLN02721353 threonine aldolase 89.6
KOG0257|consensus420 89.19
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 88.19
PRK01278389 argD acetylornithine transaminase protein; Provisi 88.17
PRK00451447 glycine dehydrogenase subunit 1; Validated 87.42
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 86.84
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 86.6
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 86.58
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 86.43
PRK04612408 argD acetylornithine transaminase protein; Provisi 86.01
PLN02242418 methionine gamma-lyase 85.98
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 85.67
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 84.55
PRK07179407 hypothetical protein; Provisional 83.63
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 83.56
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 83.29
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 83.03
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 82.94
PRK06777421 4-aminobutyrate aminotransferase; Provisional 81.62
PLN00144382 acetylornithine transaminase 81.62
PRK13580493 serine hydroxymethyltransferase; Provisional 80.95
PRK08088425 4-aminobutyrate aminotransferase; Validated 80.62
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 80.04
>KOG1411|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-53  Score=358.53  Aligned_cols=135  Identities=61%  Similarity=0.952  Sum_probs=133.2

Q ss_pred             CCcccccccCCCCcccccceeEEEeCCHHHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHHHHH
Q psy16706          1 QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADR   80 (142)
Q Consensus         1 ~SKnfgL~~~~~~YgeRvGal~vv~~~~~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m~~r   80 (142)
                      |+|||||      |||||||++|||+|++++.+|+||++.++|++|||||.|||+||++||+||+|+++|..|++.|.+|
T Consensus       271 yAKNMGL------YgERvGa~svvc~~ad~A~rV~SQlk~liRpmYSnPP~hGArIv~~Il~d~~l~~~W~~evk~MadR  344 (427)
T KOG1411|consen  271 YAKNMGL------YGERVGALSVVCKDADEAKRVESQLKILIRPMYSNPPLHGARIVATILSDPDLKNQWLGEVKGMADR  344 (427)
T ss_pred             hhhhcch------hhhccceeEEEecCHHHHHHHHHHHHHHhcccccCCCccchhhhhhccCChHHHHHHHHHHHHHHHh
Confidence            6899999      9999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccCC
Q psy16706         81 IISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQE  142 (142)
Q Consensus        81 i~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~~  142 (142)
                      |+.||+.|++.|++.+++++|+||++|.||||||||+|+||+. |+++|||||+.|||||+.
T Consensus       345 i~~mR~~L~d~L~~~gs~~~W~hI~~QIGMF~fTgl~peQv~~-l~ke~~iYmT~dGRiS~a  405 (427)
T KOG1411|consen  345 IISMRQQLFDALEKEGSPGNWSHITKQIGMFCFTGLNPEQVDW-LTKEYHIYLTKDGRISMA  405 (427)
T ss_pred             hhhhHHHHhHHhhcCCCCccHHHHHHhhheeeecCCCHHHHHH-HHhhheeeeccCceEeec
Confidence            9999999999999999999999999999999999999999999 999999999999999973

>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
3pd6_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 2e-38
3hlm_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 4e-38
7aat_A401 X-Ray Structure Refinement And Comparison Of Three 2e-37
1aka_A401 Structural Basis For The Catalytic Activity Of Aspa 4e-37
1aat_A411 Oxoglutarate-Induced Conformational Changes In Cyto 9e-28
2cst_A411 Crystal Structure Of The Closed Form Of Chicken Cyt 1e-27
1ajs_A412 Refinement And Comparison Of The Crystal Structures 1e-27
1ajr_A412 Refinement And Comparison Of The Crystal Structures 5e-27
4f4e_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 3e-26
4eff_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 3e-26
3ii0_A422 Crystal Structure Of Human Glutamate Oxaloacetate T 1e-25
3tat_A397 Tyrosine Aminotransferase From E. Coli Length = 397 8e-24
3fsl_A397 Crystal Structure Of Tyrosine Aminotransferase Trip 1e-23
4eu1_A409 Structure Of A Mitochondrial Aspartate Aminotransfe 5e-23
1ahy_A396 Aspartate Aminotransferase Hexamutant Length = 396 2e-22
1ari_A396 Aspartate Aminotransferase, W140h Mutant, Maleate C 5e-22
1ix6_A396 Aspartate Aminotransferase Active Site Mutant V39f 5e-22
1ix8_A396 Aspartate Aminotransferase Active Site Mutant V39fN 5e-22
1b4x_A396 Aspartate Aminotransferase From E. Coli, C191s Muta 5e-22
1g7w_A396 Aspartate Aminotransferase Active Site Mutant N194a 5e-22
1asb_A396 The Structural Basis For The Reduced Activity Of Th 6e-22
1asf_A396 The Structural Basis For The Reduced Activity Of Th 6e-22
3aat_A396 Activity And Structure Of The Active-Site Mutants R 6e-22
1g4v_A396 Aspartate Aminotransferase Active Site Mutant N194a 6e-22
1asl_A396 Crystal Structures Of Escherichia Coli Aspartate Am 6e-22
1qis_A396 Aspartate Aminotransferase From Escherichia Coli, C 6e-22
1qir_A396 Aspartate Aminotransferase From Escherichia Coli, C 6e-22
1arh_A396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 6e-22
1qit_A396 Aspartate Aminotransferase From Escherichia Coli, C 6e-22
2d61_A396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 7e-22
2d66_A396 Aspartate Aminotransferase Mutant Mab Length = 396 7e-22
4f5i_A406 Substrate Specificity Conversion Of E. Coli Pyridox 1e-21
1bqd_A396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 2e-21
1bqa_A396 Aspartate Aminotransferase P195a Mutant Length = 39 2e-21
2q7w_A396 Structural Studies Reveals The Inactivation Of E. C 2e-21
2aat_A396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 2e-21
4f5m_A406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 2e-21
4f5j_A406 Rational Design And Directed Evolution For Conversi 2e-21
1aia_A396 Structural Basis For The Catalytic Activity Of Aspa 2e-21
4f5f_A406 Structure Of Aspartate Aminotransferase Conversion 2e-21
4f5h_A406 Intercoversion Of Substrate Specificity: E. Coli As 2e-21
3zzj_A396 Structure Of An Engineered Aspartate Aminotransfera 4e-21
1aam_A396 The Structural Basis For The Altered Substrate Spec 4e-21
1toe_A396 Unliganded Structure Of Hexamutant + A293d Mutant O 4e-21
1yoo_A396 Aspartate Aminotransferase Mutant Atb17 With Isoval 4e-21
1g7x_A396 Aspartate Aminotransferase Active Site Mutant N194a 4e-21
1toj_A396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 4e-21
1czc_A396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 4e-21
1g4x_A396 Aspartate Aminotransferase Active Site Mutant N194a 4e-21
2d5y_A396 Aspartate Aminotransferase Mutant Mc With Isovaleri 7e-21
4f5g_A406 Rational Design And Directed Evolution Of E. Coli A 8e-21
2d64_A396 Aspartate Aminotransferase Mutant Mabc With Isovale 8e-21
4f5k_A406 Substrate Specificity Conversion Of Aspartate Amino 1e-20
1tog_A396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 2e-20
1yaa_A412 Aspartate Aminotransferase From Saccharomyces Cerev 6e-20
4h51_A420 Crystal Structure Of A Putative Aspartate Aminotran 1e-18
3uak_A406 Crystal Structure Of De Novo Designed Cysteine Este 7e-16
3meb_A448 Structure Of Cytoplasmic Aspartate Aminotransferase 6e-14
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 2e-12
3k7y_A405 Aspartate Aminotransferase Of Plasmodium Falciparum 7e-10
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure 
Iteration: 1

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/121 (61%), Positives = 88/121 (72%), Gaps = 6/121 (4%)
Query: 3   KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
           KN G++      GERVGAF++V  D +EA R+ SQLKILIR  YS+PP++GARI   IL 
Sbjct: 250 KNMGLY------GERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILT 303
Query: 63  DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
            P L+ QWL EVKGMADRIISMR  L  NL+KEGS+  W HITDQIGMFC+TGL   QV 
Sbjct: 304 SPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVE 363
Query: 123 R 123
           R
Sbjct: 364 R 364
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 Back     alignment and structure
>pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 Back     alignment and structure
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 5e-64
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 8e-64
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 9e-64
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 9e-64
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 1e-63
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 3e-63
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 6e-63
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 1e-61
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 6e-61
3rq1_A418 Aminotransferase class I and II; structural genomi 2e-57
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-57
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 3e-54
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 3e-40
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
 Score =  199 bits (508), Expect = 5e-64
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 6/121 (4%)

Query: 3   KNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILG 62
           KN+GI+       ER G    + AD          +  L R  YS PP HGA+IV  +L 
Sbjct: 243 KNFGIY------RERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLT 296

Query: 63  DPKLKSQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVR 122
            P+L++ W+ E++ +   ++ +R+ L   L+    +  +  + +  GMF   G    QV+
Sbjct: 297 TPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVK 356

Query: 123 R 123
           R
Sbjct: 357 R 357
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.92
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.89
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.84
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.82
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.81
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.75
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.63
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.62
3rq1_A418 Aminotransferase class I and II; structural genomi 99.61
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.61
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.6
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.52
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.39
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.3
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.25
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.19
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 98.97
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 98.83
3nra_A407 Aspartate aminotransferase; structural genomics, j 98.82
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.78
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.72
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 98.72
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 98.71
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 98.67
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 98.66
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 98.59
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 98.55
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 98.54
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 98.51
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 98.5
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 98.5
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 98.48
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 98.47
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 98.46
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 98.45
3ele_A398 Amino transferase; RER070207001803, structural gen 98.44
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.42
1xi9_A406 Putative transaminase; alanine aminotransferase, s 98.41
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 98.41
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 98.41
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 98.4
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.39
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 98.38
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 98.37
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 98.37
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 98.35
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 98.33
2z61_A370 Probable aspartate aminotransferase 2; amino acid 98.33
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 98.33
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 98.31
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 98.3
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 98.29
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 98.28
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 98.28
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 98.28
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 98.27
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.26
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 98.26
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 98.26
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 98.23
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 98.23
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 98.22
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 98.14
3l8a_A421 METC, putative aminotransferase, probable beta-cys 98.14
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 98.14
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 98.13
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 98.11
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 98.08
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 98.06
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 98.01
3aow_A448 Putative uncharacterized protein PH0207; protein-P 98.0
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 97.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 97.95
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 97.94
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 97.89
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 96.94
1vp4_A425 Aminotransferase, putative; structural genomics, j 97.74
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 97.58
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 97.55
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 97.32
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 97.27
1iug_A352 Putative aspartate aminotransferase; wild type, py 97.09
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 97.02
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 97.01
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 96.99
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 96.95
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 96.91
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 96.81
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 96.8
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 96.6
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 96.54
2yrr_A353 Aminotransferase, class V; structural genomics, NP 96.42
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 96.41
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 96.4
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 96.36
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 96.25
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 96.24
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 96.21
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 96.11
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 96.05
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 96.03
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 96.01
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 96.0
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 95.89
3f0h_A376 Aminotransferase; RER070207000802, structural geno 95.84
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 95.67
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 95.56
1svv_A359 Threonine aldolase; structural genomics, structura 95.49
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 95.44
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 95.31
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 95.27
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 95.1
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 95.07
3ruy_A392 Ornithine aminotransferase; structural genomics, c 94.79
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 94.77
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 94.68
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 94.67
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 94.61
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 94.52
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 94.31
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 94.26
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 94.21
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 94.17
4adb_A406 Succinylornithine transaminase; transferase, PLP e 94.12
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 94.11
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 93.97
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 93.83
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 93.72
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 93.62
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 93.57
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 93.55
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 93.34
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 93.28
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 93.17
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 93.14
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 93.04
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 92.67
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 92.57
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 92.49
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 92.2
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 92.12
3pj0_A359 LMO0305 protein; structural genomics, joint center 91.69
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 91.63
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 91.52
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 91.2
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 91.14
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 90.94
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 90.7
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 90.58
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 90.47
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 90.39
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 90.3
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 88.39
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 88.17
3hmu_A472 Aminotransferase, class III; structural genomics, 87.97
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 87.35
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 87.0
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 86.99
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 86.49
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 86.19
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 86.15
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 85.55
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 84.26
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 84.64
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 84.11
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 84.11
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 83.73
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 83.3
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 83.0
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 82.92
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 82.91
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 82.71
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 81.87
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 80.61
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
Probab=100.00  E-value=7.7e-37  Score=260.69  Aligned_cols=133  Identities=33%  Similarity=0.624  Sum_probs=129.9

Q ss_pred             CCcccccccCCCCcccccceeEEEeCCHHHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHHHHH
Q psy16706          1 QKKNYGIHFTCLPVGERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGMADR   80 (142)
Q Consensus         1 ~SKnfgL~~~~~~YgeRvGal~vv~~~~~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m~~r   80 (142)
                      .||+|||      ||+|+|++++++++.+.+.++.++++.++|++||+||.+|+++++.+|+||+++++|++|++.|++|
T Consensus       263 ~SK~~~~------~G~RvG~~~~~~~~~~~~~~~~~~l~~~~r~~~s~~p~~~a~~~~~~l~d~~l~~~~~~~~~~m~~r  336 (420)
T 4h51_A          263 FSKNMGL------YSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAER  336 (420)
T ss_dssp             CTTTSCC------GGGCEEEEEEECSCHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHH
T ss_pred             ccccccc------ccCceEEEEecccCHHHHHHHHHHHHHhhhcccCcchHHHHHHHHHHhcCHHHHHHHHHHHHHHHHH
Confidence            4999999      9999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccC
Q psy16706         81 IISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQ  141 (142)
Q Consensus        81 i~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~  141 (142)
                      ++.+|+.|.++|++.|++++|+||+.|.|||+++||+++||+. | +++|||++++||||+
T Consensus       337 ~~~~R~~l~~~L~~~g~~~~~~~i~~q~GmF~~~gls~e~v~~-L-~e~~Vy~~~~gRis~  395 (420)
T 4h51_A          337 IRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEY-C-QNHNIFITVSGRANM  395 (420)
T ss_dssp             HHHHHHHHHHHHHHTTCSSCCTHHHHCCSSEEECCCCHHHHHH-H-HHTTEECCTTCEEEG
T ss_pred             HHHHHHHHHHHHHHhCCCCCCCeecCCCceEEecCcCHHHHHH-H-HhCCEEEcCCCEEEe
Confidence            9999999999999999999999999999999999999999987 8 689999999999986
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 4e-22
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 1e-20
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 2e-20
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 3e-20
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 4e-20
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 1e-19
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Pig (Sus scrofa), cytosolic form [TaxId: 9823]

 Score = 88.1 bits (217), Expect = 4e-22
 Identities = 53/111 (47%), Positives = 72/111 (64%)

Query: 15  GERVGAFSIVSADKDEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEV 74
            ERVG  ++V+ + D   R+LSQ++ ++R  +S+PP  GARIV   L DP+L  +W   V
Sbjct: 264 NERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNV 323

Query: 75  KGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKL 125
           K MADRI+SMR  L+  L+   +   WNHITDQIGMF +TGLN  QV   +
Sbjct: 324 KTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLI 374
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.94
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.94
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.94
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.93
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.93
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.92
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 98.83
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.8
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 98.78
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.77
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 98.67
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 98.65
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 98.55
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 98.5
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 98.48
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 98.47
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 98.37
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 98.12
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 98.09
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 98.08
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 98.03
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 98.01
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 98.01
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 98.0
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 97.99
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 97.97
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 96.61
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 87.15
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 83.48
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]

Probab=99.94  E-value=2.6e-27  Score=196.38  Aligned_cols=133  Identities=38%  Similarity=0.657  Sum_probs=125.4

Q ss_pred             CcccccccCCCCcccccceeEEEeCCH----HHHHHHHHHHHHHHHhhcCCCCchHHHHHHHHhCChhhHHHHHHHHHHH
Q psy16706          2 KKNYGIHFTCLPVGERVGAFSIVSADK----DEAARILSQLKILIRAFYSSPPIHGARIVQEILGDPKLKSQWLTEVKGM   77 (142)
Q Consensus         2 SKnfgL~~~~~~YgeRvGal~vv~~~~----~~~~~v~sql~~~~R~~~S~pp~~Ga~iv~~IL~dp~L~~~W~~El~~m   77 (142)
                      ||+||+      ||.|+|.+++..+..    +..+.+.+++...+|++|++||.+++.++..++.|+.++++|.++++.|
T Consensus       253 SK~~~~------~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~l~~~~~~~~~~~~~~~~  326 (412)
T d1yaaa_         253 AKNAGM------YGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTM  326 (412)
T ss_dssp             TTTSCC------GGGCEEEEEEECCSCTTHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHHSHHHHHHHHHHHHHH
T ss_pred             CCcccc------CcCceEEEEEchhhhhhHHHHHHHHHHHHHHHHHHHhcCCChHHHHHHHHHhcChHHHHHHHHHHHHH
Confidence            899999      999999999987653    4556677888889999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHhcCCCCCCccccccccceeecCCCHHHHHHHhhhccceeeeCCCcccC
Q psy16706         78 ADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVRRKLIHDRSLKLSNVEKCSQ  141 (142)
Q Consensus        78 ~~ri~~~R~~L~~~l~~~~~~~~w~~i~~q~GmF~~~gl~~~qv~~~L~~~~~Iyl~~~Gri~~  141 (142)
                      +++++++|..|.+.|++++.+++|++++.|.|||+++|++++++++ |+++++||+++++|||.
T Consensus       327 ~~~~~~~r~~l~~~L~~~g~~~~~~~~~~~gG~F~~~~ls~e~~~~-L~~e~~V~~~~g~Ris~  389 (412)
T d1yaaa_         327 SSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKR-LEETHAVYLVASGRASI  389 (412)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCSSCCTHHHHCCSSEEECCCCHHHHHH-HHHHHCEECCTTSEEEG
T ss_pred             HHHHHHHHHHHHHHHHHhCCCCCCceeCCCceEEEecCcCHHHHHH-HHHhCCEEECCCCEEEe
Confidence            9999999999999999999999999999999999999999999998 99999999999999985
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure