Psyllid ID: psy16707


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
ccHHHHHHHHHHHcccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEccccHHHHHHHHHcccEEEEccccEEEcccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccEEEcccccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccHHHccccEEEEEcccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEccccccccHHHHHccccEEEEccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccHHHHHHHHHcccEEEEccccEEEcccccccHHHHHHHHHHHHc
cHHHHHHHHHHHcccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEccccHHHHHHHHHHHcEEcccccEEEHHHccccHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHccccccccEEccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHccccHHHHcccEEEEEEcHHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHccccEEEccccHHHHHHHHHHHcEEcccccEEEHHHcccccHHHHHHHHHHHHc
MLFHNAKKILIRAfyssppihgARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNlqkegsnkpwnhitdqIGMFCYTGLNATQVEKLIKEHSVYltkdgrismagvtsKNVGYLAKAIhangslpirfqdartssvkvpssnllteafkkdtnvnkinlgvgayrddqgkpyvlpsvkqaDEIVLNknldkeyapiigapdfGKLAAQLaygedcpqlKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLknffpgekviyvptptwgnhipickhtgLEKILIRAfyssppihgARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNlqkegsnkpwnhitdqIGMFCYTGLNATQVEKLIKEHSVYltkdgrismagvtsKNVGYLAKAIHAVTK
MLFHNAKKILIRafyssppiHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDArtssvkvpssnllteafkkdtnvnkinlgvgayrddqgkpyVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLtkdgrismagvtsknVGYLAKAIHAVTK
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
***HNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIIS****************PWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQD************LLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISM***************PWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHA***
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFHNAKKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHANGSLPIRFQDARTSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYGEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query420 2.2.26 [Sep-21-2011]
P00507430 Aspartate aminotransferas yes N/A 0.242 0.237 0.713 1e-44
P05202430 Aspartate aminotransferas yes N/A 0.242 0.237 0.713 1e-44
Q5REB0430 Aspartate aminotransferas yes N/A 0.242 0.237 0.704 2e-44
P08907401 Aspartate aminotransferas yes N/A 0.242 0.254 0.696 5e-44
P00508423 Aspartate aminotransferas yes N/A 0.242 0.241 0.688 7e-44
P12344430 Aspartate aminotransferas yes N/A 0.238 0.232 0.704 9e-44
P00506430 Aspartate aminotransferas yes N/A 0.242 0.237 0.688 1e-43
Q4R559430 Aspartate aminotransferas N/A N/A 0.242 0.237 0.696 1e-43
P00505430 Aspartate aminotransferas yes N/A 0.242 0.237 0.696 2e-43
Q28F67427 Aspartate aminotransferas yes N/A 0.242 0.238 0.680 1e-42
>sp|P00507|AATM_RAT Aspartate aminotransferase, mitochondrial OS=Rattus norvegicus GN=Got2 PE=1 SV=2 Back     alignment and function desciption
 Score =  180 bits (457), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 97/122 (79%)

Query: 299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358
           KILIR  YS+PP++GARI   IL  P L+ QWL EVKGMADRIISMR  L  NL+KEGS+
Sbjct: 309 KILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSS 368

Query: 359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418
             W HITDQIGMFC+TGL   QVE+L KE SVY+TKDGRIS+AGVTS NVGYLA AIH V
Sbjct: 369 HNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQV 428

Query: 419 TK 420
           TK
Sbjct: 429 TK 430




Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|P05202|AATM_MOUSE Aspartate aminotransferase, mitochondrial OS=Mus musculus GN=Got2 PE=1 SV=1 Back     alignment and function description
>sp|Q5REB0|AATM_PONAB Aspartate aminotransferase, mitochondrial OS=Pongo abelii GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|P08907|AATM_HORSE Aspartate aminotransferase, mitochondrial OS=Equus caballus GN=GOT2 PE=1 SV=1 Back     alignment and function description
>sp|P00508|AATM_CHICK Aspartate aminotransferase, mitochondrial OS=Gallus gallus GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P12344|AATM_BOVIN Aspartate aminotransferase, mitochondrial OS=Bos taurus GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|P00506|AATM_PIG Aspartate aminotransferase, mitochondrial OS=Sus scrofa GN=GOT2 PE=1 SV=2 Back     alignment and function description
>sp|Q4R559|AATM_MACFA Aspartate aminotransferase, mitochondrial OS=Macaca fascicularis GN=GOT2 PE=2 SV=1 Back     alignment and function description
>sp|P00505|AATM_HUMAN Aspartate aminotransferase, mitochondrial OS=Homo sapiens GN=GOT2 PE=1 SV=3 Back     alignment and function description
>sp|Q28F67|AATM_XENTR Aspartate aminotransferase, mitochondrial OS=Xenopus tropicalis GN=got2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
91084123423 PREDICTED: similar to aspartate aminotra 0.242 0.241 0.770 3e-48
332372484424 unknown [Dendroctonus ponderosae] 0.242 0.240 0.729 1e-46
332025582430 Aspartate aminotransferase, mitochondria 0.242 0.237 0.729 5e-46
322800334430 hypothetical protein SINV_02306 [Solenop 0.242 0.237 0.729 5e-46
201023323424 aspartate aminotransferase 2 [Acyrthosip 0.226 0.224 0.743 9e-46
383861654432 PREDICTED: aspartate aminotransferase, m 0.242 0.236 0.713 1e-45
156401599405 predicted protein [Nematostella vectensi 0.235 0.244 0.729 1e-45
118790651430 AGAP009685-PA [Anopheles gambiae str. PE 0.228 0.223 0.729 2e-45
443728302430 hypothetical protein CAPTEDRAFT_158431 [ 0.242 0.237 0.729 3e-45
198431669391 PREDICTED: similar to glutamate oxaloace 0.238 0.255 0.729 1e-44
>gi|91084123|ref|XP_967224.1| PREDICTED: similar to aspartate aminotransferase [Tribolium castaneum] gi|270006661|gb|EFA03109.1| hypothetical protein TcasGA2_TC013019 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  198 bits (504), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%)

Query: 299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358
           KILIRA YS+PPI+GARIV EIL DP L+A WL EVKGMADRIIS+R  L+DNL+KEGS 
Sbjct: 302 KILIRALYSNPPINGARIVAEILTDPALRADWLKEVKGMADRIISVRTKLRDNLKKEGST 361

Query: 359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418
           K W HITDQIGMFCYTG+   QVEK+ KEHSV+LTKDGRISMAGVTSKNV YLA A+H V
Sbjct: 362 KNWQHITDQIGMFCYTGMTPDQVEKITKEHSVFLTKDGRISMAGVTSKNVEYLAHAMHTV 421

Query: 419 TK 420
           TK
Sbjct: 422 TK 423




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332372484|gb|AEE61384.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|332025582|gb|EGI65745.1| Aspartate aminotransferase, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322800334|gb|EFZ21338.1| hypothetical protein SINV_02306 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|201023323|ref|NP_001128403.1| aspartate aminotransferase 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383861654|ref|XP_003706300.1| PREDICTED: aspartate aminotransferase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156401599|ref|XP_001639378.1| predicted protein [Nematostella vectensis] gi|156226506|gb|EDO47315.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|118790651|ref|XP_318743.3| AGAP009685-PA [Anopheles gambiae str. PEST] gi|116118048|gb|EAA14551.4| AGAP009685-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|443728302|gb|ELU14716.1| hypothetical protein CAPTEDRAFT_158431 [Capitella teleta] Back     alignment and taxonomy information
>gi|198431669|ref|XP_002126128.1| PREDICTED: similar to glutamate oxaloacetate transaminase 2 isoform 2 [Ciona intestinalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query420
ZFIN|ZDB-GENE-030131-7917428 got2b "glutamic-oxaloacetic tr 0.290 0.285 0.672 9.5e-84
WB|WBGene00015778414 got-2.2 [Caenorhabditis elegan 0.290 0.294 0.704 2.3e-74
RGD|2722430 Got2 "glutamic-oxaloacetic tra 0.290 0.283 0.713 2.9e-72
UNIPROTKB|Q5REB0430 GOT2 "Aspartate aminotransfera 0.290 0.283 0.704 9.7e-72
MGI|MGI:95792430 Got2 "glutamate oxaloacetate t 0.290 0.283 0.713 2e-71
UNIPROTKB|Q4R559430 GOT2 "Aspartate aminotransfera 0.290 0.283 0.696 5.3e-71
UNIPROTKB|P12344430 GOT2 "Aspartate aminotransfera 0.290 0.283 0.704 8.6e-71
UNIPROTKB|P00505430 GOT2 "Aspartate aminotransfera 0.290 0.283 0.696 8.6e-71
UNIPROTKB|P08907401 GOT2 "Aspartate aminotransfera 0.290 0.304 0.696 1.1e-70
UNIPROTKB|P00506430 GOT2 "Aspartate aminotransfera 0.290 0.283 0.688 2.9e-70
ZFIN|ZDB-GENE-030131-7917 got2b "glutamic-oxaloacetic transaminase 2b, mitochondrial (aspartate aminotransferase 2)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 421 (153.3 bits), Expect = 9.5e-84, Sum P(3) = 9.5e-84
 Identities = 82/122 (67%), Positives = 96/122 (78%)

Query:   299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358
             KILIR  YS+PP++GARI   IL  P+L++ WL EVKGMADRII MR+ L  NL+KEGS 
Sbjct:   307 KILIRPIYSNPPMNGARIASTILTTPELRSTWLEEVKGMADRIIRMREMLVTNLKKEGST 366

Query:   359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418
               W H+TDQIGMFC+TGL   QVE+L K+ SVY+TKDGRIS+AGVTS NV YLA AIH V
Sbjct:   367 HNWQHVTDQIGMFCFTGLKPEQVERLTKDFSVYMTKDGRISVAGVTSGNVEYLAHAIHQV 426

Query:   419 TK 420
             TK
Sbjct:   427 TK 428


GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA
GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
WB|WBGene00015778 got-2.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|2722 Got2 "glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5REB0 GOT2 "Aspartate aminotransferase, mitochondrial" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:95792 Got2 "glutamate oxaloacetate transaminase 2, mitochondrial" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R559 GOT2 "Aspartate aminotransferase, mitochondrial" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P12344 GOT2 "Aspartate aminotransferase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P00505 GOT2 "Aspartate aminotransferase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P08907 GOT2 "Aspartate aminotransferase, mitochondrial" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|P00506 GOT2 "Aspartate aminotransferase, mitochondrial" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.6.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
PLN02397423 PLN02397, PLN02397, aspartate transaminase 9e-71
PLN02397423 PLN02397, PLN02397, aspartate transaminase 8e-69
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 1e-61
PTZ00376404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 1e-59
PLN02397 423 PLN02397, PLN02397, aspartate transaminase 5e-54
PTZ00376 404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 3e-52
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 3e-51
PRK09257396 PRK09257, PRK09257, aromatic amino acid aminotrans 3e-50
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 1e-48
COG1448396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 7e-48
COG1448 396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 3e-42
PRK09257 396 PRK09257, PRK09257, aromatic amino acid aminotrans 4e-37
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 9e-22
pfam00155357 pfam00155, Aminotran_1_2, Aminotransferase class I 9e-22
pfam00155 357 pfam00155, Aminotran_1_2, Aminotransferase class I 5e-16
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 3e-08
cd00609350 cd00609, AAT_like, Aspartate aminotransferase fami 3e-08
cd00609 350 cd00609, AAT_like, Aspartate aminotransferase fami 1e-06
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
 Score =  228 bits (584), Expect = 9e-71
 Identities = 76/122 (62%), Positives = 95/122 (77%)

Query: 299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358
           K++ R  YS+PPIHGA IV  ILGDP+L ++W  E+KGMADRIISMRQ L D L+  GS 
Sbjct: 299 KLIARPMYSNPPIHGASIVATILGDPELFSEWTKELKGMADRIISMRQKLYDALEARGSP 358

Query: 359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418
             W+HIT QIGMF +TGLN  QV+++ KE+ +Y+T+DGRISMAG++SKNV YLA AIHAV
Sbjct: 359 GDWSHITKQIGMFSFTGLNKEQVDRMTKEYHIYMTRDGRISMAGLSSKNVPYLADAIHAV 418

Query: 419 TK 420
             
Sbjct: 419 VT 420


Length = 423

>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 420
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
KOG1411|consensus427 100.0
KOG1412|consensus410 100.0
KOG1412|consensus410 100.0
KOG1411|consensus427 100.0
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 100.0
PLN02397423 aspartate transaminase 100.0
PRK09257396 aromatic amino acid aminotransferase; Provisional 100.0
PTZ00376404 aspartate aminotransferase; Provisional 100.0
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.92
PRK08637388 hypothetical protein; Provisional 99.85
PLN00175413 aminotransferase family protein; Provisional 99.84
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.83
PRK07366388 succinyldiaminopimelate transaminase; Validated 99.81
PTZ00377481 alanine aminotransferase; Provisional 99.8
PRK06108382 aspartate aminotransferase; Provisional 99.8
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 99.79
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 99.79
PRK09148405 aminotransferase; Validated 99.79
PRK06855433 aminotransferase; Validated 99.78
PRK07681399 aspartate aminotransferase; Provisional 99.78
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 99.78
PRK08960387 hypothetical protein; Provisional 99.78
PLN02656409 tyrosine transaminase 99.78
PRK07550386 hypothetical protein; Provisional 99.78
PRK07337388 aminotransferase; Validated 99.77
PRK13355517 bifunctional HTH-domain containing protein/aminotr 99.77
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 99.77
PRK08068389 transaminase; Reviewed 99.77
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 99.77
PRK08636403 aspartate aminotransferase; Provisional 99.77
PRK06107402 aspartate aminotransferase; Provisional 99.76
PRK07682378 hypothetical protein; Validated 99.76
PRK07683387 aminotransferase A; Validated 99.76
PRK07309391 aromatic amino acid aminotransferase; Validated 99.76
PRK09082386 methionine aminotransferase; Validated 99.76
PRK06348384 aspartate aminotransferase; Provisional 99.75
PRK05957389 aspartate aminotransferase; Provisional 99.75
PRK05942394 aspartate aminotransferase; Provisional 99.75
PRK08912387 hypothetical protein; Provisional 99.75
PLN02231534 alanine transaminase 99.75
PLN02187462 rooty/superroot1 99.74
PRK08361391 aspartate aminotransferase; Provisional 99.74
PRK05764393 aspartate aminotransferase; Provisional 99.74
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.74
PTZ00433412 tyrosine aminotransferase; Provisional 99.74
PRK15481431 transcriptional regulatory protein PtsJ; Provision 99.73
PRK06290410 aspartate aminotransferase; Provisional 99.73
PRK08175395 aminotransferase; Validated 99.72
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 99.72
PRK07324373 transaminase; Validated 99.72
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 99.71
PRK07777387 aminotransferase; Validated 99.7
PRK09147396 succinyldiaminopimelate transaminase; Provisional 99.7
PRK09265404 aminotransferase AlaT; Validated 99.7
PRK07568397 aspartate aminotransferase; Provisional 99.7
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.7
PRK06207405 aspartate aminotransferase; Provisional 99.7
PRK09275 527 aspartate aminotransferase; Provisional 99.7
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 99.69
PRK12414384 putative aminotransferase; Provisional 99.69
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 99.69
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.69
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 99.69
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.68
PRK08363398 alanine aminotransferase; Validated 99.68
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 99.68
KOG0257|consensus 420 99.67
PRK09440416 avtA valine--pyruvate transaminase; Provisional 99.66
PLN02397423 aspartate transaminase 99.66
PRK05839374 hypothetical protein; Provisional 99.66
PLN02368407 alanine transaminase 99.62
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 99.62
PRK03317368 histidinol-phosphate aminotransferase; Provisional 99.6
PRK06836394 aspartate aminotransferase; Provisional 99.6
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.58
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.55
PRK09105370 putative aminotransferase; Provisional 99.55
PRK04870356 histidinol-phosphate aminotransferase; Provisional 99.55
PRK14809357 histidinol-phosphate aminotransferase; Provisional 99.54
PRK07392360 threonine-phosphate decarboxylase; Validated 99.53
PRK01533366 histidinol-phosphate aminotransferase; Validated 99.52
PRK03158359 histidinol-phosphate aminotransferase; Provisional 99.52
PRK07908349 hypothetical protein; Provisional 99.51
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.49
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.46
PTZ00376404 aspartate aminotransferase; Provisional 99.46
PRK02610374 histidinol-phosphate aminotransferase; Provisional 99.46
PRK09257396 aromatic amino acid aminotransferase; Provisional 99.45
PRK08153369 histidinol-phosphate aminotransferase; Provisional 99.45
PRK14808335 histidinol-phosphate aminotransferase; Provisional 99.45
PRK14807351 histidinol-phosphate aminotransferase; Provisional 99.43
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.43
PRK05166371 histidinol-phosphate aminotransferase; Provisional 99.42
KOG0256|consensus471 99.42
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 99.41
PRK06225380 aspartate aminotransferase; Provisional 99.4
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.39
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.39
PLN026721082 methionine S-methyltransferase 99.38
KOG0259|consensus447 99.38
PRK03967337 histidinol-phosphate aminotransferase; Provisional 99.36
PRK03321352 putative aminotransferase; Provisional 99.35
PRK00950361 histidinol-phosphate aminotransferase; Validated 99.34
PRK06358354 threonine-phosphate decarboxylase; Provisional 99.31
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 99.29
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.23
PRK04635354 histidinol-phosphate aminotransferase; Provisional 99.2
PRK05664330 threonine-phosphate decarboxylase; Reviewed 99.17
KOG0634|consensus472 99.14
PRK04781364 histidinol-phosphate aminotransferase; Provisional 99.1
PRK06959339 putative threonine-phosphate decarboxylase; Provis 99.06
PRK08354311 putative aminotransferase; Provisional 99.04
PRK06425332 histidinol-phosphate aminotransferase; Validated 99.0
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 98.97
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 98.95
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 98.93
PRK01688351 histidinol-phosphate aminotransferase; Provisional 98.93
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 98.91
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 98.89
PLN02994153 1-aminocyclopropane-1-carboxylate synthase 98.77
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.69
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 98.64
PLN02721353 threonine aldolase 98.58
PLN02822481 serine palmitoyltransferase 98.5
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 98.49
PRK10534333 L-threonine aldolase; Provisional 98.48
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 98.43
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 98.39
PLN02483 489 serine palmitoyltransferase 98.39
KOG0258|consensus475 98.38
PRK10874 401 cysteine sulfinate desulfinase; Provisional 98.36
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 98.36
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 98.36
TIGR00707379 argD acetylornithine and succinylornithine aminotr 98.34
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 98.29
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 98.27
cd06454349 KBL_like KBL_like; this family belongs to the pyri 98.25
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 98.23
PRK00451447 glycine dehydrogenase subunit 1; Validated 98.18
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 98.18
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 98.15
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 98.08
PRK02948381 cysteine desulfurase; Provisional 98.06
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 98.04
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 98.03
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 98.0
PRK13392410 5-aminolevulinate synthase; Provisional 98.0
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 97.98
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 97.96
PRK02627396 acetylornithine aminotransferase; Provisional 97.96
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 97.91
PRK08637388 hypothetical protein; Provisional 97.81
PRK13520371 L-tyrosine decarboxylase; Provisional 97.79
PRK01278389 argD acetylornithine transaminase protein; Provisi 97.76
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 97.76
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 97.73
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 97.7
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 97.67
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 97.64
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 97.63
PRK03244398 argD acetylornithine aminotransferase; Provisional 97.56
PLN02409401 serine--glyoxylate aminotransaminase 97.55
PRK07179407 hypothetical protein; Provisional 97.53
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 97.53
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 97.52
cd00609350 AAT_like Aspartate aminotransferase family. This f 97.51
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 97.48
PRK02936377 argD acetylornithine aminotransferase; Provisional 97.47
PF12897 425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 97.45
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 97.44
PRK04366 481 glycine dehydrogenase subunit 2; Validated 97.3
PRK06108382 aspartate aminotransferase; Provisional 97.29
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 97.26
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 97.26
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 97.2
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 97.16
PRK04260375 acetylornithine aminotransferase; Provisional 97.13
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 97.13
PRK09064407 5-aminolevulinate synthase; Validated 97.08
PRK14012 404 cysteine desulfurase; Provisional 97.08
PRK13393406 5-aminolevulinate synthase; Provisional 97.07
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 96.92
PRK07550386 hypothetical protein; Provisional 96.9
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 96.85
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 96.85
PRK15481431 transcriptional regulatory protein PtsJ; Provision 96.79
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 96.75
PRK05957389 aspartate aminotransferase; Provisional 96.72
PRK12381406 bifunctional succinylornithine transaminase/acetyl 96.72
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 96.67
PRK13034416 serine hydroxymethyltransferase; Reviewed 96.65
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 96.49
PLN02271586 serine hydroxymethyltransferase 96.44
PRK08088425 4-aminobutyrate aminotransferase; Validated 96.32
PLN02242 418 methionine gamma-lyase 96.27
PRK08247 366 cystathionine gamma-synthase; Reviewed 96.25
PF00266 371 Aminotran_5: Aminotransferase class-V; InterPro: I 96.19
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 96.17
PRK06234 400 methionine gamma-lyase; Provisional 96.08
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 96.06
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 96.04
PRK05764393 aspartate aminotransferase; Provisional 96.0
PRK07681399 aspartate aminotransferase; Provisional 95.98
PRK07582 366 cystathionine gamma-lyase; Validated 95.92
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 95.91
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 95.88
PLN02651 364 cysteine desulfurase 95.82
PTZ00377481 alanine aminotransferase; Provisional 95.77
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 95.69
PRK09105370 putative aminotransferase; Provisional 95.67
PRK07682378 hypothetical protein; Validated 95.63
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 95.51
PRK08068389 transaminase; Reviewed 95.36
PLN03226475 serine hydroxymethyltransferase; Provisional 95.26
PRK09148405 aminotransferase; Validated 95.14
PRK09440416 avtA valine--pyruvate transaminase; Provisional 95.09
PTZ00433412 tyrosine aminotransferase; Provisional 95.06
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 94.88
PLN02231534 alanine transaminase 94.83
PLN00144382 acetylornithine transaminase 94.57
PRK13580493 serine hydroxymethyltransferase; Provisional 94.51
PRK07324373 transaminase; Validated 94.48
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 94.45
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 94.44
PRK09028 394 cystathionine beta-lyase; Provisional 94.32
PRK08175395 aminotransferase; Validated 94.28
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 94.25
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 94.13
PRK07050 394 cystathionine beta-lyase; Provisional 94.05
PRK09082386 methionine aminotransferase; Validated 93.98
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 93.95
PRK06855433 aminotransferase; Validated 93.92
PRK08636403 aspartate aminotransferase; Provisional 93.8
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 93.74
PRK08153369 histidinol-phosphate aminotransferase; Provisional 93.7
PTZ00125400 ornithine aminotransferase-like protein; Provision 93.61
PRK05387353 histidinol-phosphate aminotransferase; Provisional 93.49
PRK07777387 aminotransferase; Validated 93.44
PTZ00094452 serine hydroxymethyltransferase; Provisional 93.34
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 93.23
PRK07366388 succinyldiaminopimelate transaminase; Validated 92.94
PRK04870356 histidinol-phosphate aminotransferase; Provisional 92.86
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 92.82
PRK08912387 hypothetical protein; Provisional 92.74
PRK05942394 aspartate aminotransferase; Provisional 92.74
PRK03317368 histidinol-phosphate aminotransferase; Provisional 92.68
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 92.67
PRK06348384 aspartate aminotransferase; Provisional 92.66
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 92.34
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 92.34
PRK06777421 4-aminobutyrate aminotransferase; Provisional 92.32
PRK07309391 aromatic amino acid aminotransferase; Validated 92.25
PRK09265404 aminotransferase AlaT; Validated 92.13
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 92.13
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 92.1
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 92.08
PLN02414 993 glycine dehydrogenase (decarboxylating) 92.04
PRK06290410 aspartate aminotransferase; Provisional 92.01
PRK06207405 aspartate aminotransferase; Provisional 91.97
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 91.96
PRK06107402 aspartate aminotransferase; Provisional 91.94
PRK05939 397 hypothetical protein; Provisional 91.84
PRK04635354 histidinol-phosphate aminotransferase; Provisional 91.82
PRK06836394 aspartate aminotransferase; Provisional 91.79
PRK07683387 aminotransferase A; Validated 91.69
PRK08363398 alanine aminotransferase; Validated 91.49
PRK07811 388 cystathionine gamma-synthase; Provisional 91.4
PRK05367 954 glycine dehydrogenase; Provisional 91.39
PRK08960387 hypothetical protein; Provisional 91.38
PRK07503 403 methionine gamma-lyase; Provisional 91.19
PLN00175413 aminotransferase family protein; Provisional 91.18
cd06454349 KBL_like KBL_like; this family belongs to the pyri 91.17
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 91.12
PRK05967 395 cystathionine beta-lyase; Provisional 91.12
PRK08361391 aspartate aminotransferase; Provisional 91.08
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 90.98
PRK05367 954 glycine dehydrogenase; Provisional 90.93
PRK06767 386 methionine gamma-lyase; Provisional 90.82
PRK07049 427 methionine gamma-lyase; Validated 90.81
PRK04260375 acetylornithine aminotransferase; Provisional 90.8
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 90.65
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 90.52
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 90.46
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 90.46
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 90.46
PRK02731367 histidinol-phosphate aminotransferase; Validated 90.42
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 90.23
PRK07337388 aminotransferase; Validated 90.22
COG0399 374 WecE Predicted pyridoxal phosphate-dependent enzym 90.22
TIGR01814406 kynureninase kynureninase. This model describes ky 90.06
PRK12414384 putative aminotransferase; Provisional 89.88
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 89.79
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 89.71
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 89.64
PLN03026380 histidinol-phosphate aminotransferase; Provisional 89.55
PRK08056356 threonine-phosphate decarboxylase; Provisional 89.54
PRK13392410 5-aminolevulinate synthase; Provisional 89.43
PRK07908349 hypothetical protein; Provisional 89.41
PRK08045 386 cystathionine gamma-synthase; Provisional 89.34
PRK02936377 argD acetylornithine aminotransferase; Provisional 89.33
PRK09064407 5-aminolevulinate synthase; Validated 89.29
PF00464 399 SHMT: Serine hydroxymethyltransferase; InterPro: I 89.29
PRK08574 385 cystathionine gamma-synthase; Provisional 89.21
PF01041 363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 89.19
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 89.07
TIGR00707379 argD acetylornithine and succinylornithine aminotr 89.04
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 89.04
PLN02656409 tyrosine transaminase 88.96
PRK10874401 cysteine sulfinate desulfinase; Provisional 88.94
PRK08249 398 cystathionine gamma-synthase; Provisional 88.92
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 88.84
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 88.83
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 88.81
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 88.5
PRK06959339 putative threonine-phosphate decarboxylase; Provis 88.43
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 88.35
PLN02509 464 cystathionine beta-lyase 88.27
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 88.16
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 88.14
KOG0633|consensus375 88.07
PRK00950361 histidinol-phosphate aminotransferase; Validated 87.88
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 87.69
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 87.64
PRK03158359 histidinol-phosphate aminotransferase; Provisional 87.6
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 87.47
PRK08776 405 cystathionine gamma-synthase; Provisional 87.34
PRK09147396 succinyldiaminopimelate transaminase; Provisional 87.21
PLN02624474 ornithine-delta-aminotransferase 87.02
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 86.92
PTZ00094452 serine hydroxymethyltransferase; Provisional 86.81
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 86.11
PRK14807351 histidinol-phosphate aminotransferase; Provisional 86.03
PLN02187462 rooty/superroot1 86.03
PRK04612408 argD acetylornithine transaminase protein; Provisi 85.85
PRK05968 389 hypothetical protein; Provisional 85.8
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 85.78
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 85.67
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 85.66
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 85.62
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 85.5
PLN02822481 serine palmitoyltransferase 85.49
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 85.46
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 85.43
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 85.42
PRK06058443 4-aminobutyrate aminotransferase; Provisional 85.41
PRK04311 464 selenocysteine synthase; Provisional 85.32
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 85.24
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 85.09
PRK13520371 L-tyrosine decarboxylase; Provisional 85.03
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 85.01
PRK03967337 histidinol-phosphate aminotransferase; Provisional 84.96
PRK03080378 phosphoserine aminotransferase; Provisional 84.81
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 84.53
TIGR01814406 kynureninase kynureninase. This model describes ky 84.48
PRK14809357 histidinol-phosphate aminotransferase; Provisional 84.42
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 84.4
PRK04781364 histidinol-phosphate aminotransferase; Provisional 84.37
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 84.34
PLN02721353 threonine aldolase 84.22
PRK05664330 threonine-phosphate decarboxylase; Reviewed 84.16
PLN026721082 methionine S-methyltransferase 84.05
PRK01688351 histidinol-phosphate aminotransferase; Provisional 83.9
PRK12381406 bifunctional succinylornithine transaminase/acetyl 83.79
PRK02948381 cysteine desulfurase; Provisional 83.71
PLN02452365 phosphoserine transaminase 83.65
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 83.62
PRK08117433 4-aminobutyrate aminotransferase; Provisional 83.61
PRK06460 376 hypothetical protein; Provisional 83.56
PRK13355517 bifunctional HTH-domain containing protein/aminotr 83.54
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 83.01
PLN02368407 alanine transaminase 82.94
PRK07568397 aspartate aminotransferase; Provisional 82.62
PLN00144382 acetylornithine transaminase 82.24
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 82.23
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 81.77
PRK05166371 histidinol-phosphate aminotransferase; Provisional 81.76
PRK08861 388 cystathionine gamma-synthase; Provisional 81.63
PRK03080378 phosphoserine aminotransferase; Provisional 81.55
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 81.48
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 81.07
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 81.02
PRK07671 377 cystathionine beta-lyase; Provisional 80.65
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 80.6
PRK01533366 histidinol-phosphate aminotransferase; Validated 80.54
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 80.49
PRK08064 390 cystathionine beta-lyase; Provisional 80.44
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 80.22
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 80.06
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=4.9e-68  Score=528.41  Aligned_cols=260  Identities=43%  Similarity=0.780  Sum_probs=254.3

Q ss_pred             ccccCCChHHHHHHHHHccCCCCceeecccccccCCCCCCchHHHHHHHHHHHccCCCCCCCCCCCCHHHHHHHHHHHcC
Q psy16707        139 TSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYG  218 (420)
Q Consensus       139 ~~~~~~d~i~~l~~~~~~d~~~~kInL~iG~y~d~dg~~~~~~~V~~a~~~~~~~~~~~~Y~p~~G~~~fr~a~~~~~~g  218 (420)
                      ++..+.|||++|.++|++|++++|||||||+|+|++|++|++++|++|++.+.+++.++.|+|+.|+++|++++++++||
T Consensus         5 i~~~p~DpIlgL~e~f~~D~R~~KVNLgIGvY~de~Gk~pvl~aV~~Ae~~l~~~~~~k~Yl~i~G~~~f~~~~~~llFG   84 (396)
T COG1448           5 IEAAPADPILGLKEAFKADPRPNKVNLGIGVYKDEDGKTPVLRAVKKAEKRLLEQEKTKNYLPIEGLPEFLEAVQKLLFG   84 (396)
T ss_pred             cccCCCCchhHHHHHHhcCCCcCeeeeeeeeeeCCCCCcchhHHHHHHHHHhhccccccccCCcCCcHHHHHHHHHHhcC
Confidence            67788999999999999999999999999999999999999999999999999888999999999999999999999999


Q ss_pred             CCCccccCCceeeecccCCCCccccccccccceeecccchHHHHHHHHHHHhcCCCCCEEEEcCCCCCCcHHHHhhcCcc
Q psy16707        219 EDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGLE  298 (420)
Q Consensus       219 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~vqt~gGtgal~~~~~~l~~~~p~gd~VlvpdP~w~ny~~i~~~aG~~  298 (420)
                      .+++.+.++||++                    +||+||||||++++.|++.+.| ..+||||||+||||..||+.+|++
T Consensus        85 ~d~~~l~~~Rv~t--------------------~Qt~GGTGAL~~~A~fl~~~~~-~~~vwis~PtW~NH~~If~~aGl~  143 (396)
T COG1448          85 ADSPALAEDRVAT--------------------VQTLGGTGALRVAADFLARFFP-DATVWISDPTWPNHKAIFEAAGLE  143 (396)
T ss_pred             CCcHHHHhhhHhh--------------------eecCCcchHHHHHHHHHHHhCC-CceEEeCCCCcHhHHHHHHhcCCc
Confidence            9999999999999                    9999999999999999999999 788999999999999999999997


Q ss_pred             --------------------------------------------------------------------------------
Q psy16707        299 --------------------------------------------------------------------------------  298 (420)
Q Consensus       299 --------------------------------------------------------------------------------  298 (420)
                                                                                                      
T Consensus       144 v~~Y~Yyd~~~~~~df~~mla~L~~a~~~~vvLLH~CcHNPTG~D~t~~qW~~l~~~~~~r~lip~~D~AYQGF~~Glee  223 (396)
T COG1448         144 VETYPYYDAETKGLDFDGMLADLKTAPEGSVVLLHGCCHNPTGIDPTEEQWQELADLIKERGLIPFFDIAYQGFADGLEE  223 (396)
T ss_pred             eeeeeccccccccccHHHHHHHHHhCCCCCEEEEecCCCCCCCCCCCHHHHHHHHHHHHHcCCeeeeehhhhhhccchHH
Confidence                                                                                            


Q ss_pred             ----------------------------------------------------hhhhhhccCCCchHHHHHHHHHhCChhh
Q psy16707        299 ----------------------------------------------------KILIRAFYSSPPIHGARIVQEILGDPKL  326 (420)
Q Consensus       299 ----------------------------------------------------~~~~r~~~s~pp~~ga~iv~~IL~dp~L  326 (420)
                                                                          +.++|++|||||.||+++|++||+||+|
T Consensus       224 Da~~lR~~a~~~~~~lva~S~SKnfgLYgERVGa~~vva~~~~~a~~v~sqlk~~iR~~ySnPP~~Ga~vva~IL~~p~L  303 (396)
T COG1448         224 DAYALRLFAEVGPELLVASSFSKNFGLYGERVGALSVVAEDAEEADRVLSQLKAIIRTNYSNPPAHGAAVVATILNNPEL  303 (396)
T ss_pred             HHHHHHHHHHhCCcEEEEehhhhhhhhhhhccceeEEEeCCHHHHHHHHHHHHHHHHhccCCCchhhHHHHHHHhCCHHH
Confidence                                                                7889999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcccCCCCceEEecCCCHHHHHHHHHhCCeEEeCCCcEEEcccCCC
Q psy16707        327 KAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSK  406 (420)
Q Consensus       327 ~~~w~~el~~m~~r~~~~R~~l~~~L~~~g~~~~w~~i~~q~GmF~~~~l~~~~v~~Ll~e~~Vy~~p~gRis~agl~~~  406 (420)
                      +++|++|++.|++||.+||..|++.|++.|.+.+|+|+..|.|||+|+|++++||++|++||+||++.+||||+||+|++
T Consensus       304 ra~W~~El~~Mr~Ri~~mR~~lv~~L~~~~~~~~f~~i~~Q~GMFsy~Gls~~QV~rLree~~IY~v~sGRi~vaGl~~~  383 (396)
T COG1448         304 RAEWEQELEEMRQRILEMRQALVDALKALGAPRNFDFIISQRGMFSYTGLSPEQVDRLREEFGIYLVASGRINVAGLNTS  383 (396)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCcccchHhhcCceeecCCCCHHHHHHHHHhccEEEecCCeeeeccCChh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHh
Q psy16707        407 NVGYLAKAIHAVT  419 (420)
Q Consensus       407 ni~~la~AI~~vv  419 (420)
                      ||+|+|+||.+|+
T Consensus       384 ni~~va~ai~~v~  396 (396)
T COG1448         384 NIDYVAKAIAAVL  396 (396)
T ss_pred             hHHHHHHHHHhhC
Confidence            9999999999874



>KOG1411|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>KOG1411|consensus Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN02994 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
3hlm_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 9e-46
3pd6_A401 Crystal Structure Of Mouse Mitochondrial Aspartate 1e-45
7aat_A401 X-Ray Structure Refinement And Comparison Of Three 6e-45
1aka_A401 Structural Basis For The Catalytic Activity Of Aspa 7e-45
1aat_A411 Oxoglutarate-Induced Conformational Changes In Cyto 1e-32
2cst_A411 Crystal Structure Of The Closed Form Of Chicken Cyt 1e-32
1ajr_A412 Refinement And Comparison Of The Crystal Structures 3e-31
1ajs_A412 Refinement And Comparison Of The Crystal Structures 3e-31
3ii0_A422 Crystal Structure Of Human Glutamate Oxaloacetate T 2e-30
4eu1_A409 Structure Of A Mitochondrial Aspartate Aminotransfe 5e-27
1yaa_A412 Aspartate Aminotransferase From Saccharomyces Cerev 4e-25
3tat_A397 Tyrosine Aminotransferase From E. Coli Length = 397 2e-24
3fsl_A397 Crystal Structure Of Tyrosine Aminotransferase Trip 2e-24
4f4e_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 3e-23
4eff_A420 Crystal Structure Of Aromatic-Amino-Acid Aminotrans 3e-23
1toj_A396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 1e-22
4f5i_A406 Substrate Specificity Conversion Of E. Coli Pyridox 2e-22
1ahy_A396 Aspartate Aminotransferase Hexamutant Length = 396 2e-22
4f5k_A406 Substrate Specificity Conversion Of Aspartate Amino 4e-22
4f5f_A406 Structure Of Aspartate Aminotransferase Conversion 5e-22
1ari_A396 Aspartate Aminotransferase, W140h Mutant, Maleate C 5e-22
1g4v_A396 Aspartate Aminotransferase Active Site Mutant N194a 5e-22
1b4x_A396 Aspartate Aminotransferase From E. Coli, C191s Muta 5e-22
1asf_A396 The Structural Basis For The Reduced Activity Of Th 5e-22
1qir_A396 Aspartate Aminotransferase From Escherichia Coli, C 6e-22
1qis_A396 Aspartate Aminotransferase From Escherichia Coli, C 6e-22
1tog_A396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 6e-22
1asb_A396 The Structural Basis For The Reduced Activity Of Th 6e-22
1asl_A396 Crystal Structures Of Escherichia Coli Aspartate Am 6e-22
1ix8_A396 Aspartate Aminotransferase Active Site Mutant V39fN 6e-22
2aat_A396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 6e-22
1ix6_A396 Aspartate Aminotransferase Active Site Mutant V39f 6e-22
4f5h_A406 Intercoversion Of Substrate Specificity: E. Coli As 6e-22
4f5m_A406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 6e-22
1bqa_A396 Aspartate Aminotransferase P195a Mutant Length = 39 6e-22
1bqd_A396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 6e-22
2q7w_A396 Structural Studies Reveals The Inactivation Of E. C 6e-22
4f5j_A406 Rational Design And Directed Evolution For Conversi 7e-22
2d61_A396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 7e-22
1qit_A396 Aspartate Aminotransferase From Escherichia Coli, C 7e-22
1aia_A396 Structural Basis For The Catalytic Activity Of Aspa 7e-22
4f5g_A406 Rational Design And Directed Evolution Of E. Coli A 7e-22
2d66_A396 Aspartate Aminotransferase Mutant Mab Length = 396 8e-22
1toe_A396 Unliganded Structure Of Hexamutant + A293d Mutant O 1e-21
1czc_A396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 2e-21
1yoo_A396 Aspartate Aminotransferase Mutant Atb17 With Isoval 2e-21
1arh_A396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 4e-21
1aam_A396 The Structural Basis For The Altered Substrate Spec 4e-21
3zzj_A396 Structure Of An Engineered Aspartate Aminotransfera 4e-21
1g7w_A396 Aspartate Aminotransferase Active Site Mutant N194a 5e-21
1g4x_A396 Aspartate Aminotransferase Active Site Mutant N194a 5e-21
3aat_A396 Activity And Structure Of The Active-Site Mutants R 5e-21
4h51_A420 Crystal Structure Of A Putative Aspartate Aminotran 5e-21
2d5y_A396 Aspartate Aminotransferase Mutant Mc With Isovaleri 1e-20
2d64_A396 Aspartate Aminotransferase Mutant Mabc With Isovale 1e-20
3meb_A 448 Structure Of Cytoplasmic Aspartate Aminotransferase 4e-20
3meb_A448 Structure Of Cytoplasmic Aspartate Aminotransferase 2e-19
1g7x_A396 Aspartate Aminotransferase Active Site Mutant N194a 4e-20
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 1e-16
1ay4_A394 Aromatic Amino Acid Aminotransferase Without Substr 3e-16
3uak_A406 Crystal Structure Of De Novo Designed Cysteine Este 2e-16
3k7y_A405 Aspartate Aminotransferase Of Plasmodium Falciparum 7e-13
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure

Iteration: 1

Score = 181 bits (458), Expect = 9e-46, Method: Compositional matrix adjust. Identities = 87/122 (71%), Positives = 97/122 (79%) Query: 299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358 KILIR YS+PP++GARI IL P L+ QWL EVKGMADRIISMR L NL+KEGS+ Sbjct: 280 KILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSS 339 Query: 359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418 W HITDQIGMFC+TGL QVE+L KE SVY+TKDGRIS+AGVTS NVGYLA AIH V Sbjct: 340 HNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQV 399 Query: 419 TK 420 TK Sbjct: 400 TK 401
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|4F4E|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Covalently Bound To Pyridoxal Phosphate Length = 420 Back     alignment and structure
>pdb|4EFF|A Chain A, Crystal Structure Of Aromatic-Amino-Acid Aminotransferase From Burkholderia Pseudomallei Length = 420 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query420
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 2e-70
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 4e-68
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 4e-57
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 3e-70
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 3e-68
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 3e-54
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 4e-70
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 8e-68
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 1e-59
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 5e-70
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 1e-67
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 1e-55
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 2e-69
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 3e-67
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 7e-55
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 4e-69
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 5e-68
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 1e-57
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 6e-69
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 6e-68
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 2e-55
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 8e-69
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 2e-67
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 2e-54
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 4e-65
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 7e-64
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 5e-57
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-64
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 5e-63
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 1e-52
3rq1_A418 Aminotransferase class I and II; structural genomi 7e-59
3rq1_A418 Aminotransferase class I and II; structural genomi 5e-57
3rq1_A 418 Aminotransferase class I and II; structural genomi 2e-47
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 4e-57
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 6e-55
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 8e-49
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 3e-39
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 2e-38
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 5e-31
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
 Score =  227 bits (580), Expect = 2e-70
 Identities = 50/122 (40%), Positives = 75/122 (61%)

Query: 299 KILIRAFYSSPPIHGARIVQEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSN 358
           K +IR  YS+PP HG  IV  +L  P+L+A W+ E+  M DRI +MR  L + L+  G  
Sbjct: 299 KRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIE 358

Query: 359 KPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAGVTSKNVGYLAKAIHAV 418
           + ++ I  Q GMF Y+GL + QV++L +E  +Y    GRI +A + ++N+  +A AI AV
Sbjct: 359 RDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAV 418

Query: 419 TK 420
            K
Sbjct: 419 LK 420


>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 100.0
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 100.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 100.0
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 100.0
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 100.0
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.97
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.97
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 99.97
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.93
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.93
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.93
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.93
3rq1_A418 Aminotransferase class I and II; structural genomi 99.91
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.9
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.88
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.83
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.78
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.77
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 99.77
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.74
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.74
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.72
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.72
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.72
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.7
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.69
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.69
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.69
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.68
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 99.68
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.67
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.67
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.67
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.67
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.67
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.67
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.66
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.65
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.64
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 99.64
3ele_A398 Amino transferase; RER070207001803, structural gen 99.63
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.62
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.62
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.61
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 99.61
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.6
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.6
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.6
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.59
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.59
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.59
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.59
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.58
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 99.58
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.58
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.57
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.57
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.57
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.55
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.54
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.54
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.54
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 99.53
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.53
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.5
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.5
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.49
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.49
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.49
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.48
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.48
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 99.47
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.46
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.45
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.44
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.41
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.39
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.38
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.37
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.35
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.33
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.32
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.28
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.28
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.26
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.23
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 98.86
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.22
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.18
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.12
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.11
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.03
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.01
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 98.99
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 98.99
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 98.98
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.97
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 98.95
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 98.94
1svv_A359 Threonine aldolase; structural genomics, structura 98.91
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 98.9
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 98.87
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 98.85
1iug_A352 Putative aspartate aminotransferase; wild type, py 98.82
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 98.81
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 98.79
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 98.77
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 98.76
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.75
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.74
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 98.73
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 98.69
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 98.69
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 98.69
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 98.68
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 98.68
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.68
3rq1_A418 Aminotransferase class I and II; structural genomi 98.68
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 98.66
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 98.66
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 98.64
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.64
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 98.63
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 98.61
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.61
2yrr_A353 Aminotransferase, class V; structural genomics, NP 98.53
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 98.5
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 98.49
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 98.48
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 98.46
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 98.44
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 98.43
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.42
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 98.36
4adb_A406 Succinylornithine transaminase; transferase, PLP e 98.35
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 98.34
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 98.34
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 98.33
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.32
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.31
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 98.29
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.25
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 98.25
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 98.23
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 98.23
3f0h_A376 Aminotransferase; RER070207000802, structural geno 98.22
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 98.2
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 98.2
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 98.18
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 98.17
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 98.16
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 98.16
3ruy_A392 Ornithine aminotransferase; structural genomics, c 98.15
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 98.13
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 98.13
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 98.13
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 98.09
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 98.09
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 98.08
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 98.08
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 98.07
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 98.05
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 98.04
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 98.03
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 98.02
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 98.0
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 97.98
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 97.96
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 97.96
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 97.95
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 97.94
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 97.94
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 97.92
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 97.89
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 97.86
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 97.82
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.81
3nra_A407 Aspartate aminotransferase; structural genomics, j 97.79
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 97.78
1z7d_A433 Ornithine aminotransferase; structural genomics co 97.76
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 97.72
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 97.72
3hmu_A 472 Aminotransferase, class III; structural genomics, 97.69
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 97.64
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.64
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 97.64
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 97.59
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 97.59
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 97.54
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.53
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 97.53
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 97.52
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 97.51
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.49
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 97.48
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.48
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 97.48
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 97.46
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 97.46
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 97.44
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 97.44
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 97.43
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 97.43
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 97.41
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 97.37
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.37
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 97.34
1o69_A 394 Aminotransferase; structural genomics, unknown fun 97.23
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 97.17
3pj0_A359 LMO0305 protein; structural genomics, joint center 97.16
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 97.16
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 97.09
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 97.09
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 97.07
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 97.05
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 97.03
2fnu_A 375 Aminotransferase; protein-product complex, structu 97.0
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 97.0
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 96.99
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 96.98
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 96.92
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 96.88
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 96.82
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 96.77
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 96.77
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 96.75
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 96.73
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 96.73
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 96.71
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 96.69
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 96.69
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 96.64
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 96.64
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 96.62
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 96.55
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 96.55
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 96.55
3aow_A448 Putative uncharacterized protein PH0207; protein-P 96.51
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 96.51
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 96.49
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 96.48
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 96.48
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 96.46
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 96.45
2z61_A370 Probable aspartate aminotransferase 2; amino acid 96.45
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 96.44
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 96.44
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 96.39
1xi9_A406 Putative transaminase; alanine aminotransferase, s 96.3
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 96.29
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 96.25
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 96.25
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 96.23
3l8a_A421 METC, putative aminotransferase, probable beta-cys 96.23
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 96.21
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 96.17
1vp4_A425 Aminotransferase, putative; structural genomics, j 96.15
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 96.12
3ele_A398 Amino transferase; RER070207001803, structural gen 96.09
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 96.09
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 96.03
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 95.97
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 95.96
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 95.94
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 95.84
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 95.81
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 95.81
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 95.77
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 95.77
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 95.77
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 95.74
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 95.68
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 95.63
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 95.62
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 95.54
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 95.5
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 95.46
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 95.41
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 95.34
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 95.31
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 95.27
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 95.15
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 95.14
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 95.12
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 95.08
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 95.06
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 95.0
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 94.95
1iug_A352 Putative aspartate aminotransferase; wild type, py 94.91
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 94.87
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 94.85
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 94.77
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 94.72
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 94.43
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 94.35
2yrr_A353 Aminotransferase, class V; structural genomics, NP 94.3
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 94.25
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 94.24
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 94.16
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 94.13
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 94.02
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 93.99
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 93.97
3ftb_A361 Histidinol-phosphate aminotransferase; structural 93.94
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 93.91
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 93.9
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 93.79
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 93.69
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 93.66
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 93.51
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 93.41
3f0h_A376 Aminotransferase; RER070207000802, structural geno 93.37
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 93.14
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 93.11
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 93.11
1svv_A359 Threonine aldolase; structural genomics, structura 93.09
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 92.95
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 92.83
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 92.81
3qm2_A386 Phosphoserine aminotransferase; structural genomic 92.8
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 92.68
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 92.45
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 92.36
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 92.15
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 91.36
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 91.91
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 91.79
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 91.61
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 91.57
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 91.44
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 91.0
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 90.84
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 90.34
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 90.13
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 90.12
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 89.82
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 89.35
3qm2_A386 Phosphoserine aminotransferase; structural genomic 89.16
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 88.86
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 88.82
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 88.77
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 88.75
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 88.67
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 88.64
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 88.18
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 88.12
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 87.82
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 87.58
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 87.29
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 87.28
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 86.7
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 86.69
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 86.49
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 86.4
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 85.85
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 85.5
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 85.46
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 85.08
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 84.31
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 84.12
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 83.94
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 83.86
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 83.73
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 83.13
3ruy_A392 Ornithine aminotransferase; structural genomics, c 82.76
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 82.73
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 82.45
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 81.97
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 81.47
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 80.05
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
Probab=100.00  E-value=1.2e-57  Score=469.60  Aligned_cols=256  Identities=36%  Similarity=0.631  Sum_probs=237.1

Q ss_pred             ccccCCChHHHHHHHHHccCCCCceeecccccccCCCCCCchHHHHHHHHHHHccCCCCCCCCCCCCHHHHHHHHHHHcC
Q psy16707        139 TSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNKNLDKEYAPIIGAPDFGKLAAQLAYG  218 (420)
Q Consensus       139 ~~~~~~d~i~~l~~~~~~d~~~~kInL~iG~y~d~dg~~~~~~~V~~a~~~~~~~~~~~~Y~p~~G~~~fr~a~~~~~~g  218 (420)
                      ++..++||||+++++|++|+++ |||||||+|||+||+||++++|++|++.+.+++.+|+|+|+.|+++||+++++++||
T Consensus        24 v~~~p~d~i~~l~~~~~~d~~~-kinLgvG~y~d~~g~~~vl~~Vk~A~~~~~~~~~~~~Y~p~~G~p~lr~aia~~~~g  102 (420)
T 4h51_A           24 IQAQAPDVIFDLAKRAAAAKGP-KANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYG  102 (420)
T ss_dssp             CCCCCCCHHHHHHHHHHHCCSS-CEECCSCCCBCTTSCBCCCHHHHHHHHHHHHTTCCCCCCCTTCCHHHHHHHHHHHHC
T ss_pred             CCCCCCChHHHHHHHHhcCCCC-CEEeecCcccCCCCCCCCCHHHHHHHHHHhcCCCCCCCCCcCChHHHHHHHHHHhcC
Confidence            3455699999999999999887 999999999999999999999999999988777789999999999999999999999


Q ss_pred             CCCccccCCceeeecccCCCCccccccccccceeecccchHHHHHHHHHHHhc--CCCCCEEEEcCCCCCCcHHHHhhcC
Q psy16707        219 EDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNF--FPGEKVIYVPTPTWGNHIPICKHTG  296 (420)
Q Consensus       219 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~vqt~gGtgal~~~~~~l~~~--~p~gd~VlvpdP~w~ny~~i~~~aG  296 (420)
                      .+.   ..+++.+                    +||+|||||+++++.|+..+  +| ||+||||+|+|+||..+++.+|
T Consensus       103 ~~~---~~~~~~~--------------------~qt~ggtga~~~a~~~l~~~~~~p-gd~V~ip~P~w~~y~~i~~~aG  158 (420)
T 4h51_A          103 NTV---ELENLVA--------------------VQTLSGTGAVSLGAKLLTRVFDAE-TTPIYLSDPTWPNHYGVVKAAG  158 (420)
T ss_dssp             ------CGGGEEE--------------------EEEEHHHHHHHHHHHHHTTTSCTT-TSCEEEEESCCTHHHHHHHHTT
T ss_pred             CCc---cccccce--------------------eeecCchHHHHHHHHHHHHhcCCC-CCEEEEecCCchhHHHHHHHcC
Confidence            874   3567777                    99999999999999988764  46 9999999999999999999999


Q ss_pred             cc------------------------------------------------------------------------------
Q psy16707        297 LE------------------------------------------------------------------------------  298 (420)
Q Consensus       297 ~~------------------------------------------------------------------------------  298 (420)
                      ++                                                                              
T Consensus       159 ~~~V~~~~~~~~~~~~~d~~~~~~~l~~~~~~~~vll~~~p~NPtG~~~~~~~~~~i~~~~~~~~~~~~~D~~Y~~~~~~  238 (420)
T 4h51_A          159 WKNICTYAYYDPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASG  238 (420)
T ss_dssp             CCCEEEEECEEGGGTEECHHHHHHHHHHSCSSCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHHTCEEEEEESCTTTTTS
T ss_pred             CeEEEeeccccccccCCCHHHHHHHHhccCCCcEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhcCceEeeehhhhhhccC
Confidence            85                                                                              


Q ss_pred             --------------------------------------------------------hhhhhhccCCCchHHHHHHHHHhC
Q psy16707        299 --------------------------------------------------------KILIRAFYSSPPIHGARIVQEILG  322 (420)
Q Consensus       299 --------------------------------------------------------~~~~r~~~s~pp~~ga~iv~~IL~  322 (420)
                                                                              ..+.|++++|||.++|++++.+|+
T Consensus       239 ~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~RvG~~~~~~~~~~~~~~~~~~l~~~~r~~~s~~p~~~a~~~~~~l~  318 (420)
T 4h51_A          239 SLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILS  318 (420)
T ss_dssp             CHHHHTHHHHHHHHTTCCCEEEEECTTTSCCGGGCEEEEEEECSCHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHHHHH
T ss_pred             CcccchHHHHhHHhhCceEEEEeccccccccccCceEEEEecccCHHHHHHHHHHHHHhhhcccCcchHHHHHHHHHHhc
Confidence                                                                    346789999999999999999999


Q ss_pred             ChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcccCCCCceEEecCCCHHHHHHHHHhCCeEEeCCCcEEEcc
Q psy16707        323 DPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGRISMAG  402 (420)
Q Consensus       323 dp~L~~~w~~el~~m~~r~~~~R~~l~~~L~~~g~~~~w~~i~~q~GmF~~~~l~~~~v~~Ll~e~~Vy~~p~gRis~ag  402 (420)
                      ||+++++|+++++.|++||++||+.|++.|+++|++++|.|+++|+|||+|+|++++|++.| +|+|||++|+||||+||
T Consensus       319 d~~l~~~~~~~~~~m~~r~~~~R~~l~~~L~~~g~~~~~~~i~~q~GmF~~~gls~e~v~~L-~e~~Vy~~~~gRis~Ag  397 (420)
T 4h51_A          319 NNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYC-QNHNIFITVSGRANMAG  397 (420)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSCCTHHHHCCSSEEECCCCHHHHHHH-HHTTEECCTTCEEEGGG
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCeecCCCceEEecCcCHHHHHHH-HhCCEEEcCCCEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999866 68999999999999999


Q ss_pred             cCCCCHHHHHHHHHHHhC
Q psy16707        403 VTSKNVGYLAKAIHAVTK  420 (420)
Q Consensus       403 l~~~ni~~la~AI~~vv~  420 (420)
                      +|++||+++|+||++|||
T Consensus       398 l~~~ni~~~a~aI~~vvr  415 (420)
T 4h51_A          398 LTHETALMLAQTINDAVR  415 (420)
T ss_dssp             CCHHHHHHHHHHHHHHHC
T ss_pred             CCHHHHHHHHHHHHHHHH
Confidence            999999999999999986



>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 420
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 1e-37
d7aata_401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 1e-33
d7aata_ 401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 3e-28
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 1e-36
d1yaaa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 1e-33
d1yaaa_ 412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 2e-24
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 3e-36
d2q7wa1396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 7e-34
d2q7wa1 396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 4e-24
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 4e-36
d1ajsa_412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 2e-33
d1ajsa_ 412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 4e-29
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 3e-35
d2ay1a_394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-33
d2ay1a_ 394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 8e-25
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 7e-34
d3tata_397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 3e-31
d3tata_ 397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-27
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Chicken (Gallus gallus), mitochondria [TaxId: 9031]
 Score =  138 bits (348), Expect = 1e-37
 Identities = 86/154 (55%), Positives = 102/154 (66%), Gaps = 1/154 (0%)

Query: 267 FLKNFFPGEKVIYVPTPTWGNHIPICKHTGLEKILIRAFYSSPPIHGARIVQEILGDPKL 326
                  GE+          +     +     KILIR  YS+PP++GARI   IL  P+L
Sbjct: 249 AKNMGLYGERAGAFTVI-CRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPEL 307

Query: 327 KAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIK 386
           + +WL EVKGMADRIISMR  L  NL+KEGS+  W HITDQIGMFC+TGL   QVE+L K
Sbjct: 308 RKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTK 367

Query: 387 EHSVYLTKDGRISMAGVTSKNVGYLAKAIHAVTK 420
           E S+Y+TKDGRIS+AGV S NVGYLA AIH VTK
Sbjct: 368 EFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK 401


>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query420
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 100.0
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 100.0
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 100.0
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 100.0
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 100.0
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 100.0
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.92
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.91
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 99.91
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.9
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.89
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.89
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.89
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 99.89
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 99.89
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.88
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.87
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 99.87
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 99.87
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.87
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.87
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 99.86
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 99.86
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.85
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.85
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 99.82
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 99.81
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.8
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.79
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 99.7
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.42
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 99.31
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 99.17
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.72
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 98.57
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 98.28
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 98.15
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 98.08
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 97.81
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 97.78
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 97.69
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 97.31
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 97.31
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 97.28
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 97.23
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.18
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 97.12
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 97.08
d1mdoa_ 376 Aminotransferase ArnB {Salmonella typhimurium [Tax 97.06
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 97.04
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 97.03
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.03
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 97.01
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 96.79
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 96.77
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 96.7
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 96.63
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 96.48
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 96.36
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 96.11
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 96.06
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 96.04
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 95.88
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 95.83
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 95.77
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 95.65
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 95.59
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 95.37
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 95.09
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 94.98
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 94.74
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 94.28
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 94.21
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 94.09
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 94.06
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 93.3
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 93.01
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 92.87
d1b9ha_ 384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 92.44
d1o69a_ 374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 92.28
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 92.21
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 91.79
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 91.26
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 91.18
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 90.88
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 90.3
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 89.93
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 89.17
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 88.42
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 88.19
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 86.33
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 85.6
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 85.4
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 85.11
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 84.92
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 84.35
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 83.95
d2fnua1 371 Spore coat polysaccharide biosynthesis protein C { 83.31
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 83.28
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 82.52
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 81.52
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]
Probab=100.00  E-value=4.1e-50  Score=406.94  Aligned_cols=261  Identities=40%  Similarity=0.763  Sum_probs=245.6

Q ss_pred             ccccCCChHHHHHHHHHccCCCCceeecccccccCCCCCCchHHHHHHHHHHHcc-CCCCCCCCCCCCHHHHHHHHHHHc
Q psy16707        139 TSSVKVPSSNLLTEAFKKDTNVNKINLGVGAYRDDQGKPYVLPSVKQADEIVLNK-NLDKEYAPIIGAPDFGKLAAQLAY  217 (420)
Q Consensus       139 ~~~~~~d~i~~l~~~~~~d~~~~kInL~iG~y~d~dg~~~~~~~V~~a~~~~~~~-~~~~~Y~p~~G~~~fr~a~~~~~~  217 (420)
                      ++.+++||||+++++|++|++++||||++|+|+|+||++|++++|++|++.+..+ ...|+|+|+.|+++||++++++++
T Consensus         8 ~~~~~~d~i~~~~~~~~~d~~~~kInL~iG~~~d~~g~~~~~~~V~~A~~~l~~~~~~~~~Y~p~~G~~~lr~aia~~~~   87 (412)
T d1yaaa_           8 IELLPPDALFGIKQRYGQDQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLIHNDSSYNHEYLGITGLPSLTSNAAKIIF   87 (412)
T ss_dssp             CCCCCCCTTHHHHHHHHTCCCSSCEECSSCCCBCTTSCBCCCHHHHHHHHHHHTCTTCCCCCCCTTCCHHHHHHHHHHHH
T ss_pred             CCcCCCChHHHHHHHHhcCCCCCcEEeecCCCcCCCCCCCCcHHHHHHHHHHHhCcccCCCCCCCCCCHHHHHHHHHHHh
Confidence            7889999999999999999999999999999999999999999999999888755 457899999999999999999999


Q ss_pred             CCCCccccCCceeeecccCCCCccccccccccceeecccchHHHHHHHHHHHhcCCCCCEEEEcCCCCCCcHHHHhhcCc
Q psy16707        218 GEDCPQLKDNLISIVQGISGTGSLRVGAAFQISIVQGISGTGSLRVGAAFLKNFFPGEKVIYVPTPTWGNHIPICKHTGL  297 (420)
Q Consensus       218 g~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~vqt~gGtgal~~~~~~l~~~~p~gd~VlvpdP~w~ny~~i~~~aG~  297 (420)
                      +.+++.+.++++.+                    +++.||++++.+++.++..+.| ||+|++|+|+|++|..+++.+|+
T Consensus        88 ~~~~~~~~~~~~~~--------------------~~~~~~~~~~~~~~~~~~~~~~-gd~Vlip~P~~~~y~~~~~~~g~  146 (412)
T d1yaaa_          88 GTQSDALQEDRVIS--------------------VQSLSGTGALHISAKFFSKFFP-DKLVYLSKPTWANHMAIFENQGL  146 (412)
T ss_dssp             CTTCHHHHTTCEEE--------------------EEEEHHHHHHHHHHHHHHHHCT-TCCEEEEESCCTTHHHHHHTTTC
T ss_pred             cccCccccccceeE--------------------EecccchhHHHHHHHHHhccCC-CCEEecccccCchhHHHHHHcCC
Confidence            99988888888887                    8899999999888877777888 99999999999999999999998


Q ss_pred             c-------------------------------------------------------------------------------
Q psy16707        298 E-------------------------------------------------------------------------------  298 (420)
Q Consensus       298 ~-------------------------------------------------------------------------------  298 (420)
                      +                                                                               
T Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~i~~P~NPTG~~~s~~~~~~i~~~a~~~~~~ii~De~Y~~l~~~~~  226 (412)
T d1yaaa_         147 KTATYPYWANETKSLDLNGFLNAIQKAPEGSIFVLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDL  226 (412)
T ss_dssp             CEEEEECEETTTTEECHHHHHHHHHHSCTTCEEEEECSSCTTTCCCCCHHHHHHHHHHHHHTTCEEEEEESCTTTSSSCH
T ss_pred             ceecccccccccccccchhhhcccccCCCceEEEEecCCCCCccccCCHHHHHHHHhhhccCCEEEeecceeeecccCCc
Confidence            5                                                                               


Q ss_pred             -------------------------------------------------------------hhhhhhccCCCchHHHHHH
Q psy16707        299 -------------------------------------------------------------KILIRAFYSSPPIHGARIV  317 (420)
Q Consensus       299 -------------------------------------------------------------~~~~r~~~s~pp~~ga~iv  317 (420)
                                                                                   ....+++++|+|.++|+++
T Consensus       227 ~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~RiG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~  306 (412)
T d1yaaa_         227 DKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTIKPAVTSQLAKIIRSEVSNPPAYGAKIV  306 (412)
T ss_dssp             HHHTHHHHHHHHHTTTTCCEEEEEECTTTSCCGGGCEEEEEEECCSCTTHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHH
T ss_pred             ccchhhhhhhhhccccCCCeEEEEecCCccccCcCceEEEEEchhhhhhHHHHHHHHHHHHHHHHHHHhcCCChHHHHHH
Confidence                                                                         2334778999999999999


Q ss_pred             HHHhCChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCcccCCCCceEEecCCCHHHHHHHHHhCCeEEeCCCc
Q psy16707        318 QEILGDPKLKAQWLTEVKGMADRIISMRQSLKDNLQKEGSNKPWNHITDQIGMFCYTGLNATQVEKLIKEHSVYLTKDGR  397 (420)
Q Consensus       318 ~~IL~dp~L~~~w~~el~~m~~r~~~~R~~l~~~L~~~g~~~~w~~i~~q~GmF~~~~l~~~~v~~Ll~e~~Vy~~p~gR  397 (420)
                      ..+++|++++++|.++++.|+++|+++|+.|.+.|+++|.++.|.++++++|||+|++++++|+++|++|+|||++||+|
T Consensus       307 ~~~l~~~~~~~~~~~~~~~~~~~~~~~r~~l~~~L~~~g~~~~~~~~~~~gG~F~~~~ls~e~~~~L~~e~~V~~~~g~R  386 (412)
T d1yaaa_         307 AKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGR  386 (412)
T ss_dssp             HHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCTHHHHCCSSEEECCCCHHHHHHHHHHHCEECCTTSE
T ss_pred             HHHhcChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCceeCCCceEEEecCcCHHHHHHHHHhCCEEECCCCE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcccCCCCHHHHHHHHHHHhC
Q psy16707        398 ISMAGVTSKNVGYLAKAIHAVTK  420 (420)
Q Consensus       398 is~agl~~~ni~~la~AI~~vv~  420 (420)
                      ||+||++++||+++++||++|+|
T Consensus       387 is~~g~~~~~i~~l~~ai~~v~k  409 (412)
T d1yaaa_         387 ASIAGLNQGNVEYVAKAIDEVVR  409 (412)
T ss_dssp             EEGGGCCTTTHHHHHHHHHHHHH
T ss_pred             EEeccCCHHHHHHHHHHHHHHHH
Confidence            99999999999999999999985



>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure