Psyllid ID: psy16714

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE
cHHHHHHHHccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccc
ccHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccc
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEdlkkesnpdVIEEKARFIYEDYISILSPKE
mqcikrtrntfkagrKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE
********NTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISIL****
**C*KRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDL************ARFIYEDYISILSP**
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILS***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQCIKRTRNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
Q9PWA0210 Regulator of G-protein si yes N/A 0.823 0.266 0.875 3e-22
Q9UGC6210 Regulator of G-protein si yes N/A 0.823 0.266 0.875 4e-22
Q9QZB0210 Regulator of G-protein si yes N/A 0.823 0.266 0.839 1e-21
Q9PWA1218 Regulator of G-protein si no N/A 0.823 0.256 0.803 1e-20
O76081388 Regulator of G-protein si no N/A 0.823 0.144 0.785 2e-20
Q08DC7223 Regulator of G-protein si no N/A 0.823 0.251 0.767 5e-20
P79348374 Regulator of G-protein si no N/A 0.823 0.149 0.785 3e-19
Q9QZB1239 Regulator of G-protein si no N/A 0.823 0.234 0.767 5e-19
P49795217 Regulator of G-protein si no N/A 0.823 0.258 0.75 2e-18
Q9CX84216 Regulator of G-protein si no N/A 0.808 0.254 0.745 4e-18
>sp|Q9PWA0|RGS17_CHICK Regulator of G-protein signaling 17 OS=Gallus gallus GN=RGS17 PE=2 SV=1 Back     alignment and function desciption
 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 50/56 (89%)

Query: 13  AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
           AGR LFREFLR EYSEEN+LFWLACEDLKKE N  VIEEKAR IYEDYISILSPKE
Sbjct: 93  AGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISILSPKE 148
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Gallus gallus (taxid: 9031)
>sp|Q9UGC6|RGS17_HUMAN Regulator of G-protein signaling 17 OS=Homo sapiens GN=RGS17 PE=1 SV=2 Back     alignment and function description
>sp|Q9QZB0|RGS17_MOUSE Regulator of G-protein signaling 17 OS=Mus musculus GN=Rgs17 PE=1 SV=1 Back     alignment and function description
>sp|Q9PWA1|RGS20_CHICK Regulator of G-protein signaling 20 OS=Gallus gallus GN=RGS20 PE=2 SV=1 Back     alignment and function description
>sp|O76081|RGS20_HUMAN Regulator of G-protein signaling 20 OS=Homo sapiens GN=RGS20 PE=1 SV=4 Back     alignment and function description
>sp|Q08DC7|RGS19_BOVIN Regulator of G-protein signaling 19 OS=Bos taurus GN=RGS19 PE=2 SV=1 Back     alignment and function description
>sp|P79348|RGS20_BOVIN Regulator of G-protein signaling 20 OS=Bos taurus GN=RGS20 PE=1 SV=2 Back     alignment and function description
>sp|Q9QZB1|RGS20_MOUSE Regulator of G-protein signaling 20 OS=Mus musculus GN=Rgs20 PE=1 SV=1 Back     alignment and function description
>sp|P49795|RGS19_HUMAN Regulator of G-protein signaling 19 OS=Homo sapiens GN=RGS19 PE=1 SV=1 Back     alignment and function description
>sp|Q9CX84|RGS19_MOUSE Regulator of G-protein signaling 19 OS=Mus musculus GN=Rgs19 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
427792251 437 Putative termination of g-protein couple 0.823 0.128 0.892 4e-23
189233787 284 PREDICTED: similar to AGAP007127-PA [Tri 0.823 0.197 0.875 6e-23
158286230 237 AGAP007127-PA [Anopheles gambiae str. PE 0.823 0.236 0.892 2e-22
193631927 270 PREDICTED: regulator of G-protein signal 0.823 0.207 0.892 2e-22
170036846159 conserved hypothetical protein [Culex qu 0.823 0.352 0.892 6e-22
270015072167 hypothetical protein TcasGA2_TC014234 [T 0.823 0.335 0.875 9e-22
307209078 317 Regulator of G-protein signaling 20 [Har 0.823 0.176 0.857 2e-21
157115335 180 regulator of g protein signaling [Aedes 0.823 0.311 0.875 2e-21
332030836 313 Regulator of G-protein signaling 20 [Acr 0.823 0.178 0.821 3e-21
358332505 648 regulator of G-protein signaling 20, par 0.882 0.092 0.705 5e-21
>gi|427792251|gb|JAA61577.1| Putative termination of g-protein coupled receptor signaling pathway, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  112 bits (279), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 50/56 (89%), Positives = 55/56 (98%)

Query: 13  AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
           AGRK+FR+FL+CEYSEENILFWLACEDLKKESNP++IEEKAR IYEDYISILSPKE
Sbjct: 318 AGRKVFRDFLKCEYSEENILFWLACEDLKKESNPELIEEKARAIYEDYISILSPKE 373

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189233787|ref|XP_972835.2| PREDICTED: similar to AGAP007127-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158286230|ref|XP_308634.3| AGAP007127-PA [Anopheles gambiae str. PEST] gi|157020369|gb|EAA04115.3| AGAP007127-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|193631927|ref|XP_001951409.1| PREDICTED: regulator of G-protein signaling 17-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|170036846|ref|XP_001846272.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167879807|gb|EDS43190.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|270015072|gb|EFA11520.1| hypothetical protein TcasGA2_TC014234 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307209078|gb|EFN86245.1| Regulator of G-protein signaling 20 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157115335|ref|XP_001658206.1| regulator of g protein signaling [Aedes aegypti] gi|108883529|gb|EAT47754.1| AAEL001193-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332030836|gb|EGI70480.1| Regulator of G-protein signaling 20 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|358332505|dbj|GAA51147.1| regulator of G-protein signaling 20, partial [Clonorchis sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
UNIPROTKB|Q9PWA0210 RGS17 "Regulator of G-protein 0.823 0.266 0.875 1.1e-21
UNIPROTKB|E2QTJ9232 RGS17 "Uncharacterized protein 0.823 0.241 0.875 1.1e-21
UNIPROTKB|F6V7Y8210 RGS17 "Uncharacterized protein 0.823 0.266 0.875 1.1e-21
UNIPROTKB|Q9UGC6210 RGS17 "Regulator of G-protein 0.823 0.266 0.875 1.1e-21
UNIPROTKB|F1S7X6206 RGS17 "Uncharacterized protein 0.823 0.271 0.875 1.1e-21
UNIPROTKB|A7MBG6210 RGS17 "RGS17 protein" [Bos tau 0.823 0.266 0.857 2.4e-21
ZFIN|ZDB-GENE-040718-229208 rgs17 "regulator of G-protein 0.808 0.264 0.8 3e-21
MGI|MGI:1927469210 Rgs17 "regulator of G-protein 0.823 0.266 0.839 3.9e-21
RGD|1305515215 Rgs17 "regulator of G-protein 0.823 0.260 0.839 3.9e-21
FB|FBgn0028743274 CG5036 [Drosophila melanogaste 0.823 0.204 0.785 1e-20
UNIPROTKB|Q9PWA0 RGS17 "Regulator of G-protein signaling 17" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 49/56 (87%), Positives = 50/56 (89%)

Query:    13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
             AGR LFREFLR EYSEEN+LFWLACEDLKKE N  VIEEKAR IYEDYISILSPKE
Sbjct:    93 AGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARLIYEDYISILSPKE 148
GO:0038032 "termination of G-protein coupled receptor signaling pathway" evidence=IEA
GO:0005096 "GTPase activator activity" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
GO:0005886 "plasma membrane" evidence=IBA
GO:0005634 "nucleus" evidence=IEA
GO:0043547 "positive regulation of GTPase activity" evidence=IBA
UNIPROTKB|E2QTJ9 RGS17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6V7Y8 RGS17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UGC6 RGS17 "Regulator of G-protein signaling 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S7X6 RGS17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBG6 RGS17 "RGS17 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-229 rgs17 "regulator of G-protein signaling 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1927469 Rgs17 "regulator of G-protein signaling 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305515 Rgs17 "regulator of G-protein signaling 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0028743 CG5036 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34295RGS1_CAEELNo assigned EC number0.67740.91170.3084yesN/A
Q9PWA0RGS17_CHICKNo assigned EC number0.8750.82350.2666yesN/A
Q9QZB0RGS17_MOUSENo assigned EC number0.83920.82350.2666yesN/A
Q9UGC6RGS17_HUMANNo assigned EC number0.8750.82350.2666yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
cd08718118 cd08718, RGS_RZ-like, Regulator of G protein signa 4e-33
cd08746167 cd08746, RGS_RGS20, Regulator of G protein signali 5e-27
cd08744118 cd08744, RGS_RGS17, Regulator of G protein signali 1e-26
cd08745118 cd08745, RGS_RGS19, Regulator of G protein signali 1e-26
pfam00615117 pfam00615, RGS, Regulator of G protein signaling d 8e-17
cd08714114 cd08714, RGS_RGS4, Regulator of G protein signalin 9e-17
cd08713114 cd08713, RGS_RGS3, Regulator of G protein signalin 7e-16
cd08717114 cd08717, RGS_RGS5, Regulator of G protein signalin 6e-15
smart00315118 smart00315, RGS, Regulator of G protein signalling 1e-14
cd08706113 cd08706, RGS_R12-like, Regulator of G protein sign 4e-14
cd08712114 cd08712, RGS_RGS18, Regulator of G protein signali 1e-13
cd08723111 cd08723, RGS_RGS21, Regulator of G protein signali 2e-13
cd08709114 cd08709, RGS_RGS2, Regulator of G protein signalin 3e-13
cd08705121 cd08705, RGS_R7-like, Regulator of G protein signa 2e-12
cd07440113 cd07440, RGS, Regulator of G protein signaling (RG 3e-12
cd08711125 cd08711, RGS_RGS8, Regulator of G protein signalin 1e-11
cd08715114 cd08715, RGS_RGS1, Regulator of G protein signalin 2e-11
cd08741113 cd08741, RGS_RGS10, Regulator of G protein signali 3e-11
cd08710114 cd08710, RGS_RGS16, Regulator of G protein signali 2e-10
cd08743129 cd08743, RGS_RGS14, Regulator of G protein signali 5e-08
cd08739121 cd08739, RGS_RGS9, Regulator of G protein signalin 5e-08
cd08716114 cd08716, RGS_RGS13, Regulator of G protein signali 5e-07
cd08742115 cd08742, RGS_RGS12, Regulator of G protein signali 2e-06
cd08737125 cd08737, RGS_RGS6, Regulator of G protein signalin 3e-06
cd08738121 cd08738, RGS_RGS7, Regulator of G protein signalin 2e-05
cd08740126 cd08740, RGS_RGS11, Regulator of G protein signali 3e-05
cd08734109 cd08734, RGS-like_1, Uncharacterized Regulator of 5e-05
cd08707117 cd08707, RGS_Axin, Regulator of G protein signalin 9e-05
cd08728 179 cd08728, RGS-like_2, Uncharacterized Regulator of 0.004
>gnl|CDD|188673 cd08718, RGS_RZ-like, Regulator of G protein signaling (RGS) domain found in the RZ protein Back     alignment and domain information 
 Score =  109 bits (274), Expect = 4e-33
 Identities = 47/56 (83%), Positives = 51/56 (91%)

Query: 13 AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          AGR +FREFLR EYSEEN+LFWLACE+LKKE+N  VIEEKAR IYEDYISILSPKE
Sbjct: 13 AGRNVFREFLRTEYSEENMLFWLACEELKKEANKHVIEEKARLIYEDYISILSPKE 68

The RGS (Regulator of G-protein Signaling) domain is an essential part of the RZ subfamily of the RGS protein family. They are a diverse group of multifunctional proteins that regulate cellular signaling events downstream of G-protein coupled receptors (GPCRs). RGS proteins play critical regulatory roles as GTPase activating proteins (GAPs) of the heterotrimeric G-protein G-alpha-subunits. Deactivation of G-protein signaling is controlled by RGS domains, which accelerate GTPase activity of the alpha subunit by hydrolysis of GTP to GDP, which results in reassociation of the alpha-subunit with the beta-gamma-dimer and inhibition of downstream activity. As a major G-protein regulator, RGS domain containing proteins are involved in many crucial cellular processes such as regulation of intracellular trafficking, glial differentiation, embryonic axis formation, skeletal and muscle development, and cell migration during early embryogenesis. The RZ subfamily of RGS proteins includes RGS17, RGS19 (former GAIP), RGS20, and its splice variant Ret-RGS. Length = 118
>gnl|CDD|188700 cd08746, RGS_RGS20, Regulator of G protein signaling (RGS) domain found in the RGS20 protein Back     alignment and domain information
>gnl|CDD|188698 cd08744, RGS_RGS17, Regulator of G protein signaling (RGS) domain found in the RGS17 protein Back     alignment and domain information
>gnl|CDD|188699 cd08745, RGS_RGS19, Regulator of G protein signaling (RGS) domain found in the RGS19 protein Back     alignment and domain information
>gnl|CDD|216023 pfam00615, RGS, Regulator of G protein signaling domain Back     alignment and domain information
>gnl|CDD|188669 cd08714, RGS_RGS4, Regulator of G protein signaling (RGS) domain found in the RGS4 protein Back     alignment and domain information
>gnl|CDD|188668 cd08713, RGS_RGS3, Regulator of G protein signaling (RGS) domain found in the RGS3 protein Back     alignment and domain information
>gnl|CDD|188672 cd08717, RGS_RGS5, Regulator of G protein signaling (RGS) domain found in the RGS5 protein Back     alignment and domain information
>gnl|CDD|214613 smart00315, RGS, Regulator of G protein signalling domain Back     alignment and domain information
>gnl|CDD|188661 cd08706, RGS_R12-like, Regulator of G protein signaling (RGS) domain found in the R12 subfamily of proteins Back     alignment and domain information
>gnl|CDD|188667 cd08712, RGS_RGS18, Regulator of G protein signaling (RGS) domain found in the RGS18 protein Back     alignment and domain information
>gnl|CDD|188678 cd08723, RGS_RGS21, Regulator of G protein signaling (RGS) domain found in the RGS21 protein Back     alignment and domain information
>gnl|CDD|188664 cd08709, RGS_RGS2, Regulator of G protein signaling (RGS) domain found in the RGS2 protein Back     alignment and domain information
>gnl|CDD|188660 cd08705, RGS_R7-like, Regulator of G protein signaling (RGS) domain found in the R7 subfamily of proteins Back     alignment and domain information
>gnl|CDD|188659 cd07440, RGS, Regulator of G protein signaling (RGS) domain superfamily Back     alignment and domain information
>gnl|CDD|188666 cd08711, RGS_RGS8, Regulator of G protein signaling (RGS) domain found in the RGS8 protein Back     alignment and domain information
>gnl|CDD|188670 cd08715, RGS_RGS1, Regulator of G protein signaling (RGS) domain found in the RGS1 protein Back     alignment and domain information
>gnl|CDD|188695 cd08741, RGS_RGS10, Regulator of G protein signaling (RGS) domain found in the RGS10 protein Back     alignment and domain information
>gnl|CDD|188665 cd08710, RGS_RGS16, Regulator of G protein signaling (RGS) domain found in the RGS16 protein Back     alignment and domain information
>gnl|CDD|188697 cd08743, RGS_RGS14, Regulator of G protein signaling (RGS) domain found in the RGS14 protein Back     alignment and domain information
>gnl|CDD|188693 cd08739, RGS_RGS9, Regulator of G protein signaling (RGS) domain found in the RGS9 protein Back     alignment and domain information
>gnl|CDD|188671 cd08716, RGS_RGS13, Regulator of G protein signaling (RGS) domain found in the RGS13 protein Back     alignment and domain information
>gnl|CDD|188696 cd08742, RGS_RGS12, Regulator of G protein signaling (RGS) domain found in the RGS12 protein Back     alignment and domain information
>gnl|CDD|188691 cd08737, RGS_RGS6, Regulator of G protein signaling (RGS) domain found in the RGS6 protein Back     alignment and domain information
>gnl|CDD|188692 cd08738, RGS_RGS7, Regulator of G protein signaling (RGS) domain found in the RGS7 protein Back     alignment and domain information
>gnl|CDD|188694 cd08740, RGS_RGS11, Regulator of G protein signaling (RGS) domain found in the RGS11 protein Back     alignment and domain information
>gnl|CDD|188688 cd08734, RGS-like_1, Uncharacterized Regulator of G protein Signaling (RGS) domain subfamily, child 1 Back     alignment and domain information
>gnl|CDD|188662 cd08707, RGS_Axin, Regulator of G protein signaling (RGS) domain found in the Axin protein Back     alignment and domain information
>gnl|CDD|188683 cd08728, RGS-like_2, Uncharacterized Regulator of G protein Signaling (RGS) domain subfamily, child 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
KOG3589|consensus221 99.81
smart00315118 RGS Regulator of G protein signalling domain. RGS 99.79
PF00615118 RGS: Regulator of G protein signaling domain; Inte 99.74
PF09128 188 RGS-like: Regulator of G protein signalling-like d 98.3
KOG3590|consensus 602 97.61
KOG3590|consensus 602 97.08
KOG0986|consensus 591 97.03
PF1518269 OTOS: Otospiralin 86.08
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 80.72
>KOG3589|consensus Back     alignment and domain information 
Probab=99.81  E-value=8.7e-20  Score=119.33  Aligned_cols=61  Identities=48%  Similarity=0.822  Sum_probs=57.4

Q ss_pred             HhhChHHHHHHHHHHHhhcchhHHHHHHHHHHHhccCCH--HHHHHHHHHHHHHhcCCCCCCC
Q psy16714          8 RNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNP--DVIEEKARFIYEDYISILSPKE   68 (68)
Q Consensus         8 ll~dp~g~~~F~~FL~~e~s~Enl~Fw~ave~~k~~~~~--~~~~~~a~~Iy~~fi~~~sp~E   68 (68)
                      |++|+.|+..|..||++|||+|||.||++||+||+....  ..+..+|+.||.+||+++||+|
T Consensus        84 L~~~~~G~~~F~~fLk~e~Seeni~FW~ace~~k~~~~~~~~~~~~~a~~i~~~f~~~~ap~~  146 (221)
T KOG3589|consen   84 LLADEAGRAVFAEFLKSEFSEENLEFWLACEEFKKRRSEKSTKMSEKAKEIYEEFSAPAAPKE  146 (221)
T ss_pred             HhhChhhHHHHHHHHHHHhhHhHHHHHHHHHHHHhCcCchhhhhhHHHHHHHHHHhccCCCCC
Confidence            459999999999999999999999999999999998765  5799999999999999999986

>smart00315 RGS Regulator of G protein signalling domain Back     alignment and domain information
>PF00615 RGS: Regulator of G protein signaling domain; InterPro: IPR000342 RGS (Regulator of G Protein Signalling) proteins are multi-functional, GTPase-accelerating proteins that promote GTP hydrolysis by the alpha subunit of heterotrimeric G proteins, thereby inactivating the G protein and rapidly switching off G protein-coupled receptor signalling pathways [] Back     alignment and domain information
>PF09128 RGS-like: Regulator of G protein signalling-like domain; InterPro: IPR015212 This entry represents a domain consisting of twelve helices that fold into a compact structure that contains the overall structural scaffold observed in other regulator of G protein signalling (RGS) proteins and three additional helical elements that pack closely to it Back     alignment and domain information
>KOG3590|consensus Back     alignment and domain information
>KOG3590|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>PF15182 OTOS: Otospiralin Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
1zv4_X158 Structure Of The Regulator Of G-Protein Signaling 1 7e-23
1cmz_A152 Solution Structure Of Gaip (Galpha Interacting Prot 1e-20
2v4z_B142 The Crystal Structure Of The Human G-Protein Subuni 7e-12
2af0_A146 Structure Of The Regulator Of G-Protein Signaling D 4e-11
4ekc_B137 Structure Of Human Regulator Of G Protein Signaling 5e-11
2jm5_A151 Solution Structure Of The Rgs Domain From Human Rgs 6e-11
2dlv_A140 Solution Structure Of The Rgs Domain Of Human Regul 6e-11
2crp_A150 Solution Structure Of The Rgs Domain Of Regulator O 1e-10
2ihb_B153 Crystal Structure Of The Heterodimeric Complex Of H 2e-10
2i59_A138 Solution Structure Of Rgs10 Length = 138 2e-10
2dlr_A149 Solution Structure Of The Rgs Domain Of Human Regul 3e-10
1agr_E205 Complex Of Alf4-Activated Gi-Alpha-1 With Rgs4 Leng 2e-09
2oj4_A127 Crystal Structure Of Rgs3 Rgs Domain Length = 127 3e-09
1ezt_A166 High-Resolution Solution Structure Of Free Rgs4 By 3e-09
2ode_B141 Crystal Structure Of The Heterodimeric Complex Of H 3e-09
2ihd_A155 Crystal Structure Of Human Regulator Of G-Protein S 4e-09
3c7l_A137 Molecular Architecture Of Galphao And The Structura 3e-08
3c7k_B129 Molecular Architecture Of Galphao And The Structura 3e-08
2bt2_A161 Structure Of The Regulator Of G-Protein Signaling 1 9e-08
2ik8_B140 Crystal Structure Of The Heterodimeric Complex Of H 9e-08
2bv1_A145 Regulator Of G-Protein Signalling 1 (Human) Length 5e-07
1fqj_B147 Crystal Structure Of The Heterotrimeric Complex Of 1e-05
1fqi_A147 Rgs9 Rgs Domain Length = 147 1e-05
2es0_A148 Structure Of The Regulator Of G-Protein Signaling D 2e-05
2pbi_A424 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 4e-05
2jnu_A154 Solution Structure Of The Rgs Domain Of Human Rgs14 5e-05
2a72_A146 Structure Of The Regulator Of G-Protein Signaling D 6e-05
2d9j_A139 Solution Structure Of The Rgs Domain Of Regulator O 7e-05
2ebz_A155 Solution Structure Of The Rgs Domain From Human Reg 3e-04
>pdb|1ZV4|X Chain X, Structure Of The Regulator Of G-Protein Signaling 17 (Rgsz2) Length = 158 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (253), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 49/56 (87%), Positives = 50/56 (89%)
Query: 13  AGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
           AGR LFREFLR EYSEEN+LFWLACEDLKKE N  VIEEKAR IYEDYISILSPKE
Sbjct: 45  AGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKE 100
>pdb|1CMZ|A Chain A, Solution Structure Of Gaip (Galpha Interacting Protein): A Regulator Of G Protein Signaling Length = 152 Back     alignment and structure
>pdb|2V4Z|B Chain B, The Crystal Structure Of The Human G-Protein Subunit Alpha ( Gnai3) In Complex With An Engineered Regulator Of G- Protein Signaling Type 2 Domain (Rgs2) Length = 142 Back     alignment and structure
>pdb|2AF0|A Chain A, Structure Of The Regulator Of G-Protein Signaling Domain Of Rgs2 Length = 146 Back     alignment and structure
>pdb|4EKC|B Chain B, Structure Of Human Regulator Of G Protein Signaling 2 (rgs2) In Complex With Murine Galpha-q(r183c) Length = 137 Back     alignment and structure
>pdb|2JM5|A Chain A, Solution Structure Of The Rgs Domain From Human Rgs18 Length = 151 Back     alignment and structure
>pdb|2DLV|A Chain A, Solution Structure Of The Rgs Domain Of Human Regulator Of G-Protein Signaling 18 Length = 140 Back     alignment and structure
>pdb|2CRP|A Chain A, Solution Structure Of The Rgs Domain Of Regulator Of G- Protein Signalling 5 (Rgs 5) Length = 150 Back     alignment and structure
>pdb|2IHB|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs10 And Activated Gi Alpha 3 Length = 153 Back     alignment and structure
>pdb|2I59|A Chain A, Solution Structure Of Rgs10 Length = 138 Back     alignment and structure
>pdb|2DLR|A Chain A, Solution Structure Of The Rgs Domain Of Human Regulator Of G-Protein Signaling 10 Length = 149 Back     alignment and structure
>pdb|1AGR|E Chain E, Complex Of Alf4-Activated Gi-Alpha-1 With Rgs4 Length = 205 Back     alignment and structure
>pdb|2OJ4|A Chain A, Crystal Structure Of Rgs3 Rgs Domain Length = 127 Back     alignment and structure
>pdb|1EZT|A Chain A, High-Resolution Solution Structure Of Free Rgs4 By Nmr Length = 166 Back     alignment and structure
>pdb|2ODE|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs8 And Activated Gi Alpha 3 Length = 141 Back     alignment and structure
>pdb|2IHD|A Chain A, Crystal Structure Of Human Regulator Of G-Protein Signaling 8, Rgs8 Length = 155 Back     alignment and structure
>pdb|3C7L|A Chain A, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 137 Back     alignment and structure
>pdb|3C7K|B Chain B, Molecular Architecture Of Galphao And The Structural Basis For Rgs16-Mediated Deactivation Length = 129 Back     alignment and structure
>pdb|2BT2|A Chain A, Structure Of The Regulator Of G-Protein Signaling 16 Length = 161 Back     alignment and structure
>pdb|2IK8|B Chain B, Crystal Structure Of The Heterodimeric Complex Of Human Rgs16 And Activated Gi Alpha 1 Length = 140 Back     alignment and structure
>pdb|2BV1|A Chain A, Regulator Of G-Protein Signalling 1 (Human) Length = 145 Back     alignment and structure
>pdb|1FQJ|B Chain B, Crystal Structure Of The Heterotrimeric Complex Of The Rgs Domain Of Rgs9, The Gamma Subunit Of Phosphodiesterase And The GtI1 CHIMERA ALPHA SUBUNIT [(RGS9)-(Pdegamma)- (GtI1ALPHA)-(Gdp)-(Alf4-)-(Mg2+)] Length = 147 Back     alignment and structure
>pdb|1FQI|A Chain A, Rgs9 Rgs Domain Length = 147 Back     alignment and structure
>pdb|2ES0|A Chain A, Structure Of The Regulator Of G-Protein Signaling Domain Of Rgs6 Length = 148 Back     alignment and structure
>pdb|2PBI|A Chain A, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 424 Back     alignment and structure
>pdb|2JNU|A Chain A, Solution Structure Of The Rgs Domain Of Human Rgs14 Length = 154 Back     alignment and structure
>pdb|2A72|A Chain A, Structure Of The Regulator Of G-Protein Signaling Domain Of Rgs7 Length = 146 Back     alignment and structure
>pdb|2D9J|A Chain A, Solution Structure Of The Rgs Domain Of Regulator Of G- Protein Signaling 7 Length = 139 Back     alignment and structure
>pdb|2EBZ|A Chain A, Solution Structure Of The Rgs Domain From Human Regulator Of G-Protein Signaling 12 (Rgs12) Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
2dlr_A149 RGS10, regulator of G-protein signaling 10; RGS do 4e-16
2ihd_A155 RGS8, regulator of G-protein signaling 8; signalin 5e-16
1zv4_X158 RGS17, regulator of G-protein signaling 17; human 8e-16
1cmz_A152 Protein (GAIP (G-alpha interacting) protein); RGS, 1e-15
2jnu_A154 RGS14, regulator of G-protein signaling 14; regula 3e-15
2ihb_B153 Regulator of G-protein signalling 10, guanine nucl 3e-15
2crp_A150 RGS5, regulator of G-protein signaling 5; RGS doma 4e-15
3c7l_A137 Regulator of G-protein signaling 16; RGS, RGS16, G 7e-15
2ebz_A155 RGS12, regulator of G-protein signaling 12; RGS do 7e-15
2dlv_A140 RGS18, regulator of G-protein signaling 18; RGS do 1e-14
2pbi_A424 Regulator of G-protein signaling 9; helix WRAP, RG 2e-14
2jm5_A151 RGS18, regulator of G-protein signaling 18; signal 3e-14
2af0_A146 Regulator of G-protein signaling 2; helix, structu 3e-14
2bv1_A145 Regulator of G-protein signalling 1; RGS1, RGS, st 4e-14
2a72_A146 Regulator of G-protein signalling 7; human RGS7, r 4e-14
1agr_E205 RGS4; GI-alpha-1, hydrolase, signal transduction, 7e-14
2oj4_A127 RGS3, regulator of G-protein signaling 3, RGP3; RG 7e-14
1fqi_A147 RGS9, regulator of G-protein signaling 9; phototra 1e-13
1dk8_A147 Axin; alpha-helix, PI-helix, signaling protein; HE 1e-12
>2dlr_A RGS10, regulator of G-protein signaling 10; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 66.6 bits (162), Expect = 4e-16
 Identities = 28/57 (49%), Positives = 39/57 (68%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
            G K FREFL+ E+SEEN+LFWLACED KK  +   ++EKA+ IY  ++S  +  +
Sbjct: 26 PEGVKRFREFLKKEFSEENVLFWLACEDFKKMQDKTQMQEKAKEIYMTFLSSKASSQ 82
>2ihd_A RGS8, regulator of G-protein signaling 8; signaling protein, structural genomics, structura genomics consortium, SGC, signaling protein; 1.70A {Homo sapiens} PDB: 2ode_B* 2bt2_A Length = 155 Back     alignment and structure
>1zv4_X RGS17, regulator of G-protein signaling 17; human RGSZ2, human RGS17(Z2), regulator of G-protein signali opioid receptor interacting protein; 2.40A {Homo sapiens} Length = 158 Back     alignment and structure
>1cmz_A Protein (GAIP (G-alpha interacting) protein); RGS, regulator of G protein, signaling protein regulation; NMR {Homo sapiens} SCOP: a.91.1.1 Length = 152 Back     alignment and structure
>2jnu_A RGS14, regulator of G-protein signaling 14; regulator of G-protein signalling domain, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Length = 154 Back     alignment and structure
>2ihb_B Regulator of G-protein signalling 10, guanine nucleotide-binding protein G(K) subunit A; RGS, heterotrimeric G protein, signall complex; HET: GDP; 2.71A {Homo sapiens} PDB: 2i59_A Length = 153 Back     alignment and structure
>2crp_A RGS5, regulator of G-protein signaling 5; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 150 Back     alignment and structure
>3c7l_A Regulator of G-protein signaling 16; RGS, RGS16, GAP, GTPase activating protein, heterotrimeric G-protein, lipoprotein, palmitate, phosphoprotein; 1.89A {Mus musculus} PDB: 3c7k_B* 2ik8_B* Length = 137 Back     alignment and structure
>2ebz_A RGS12, regulator of G-protein signaling 12; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlv_A RGS18, regulator of G-protein signaling 18; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2pbi_A Regulator of G-protein signaling 9; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 424 Back     alignment and structure
>2jm5_A RGS18, regulator of G-protein signaling 18; signaling protein, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} SCOP: a.91.1.1 PDB: 2owi_A Length = 151 Back     alignment and structure
>2af0_A Regulator of G-protein signaling 2; helix, structural genomics, structural genomics consortium, SGC, signaling protein; 2.30A {Homo sapiens} PDB: 2v4z_B* Length = 146 Back     alignment and structure
>2bv1_A Regulator of G-protein signalling 1; RGS1, RGS, structural genomics, struct genomics consortium, B-cell activation, phosphorylation; 2.0A {Homo sapiens} PDB: 2gtp_C* Length = 145 Back     alignment and structure
>2a72_A Regulator of G-protein signalling 7; human RGS7, regulator of G-protein signaling 7, GTPase-activ proteins (GAP), structural genomics; 2.00A {Homo sapiens} PDB: 2d9j_A 2es0_A Length = 146 Back     alignment and structure
>1agr_E RGS4; GI-alpha-1, hydrolase, signal transduction, complex (signal transduction/regulator), GTP-binding, GTPase activating protein; HET: GDP CIT; 2.80A {Rattus norvegicus} SCOP: a.91.1.1 PDB: 1ezt_A 1ezy_A Length = 205 Back     alignment and structure
>2oj4_A RGS3, regulator of G-protein signaling 3, RGP3; RGS domain, signaling protein inhibitor; 2.30A {Homo sapiens} Length = 127 Back     alignment and structure
>1fqi_A RGS9, regulator of G-protein signaling 9; phototransduction, ROD, GAP, signaling protein; 1.94A {Bos taurus} SCOP: a.91.1.1 PDB: 1fqj_B* 1fqk_B* Length = 147 Back     alignment and structure
>1dk8_A Axin; alpha-helix, PI-helix, signaling protein; HET: SO4; 1.57A {Homo sapiens} SCOP: a.91.1.1 PDB: 1emu_A Length = 147 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
2oj4_A127 RGS3, regulator of G-protein signaling 3, RGP3; RG 99.87
3c7l_A137 Regulator of G-protein signaling 16; RGS, RGS16, G 99.86
2dlv_A140 RGS18, regulator of G-protein signaling 18; RGS do 99.86
2af0_A146 Regulator of G-protein signaling 2; helix, structu 99.86
2ihd_A155 RGS8, regulator of G-protein signaling 8; signalin 99.85
2jm5_A151 RGS18, regulator of G-protein signaling 18; signal 99.85
1zv4_X158 RGS17, regulator of G-protein signaling 17; human 99.85
2crp_A150 RGS5, regulator of G-protein signaling 5; RGS doma 99.85
2ihb_B153 Regulator of G-protein signalling 10, guanine nucl 99.85
2dlr_A149 RGS10, regulator of G-protein signaling 10; RGS do 99.85
1cmz_A152 Protein (GAIP (G-alpha interacting) protein); RGS, 99.85
2ebz_A155 RGS12, regulator of G-protein signaling 12; RGS do 99.84
2bv1_A145 Regulator of G-protein signalling 1; RGS1, RGS, st 99.84
2jnu_A154 RGS14, regulator of G-protein signaling 14; regula 99.84
2a72_A146 Regulator of G-protein signalling 7; human RGS7, r 99.83
1fqi_A147 RGS9, regulator of G-protein signaling 9; phototra 99.83
1dk8_A147 Axin; alpha-helix, PI-helix, signaling protein; HE 99.83
1agr_E205 RGS4; GI-alpha-1, hydrolase, signal transduction, 99.82
2pbi_A424 Regulator of G-protein signaling 9; helix WRAP, RG 99.75
3cx8_B 203 RHO guanine nucleotide exchange factor 11; signal 98.33
1iap_A 211 Guanine nucleotide exchange factor P115rhogef; RGS 98.15
3ab3_B 246 RHO guanine nucleotide exchange factor 1; signal t 97.78
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 97.45
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 97.23
4gou_A 518 EHRGS-rhogef; RGS domain, DH domain, PH domain, RH 96.21
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 92.62
>2oj4_A RGS3, regulator of G-protein signaling 3, RGP3; RGS domain, signaling protein inhibitor; 2.30A {Homo sapiens} Back     alignment and structure
Probab=99.87  E-value=4.4e-22  Score=118.56  Aligned_cols=61  Identities=46%  Similarity=0.766  Sum_probs=57.9

Q ss_pred             HhhChHHHHHHHHHHHhhcchhHHHHHHHHHHHhccCCHHHHHHHHHHHHHHhcCCCCCCC
Q psy16714          8 RNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE   68 (68)
Q Consensus         8 ll~dp~g~~~F~~FL~~e~s~Enl~Fw~ave~~k~~~~~~~~~~~a~~Iy~~fi~~~sp~E   68 (68)
                      +|+||.|+..|+.||++++|+|||.||.+|++||...+...+...|..||++||+++||+|
T Consensus        14 iL~~~~g~~~F~~Fl~~e~~~enl~Fw~~ve~~k~~~~~~~~~~~a~~I~~~yi~~~s~~e   74 (127)
T 2oj4_A           14 LLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKE   74 (127)
T ss_dssp             HHTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHTSTTCTTC
T ss_pred             HHCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHccCCCCcC
Confidence            5699999999999999999999999999999999987777899999999999999999986
>3c7l_A Regulator of G-protein signaling 16; RGS, RGS16, GAP, GTPase activating protein, heterotrimeric G-protein, lipoprotein, palmitate, phosphoprotein; 1.89A {Mus musculus} PDB: 3c7k_B* 2ik8_B* Back     alignment and structure
>2dlv_A RGS18, regulator of G-protein signaling 18; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2af0_A Regulator of G-protein signaling 2; helix, structural genomics, structural genomics consortium, SGC, signaling protein; 2.30A {Homo sapiens} PDB: 2v4z_B* Back     alignment and structure
>2ihd_A RGS8, regulator of G-protein signaling 8; signaling protein, structural genomics, structura genomics consortium, SGC, signaling protein; 1.70A {Homo sapiens} PDB: 2ode_B* 2bt2_A Back     alignment and structure
>2jm5_A RGS18, regulator of G-protein signaling 18; signaling protein, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} SCOP: a.91.1.1 PDB: 2owi_A Back     alignment and structure
>1zv4_X RGS17, regulator of G-protein signaling 17; human RGSZ2, human RGS17(Z2), regulator of G-protein signali opioid receptor interacting protein; 2.40A {Homo sapiens} Back     alignment and structure
>2crp_A RGS5, regulator of G-protein signaling 5; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ihb_B Regulator of G-protein signalling 10, guanine nucleotide-binding protein G(K) subunit A; RGS, heterotrimeric G protein, signall complex; HET: GDP; 2.71A {Homo sapiens} PDB: 2i59_A Back     alignment and structure
>2dlr_A RGS10, regulator of G-protein signaling 10; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1cmz_A Protein (GAIP (G-alpha interacting) protein); RGS, regulator of G protein, signaling protein regulation; NMR {Homo sapiens} SCOP: a.91.1.1 Back     alignment and structure
>2ebz_A RGS12, regulator of G-protein signaling 12; RGS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bv1_A Regulator of G-protein signalling 1; RGS1, RGS, structural genomics, struct genomics consortium, B-cell activation, phosphorylation; 2.0A {Homo sapiens} PDB: 2gtp_C* Back     alignment and structure
>2jnu_A RGS14, regulator of G-protein signaling 14; regulator of G-protein signalling domain, structural genomics, structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2a72_A Regulator of G-protein signalling 7; human RGS7, regulator of G-protein signaling 7, GTPase-activ proteins (GAP), structural genomics; 2.00A {Homo sapiens} PDB: 2d9j_A 2es0_A Back     alignment and structure
>1fqi_A RGS9, regulator of G-protein signaling 9; phototransduction, ROD, GAP, signaling protein; 1.94A {Bos taurus} SCOP: a.91.1.1 PDB: 1fqj_B* 1fqk_B* Back     alignment and structure
>1dk8_A Axin; alpha-helix, PI-helix, signaling protein; HET: SO4; 1.57A {Homo sapiens} SCOP: a.91.1.1 PDB: 1emu_A Back     alignment and structure
>1agr_E RGS4; GI-alpha-1, hydrolase, signal transduction, complex (signal transduction/regulator), GTP-binding, GTPase activating protein; HET: GDP CIT; 2.80A {Rattus norvegicus} SCOP: a.91.1.1 PDB: 1ezt_A 1ezy_A Back     alignment and structure
>2pbi_A Regulator of G-protein signaling 9; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3cx8_B RHO guanine nucleotide exchange factor 11; signal transduction, protein complex, GTP-binding, lipoprotein, membrane, nucleotide-binding; HET: GSP; 2.00A {Rattus norvegicus} PDB: 3cx6_B* 3cx7_B* 1htj_F Back     alignment and structure
>1iap_A Guanine nucleotide exchange factor P115rhogef; RGS, RGRGS, signaling protein; 1.90A {Homo sapiens} SCOP: a.91.1.1 Back     alignment and structure
>3ab3_B RHO guanine nucleotide exchange factor 1; signal transduction, protein complex, GTP-binding, membrane, transducer, lipoprotein, nucleotide-binding; HET: GDP; 2.40A {Homo sapiens} PDB: 1shz_C* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4gou_A EHRGS-rhogef; RGS domain, DH domain, PH domain, RHO guanine nucleotide EXC factor, signaling protein, GTPase accelerating protein; 2.30A {Entamoeba histolytica} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 68
d2jm5a1132 a.91.1.1 (A:3-134) Regulator of G-protein signalin 3e-14
d1agre_128 a.91.1.1 (E:) Regulator of G-protein signaling 4, 3e-14
d1cmza_128 a.91.1.1 (A:) Galpha interacting protein, GaIP {Hu 3e-14
d2ik8b1116 a.91.1.1 (B:65-180) Regulator of G-protein signali 9e-14
d1dk8a_147 a.91.1.1 (A:) Axin RGS-homologous domain {Human (H 2e-13
d1omwa1157 a.91.1.1 (A:29-185) G-protein coupled receptor kin 7e-13
d1fqia_138 a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [ 5e-12
d1htjf_ 182 a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (H 6e-11
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure

class: All alpha proteins
fold: Regulator of G-protein signaling, RGS
superfamily: Regulator of G-protein signaling, RGS
family: Regulator of G-protein signaling, RGS
domain: Regulator of G-protein signaling 18, RGS18
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.4 bits (146), Expect = 3e-14
 Identities = 29/57 (50%), Positives = 37/57 (64%)

Query: 12 KAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE 68
          + G + F  FL+ E+SEENI FW+ACED KK   P  I  KA+ IYE +I   +PKE
Sbjct: 20 RDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYEKFIQTDAPKE 76
>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 128 Back     information, alignment and structure
>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1dk8a_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Length = 157 Back     information, alignment and structure
>d1fqia_ a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} Length = 138 Back     information, alignment and structure
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d2ik8b1116 Regulator of G-protein signaling 16, RGS16 {Human 99.86
d1htjf_ 182 Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [ 99.86
d2jm5a1132 Regulator of G-protein signaling 18, RGS18 {Human 99.83
d1agre_128 Regulator of G-protein signaling 4, RGS4 {Rat (Rat 99.83
d1cmza_128 Galpha interacting protein, GaIP {Human (Homo sapi 99.82
d1dk8a_147 Axin RGS-homologous domain {Human (Homo sapiens) [ 99.81
d1omwa1157 G-protein coupled receptor kinase 2, N-terminal do 99.8
d1fqia_138 RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1iapa_ 190 p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} 98.22
>d2ik8b1 a.91.1.1 (B:65-180) Regulator of G-protein signaling 16, RGS16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Regulator of G-protein signaling, RGS
superfamily: Regulator of G-protein signaling, RGS
family: Regulator of G-protein signaling, RGS
domain: Regulator of G-protein signaling 16, RGS16
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=1.1e-21  Score=114.09  Aligned_cols=61  Identities=41%  Similarity=0.733  Sum_probs=57.8

Q ss_pred             HhhChHHHHHHHHHHHhhcchhHHHHHHHHHHHhccCCHHHHHHHHHHHHHHhcCCCCCCC
Q psy16714          8 RNTFKAGRKLFREFLRCEYSEENILFWLACEDLKKESNPDVIEEKARFIYEDYISILSPKE   68 (68)
Q Consensus         8 ll~dp~g~~~F~~FL~~e~s~Enl~Fw~ave~~k~~~~~~~~~~~a~~Iy~~fi~~~sp~E   68 (68)
                      +|.||.|+..|++||++++|+|||.||++|++||...+..++...|+.||++||+++||.+
T Consensus         5 iL~d~~~~~~F~~FL~~~~~~e~L~Fw~~ve~~~~~~~~~~~~~~a~~Iy~~yi~~~s~~~   65 (116)
T d2ik8b1           5 LLSSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHQIFEEFICSEAPKE   65 (116)
T ss_dssp             HHHSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHTSTTCTTC
T ss_pred             HHcChHHHHHHHHHHhHhcCHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHhcCCCCCc
Confidence            4599999999999999999999999999999999988887889999999999999999975
>d1htjf_ a.91.1.1 (F:) Pdz-RhoGEF RGS-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jm5a1 a.91.1.1 (A:3-134) Regulator of G-protein signaling 18, RGS18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dk8a_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa1 a.91.1.1 (A:29-185) G-protein coupled receptor kinase 2, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fqia_ a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iapa_ a.91.1.1 (A:) p115RhoGEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure