Psyllid ID: psy16719
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 197 | ||||||
| 270009257 | 501 | cytochrome P450-like protein [Tribolium | 0.857 | 0.337 | 0.438 | 2e-36 | |
| 223976197 | 512 | CYP4CD1 [Liposcelis bostrychophila] | 0.852 | 0.328 | 0.430 | 1e-35 | |
| 307170230 | 508 | Cytochrome P450 4C1 [Camponotus floridan | 0.802 | 0.311 | 0.432 | 2e-35 | |
| 307181862 | 472 | Cytochrome P450 4V3 [Camponotus floridan | 0.847 | 0.353 | 0.410 | 6e-35 | |
| 340722435 | 560 | PREDICTED: cytochrome P450 4g15-like [Bo | 0.847 | 0.298 | 0.416 | 2e-34 | |
| 350416638 | 560 | PREDICTED: cytochrome P450 4g15-like [Bo | 0.847 | 0.298 | 0.416 | 2e-34 | |
| 5263306 | 501 | family 4 cytochrome P450 [Coptotermes ac | 0.827 | 0.325 | 0.437 | 3e-34 | |
| 307205534 | 356 | Cytochrome P450 4C1 [Harpegnathos saltat | 0.862 | 0.477 | 0.433 | 3e-34 | |
| 345485110 | 380 | PREDICTED: cytochrome P450 4C1 [Nasonia | 0.862 | 0.447 | 0.404 | 5e-34 | |
| 332024894 | 558 | Cytochrome P450 4C1 [Acromyrmex echinati | 0.847 | 0.299 | 0.416 | 9e-34 |
| >gi|270009257|gb|EFA05705.1| cytochrome P450-like protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 157 bits (397), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 75/171 (43%), Positives = 109/171 (63%), Gaps = 2/171 (1%)
Query: 27 RVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPVIARSAPYEVQCGDYT 86
+V EL+ + G + D PT + + +L+ L RVIKET RLFP P+ RSA ++++ YT
Sbjct: 328 KVSEELKTIFG-TDDRQPTLEDINKLEYLERVIKETFRLFPVVPMFIRSADHDIKFDCYT 386
Query: 87 IPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKY 146
IPAG+ I I I+ L++ P+ WN P +FDPDRFLP +S+R+ ++PFS GPR C+G KY
Sbjct: 387 IPAGSIILIPIFQLNKKPEFWNEPQKFDPDRFLPENNSNRHRCTFIPFSYGPRNCLGLKY 446
Query: 147 AMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 197
M+ MK +ST+LR Y I P K L DI FG+ + G +++E +
Sbjct: 447 GMMSMKVVLSTVLRNYTIKPT-VYKKLDDIEMIFGIVNKPSLGFKVKLEKK 496
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|223976197|gb|ACI25370.2| CYP4CD1 [Liposcelis bostrychophila] | Back alignment and taxonomy information |
|---|
| >gi|307170230|gb|EFN62598.1| Cytochrome P450 4C1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307181862|gb|EFN69302.1| Cytochrome P450 4V3 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340722435|ref|XP_003399611.1| PREDICTED: cytochrome P450 4g15-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350416638|ref|XP_003491030.1| PREDICTED: cytochrome P450 4g15-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|5263306|gb|AAC03111.2| family 4 cytochrome P450 [Coptotermes acinaciformis] | Back alignment and taxonomy information |
|---|
| >gi|307205534|gb|EFN83839.1| Cytochrome P450 4C1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|345485110|ref|XP_001602979.2| PREDICTED: cytochrome P450 4C1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332024894|gb|EGI65082.1| Cytochrome P450 4C1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 197 | ||||||
| FB|FBgn0035344 | 510 | Cyp4d20 "Cyp4d20" [Drosophila | 0.827 | 0.319 | 0.465 | 6.3e-32 | |
| FB|FBgn0015032 | 535 | Cyp4c3 "Cytochrome P450-4c3" [ | 0.852 | 0.314 | 0.397 | 5.3e-31 | |
| FB|FBgn0030304 | 574 | Cyp4g15 "Cyp4g15" [Drosophila | 0.847 | 0.290 | 0.398 | 1.1e-30 | |
| FB|FBgn0031925 | 511 | Cyp4d21 "Cyp4d21" [Drosophila | 0.883 | 0.340 | 0.372 | 3.3e-29 | |
| UNIPROTKB|Q6ZWL3 | 525 | CYP4V2 "Cytochrome P450 4V2" [ | 0.827 | 0.310 | 0.414 | 4e-29 | |
| UNIPROTKB|Q5RCN6 | 525 | CYP4V2 "Cytochrome P450 4V2" [ | 0.827 | 0.310 | 0.414 | 4e-29 | |
| FB|FBgn0031695 | 509 | Cyp4ac3 "Cyp4ac3" [Drosophila | 0.842 | 0.326 | 0.397 | 7.1e-29 | |
| FB|FBgn0010019 | 556 | Cyp4g1 "Cytochrome P450-4g1" [ | 0.852 | 0.302 | 0.358 | 2e-28 | |
| UNIPROTKB|E1BYW5 | 530 | CYP4V2 "Uncharacterized protei | 0.847 | 0.315 | 0.358 | 9.5e-28 | |
| FB|FBgn0023541 | 507 | Cyp4d14 "Cyp4d14" [Drosophila | 0.878 | 0.341 | 0.367 | 9.5e-28 |
| FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 350 (128.3 bits), Expect = 6.3e-32, P = 6.3e-32
Identities = 81/174 (46%), Positives = 106/174 (60%)
Query: 27 RVYHELQDVLGDSPD-SAP-TYDQLQRLDLLTRVIKETMRLFPAAPVIARSAPYEVQCGD 84
R++ ELQ VLG PD SAP T QLQ L L VIKETMRL+P P I R A E++ GD
Sbjct: 341 RIFEELQRVLG--PDASAPVTQAQLQDLKYLDCVIKETMRLYPPVPAIGRHAQKELEIGD 398
Query: 85 YTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGS 144
TIPA SI + +Y HR + +P F P+RFL Q N YVPFS GP+ CIG
Sbjct: 399 KTIPANTSIYLVLYYAHRDANYFPDPLSFRPERFLEDQEQGHNTFAYVPFSAGPKNCIGQ 458
Query: 145 KYAMLQMKTTISTILRRYKILP-GDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 197
K+A+L+MK IS +LR Y++LP G++ K + + F +RS G ++ + PR
Sbjct: 459 KFAVLEMKVLISKVLRFYELLPLGEELKPM--LNF----ILRSASGINVGLRPR 506
|
|
| FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0030304 Cyp4g15 "Cyp4g15" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6ZWL3 CYP4V2 "Cytochrome P450 4V2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RCN6 CYP4V2 "Cytochrome P450 4V2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031695 Cyp4ac3 "Cyp4ac3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0010019 Cyp4g1 "Cytochrome P450-4g1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0023541 Cyp4d14 "Cyp4d14" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 197 | |||
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 7e-43 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 5e-31 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 3e-29 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 6e-27 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 5e-23 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 6e-22 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 7e-22 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 3e-19 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 2e-17 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 3e-15 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 3e-14 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 3e-14 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 1e-13 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 2e-13 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 6e-12 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 7e-12 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 1e-11 | |
| PLN03018 | 534 | PLN03018, PLN03018, homomethionine N-hydroxylase | 2e-11 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 3e-11 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 7e-11 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 2e-10 | |
| PLN02971 | 543 | PLN02971, PLN02971, tryptophan N-hydroxylase | 2e-10 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 2e-08 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 5e-06 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 1e-05 | |
| PLN02774 | 463 | PLN02774, PLN02774, brassinosteroid-6-oxidase | 9e-05 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
Score = 148 bits (377), Expect = 7e-43
Identities = 51/141 (36%), Positives = 83/141 (58%), Gaps = 3/141 (2%)
Query: 27 RVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPV-IARSAPYEVQCGDY 85
++ E+ +V+GD +PTYD LQ + L VIKET+RL P P+ + R + Y
Sbjct: 297 KLREEIDEVIGD--KRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGY 354
Query: 86 TIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSK 145
IP G + + +Y LHR P+++ NP +FDP+RFL R ++PF GPR C+G +
Sbjct: 355 LIPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCLGER 414
Query: 146 YAMLQMKTTISTILRRYKILP 166
A ++MK ++T+L+ +++
Sbjct: 415 LARMEMKLFLATLLQNFEVEL 435
|
Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461 |
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| KOG0158|consensus | 499 | 100.0 | ||
| KOG0157|consensus | 497 | 100.0 | ||
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 100.0 | |
| KOG0159|consensus | 519 | 100.0 | ||
| KOG0156|consensus | 489 | 100.0 | ||
| PLN02971 | 543 | tryptophan N-hydroxylase | 100.0 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 100.0 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 100.0 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 100.0 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 100.0 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 100.0 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 100.0 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 100.0 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 100.0 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 100.0 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 100.0 | |
| PLN02655 | 466 | ent-kaurene oxidase | 100.0 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 100.0 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 100.0 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 100.0 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 100.0 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 100.0 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 100.0 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 100.0 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 100.0 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 100.0 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 100.0 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 100.0 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 100.0 | |
| KOG0684|consensus | 486 | 100.0 | ||
| PLN02648 | 480 | allene oxide synthase | 100.0 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 100.0 |
| >KOG0158|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.4e-54 Score=360.69 Aligned_cols=194 Identities=29% Similarity=0.596 Sum_probs=177.3
Q ss_pred CCCcchhhhHHHHhhhHHhhChhHHHHHHHHHHHHhCCCCCCCCCHHhhccChHHHHHHHHHhcCCCCCccceeecCcee
Q psy16719 1 MFGVDFEIQRNHYSQHPYLEAVESSFRVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPVIARSAPYEV 80 (197)
Q Consensus 1 ~ag~~t~~~~~~~~l~~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~~~~~~~~r~~~~~~ 80 (197)
+||.||||++|++++|+|++||++|+|+++||+++..+..+ + +++.+.+|+||++||+||||+||+++.+.|.+.+|+
T Consensus 304 ~AGfeTts~tlsf~lYeLA~~PdvQ~kLreEI~~~~~~~~~-l-tyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~ 381 (499)
T KOG0158|consen 304 LAGFETTASTLSFALYELAKNPDVQDKLREEIDEVLEEKEG-L-TYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDY 381 (499)
T ss_pred HhhhHhHHHHHHHHHHHHhcChHHHHHHHHHHHHHhcccCC-C-CHHHHhCCcHHHHHHHHHHhhCCCcccccceecCce
Confidence 59999999999999999999999999999999999765433 6 999999999999999999999999999999999999
Q ss_pred ecC-CEEeCCCCEEEecchhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCcCCccHHHHHHHHHHHHHHHh
Q psy16719 81 QCG-DYTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTIL 159 (197)
Q Consensus 81 ~~~-g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll 159 (197)
++. ++.|++|+.|.++++++||||++|+||++|+||||.+++.+...+..|+|||.|||+|+|.+||++|+|+.++.||
T Consensus 382 ~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL 461 (499)
T KOG0158|consen 382 EIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLL 461 (499)
T ss_pred ecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHHHH
Confidence 999 9999999999999999999999999999999999998887677889999999999999999999999999999999
Q ss_pred hhCeEeeCCCCCCcccceeecceeEeeCCCceeEEEeC
Q psy16719 160 RRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 197 (197)
Q Consensus 160 ~~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R 197 (197)
++|+++..+.. .+.......+.++.|++++++++++|
T Consensus 462 ~~f~~~~~~~t-~~~~~~~~~~~~l~pk~gi~Lkl~~r 498 (499)
T KOG0158|consen 462 RNFSFEVCPTT-IIPLEGDPKGFTLSPKGGIWLKLEPR 498 (499)
T ss_pred hhCEEecCCcc-cCcccCCccceeeecCCceEEEEEeC
Confidence 99999999841 12211112278899999999999987
|
|
| >KOG0157|consensus | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >KOG0159|consensus | Back alignment and domain information |
|---|
| >KOG0156|consensus | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >KOG0684|consensus | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 197 | ||||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 1e-22 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 1e-22 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 1e-22 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 3e-17 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 3e-17 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 3e-17 | ||
| 3k9v_A | 482 | Crystal Structure Of Rat Mitochondrial P450 24a1 S5 | 3e-15 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 2e-14 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 2e-14 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 3e-14 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 4e-14 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 4e-14 | ||
| 3ebs_A | 476 | Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C | 4e-14 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 4e-14 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 4e-14 | ||
| 3eqm_A | 503 | Crystal Structure Of Human Placental Aromatase Cyto | 5e-14 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 1e-13 | ||
| 4dtw_B | 469 | Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto | 3e-13 | ||
| 3na0_A | 471 | Crystal Structure Of Human Cyp11a1 In Complex With | 5e-13 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 6e-13 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 6e-13 | ||
| 3n9y_A | 487 | Crystal Structure Of Human Cyp11a1 In Complex With | 6e-13 | ||
| 3mzs_A | 486 | Crystal Structure Of Cytochrome P450 Cyp11a1 In Com | 6e-13 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 1e-12 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 1e-12 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-12 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 1e-12 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 1e-12 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 1e-12 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-12 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 1e-12 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-12 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 1e-12 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 1e-12 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 1e-12 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 1e-12 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 1e-12 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 1e-12 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 1e-12 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 1e-12 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 1e-12 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 1e-12 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 1e-12 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 1e-12 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 1e-12 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 1e-12 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 1e-12 | ||
| 4du2_B | 470 | Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin | 1e-12 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 1e-12 | ||
| 2p85_A | 476 | Structure Of Human Lung Cytochrome P450 2a13 With I | 2e-12 | ||
| 4dvq_A | 483 | Structure Of Human Aldosterone Synthase, Cyp11b2, I | 2e-12 | ||
| 1zo4_A | 473 | Crystal Structure Of A328s Mutant Of The Heme Domai | 3e-12 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 3e-12 | ||
| 4dub_A | 472 | Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami | 4e-12 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 4e-12 | ||
| 4dua_A | 471 | Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng | 4e-12 | ||
| 1zoa_A | 473 | Crystal Structure Of A328v Mutant Of The Heme Domai | 4e-12 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 4e-12 | ||
| 3qi8_B | 472 | Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) | 4e-12 | ||
| 1x8v_A | 455 | Estriol-Bound And Ligand-Free Structures Of Sterol | 5e-12 | ||
| 1ea1_A | 455 | Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) | 5e-12 | ||
| 2w0a_A | 455 | Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( | 5e-12 | ||
| 1u13_A | 455 | Crystal Structure Analysis Of The C37lC151TC442A-Tr | 5e-12 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 9e-12 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 9e-12 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-11 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 1e-11 | ||
| 3qz1_A | 496 | Crystal Structure Of Bovine Steroid Of 21-Hydroxyla | 2e-11 | ||
| 3k1o_A | 458 | Crystal Structure Of Sterol 14-alpha Demethylase (c | 5e-11 | ||
| 3khm_A | 464 | Crystal Structure Of Sterol 14alpha-Demethylase (Cy | 5e-11 | ||
| 2wuz_A | 473 | X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In | 5e-11 | ||
| 1suo_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 With Bou | 1e-10 | ||
| 4h1n_A | 479 | Crystal Structure Of P450 2b4 F297a Mutant In Compl | 1e-10 | ||
| 1po5_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 Length = | 1e-10 | ||
| 2q6n_A | 478 | Structure Of Cytochrome P450 2b4 With Bound 1-(4- C | 1e-10 | ||
| 3qm4_A | 479 | Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl | 3e-10 | ||
| 3tk3_A | 476 | Cytochrome P450 2b4 Mutant L437a In Complex With 4- | 3e-10 | ||
| 1dt6_A | 473 | Structure Of Mammalian Cytochrome P450 2c5 Length = | 3e-10 | ||
| 2f9q_A | 479 | Crystal Structure Of Human Cytochrome P450 2d6 Leng | 5e-10 | ||
| 3ibd_A | 476 | Crystal Structure Of A Cytochrome P450 2b6 Genetic | 9e-10 | ||
| 1og2_A | 475 | Structure Of Human Cytochrome P450 Cyp2c9 Length = | 9e-10 | ||
| 1r9o_A | 477 | Crystal Structure Of P4502c9 With Flurbiprofen Boun | 9e-10 | ||
| 1pq2_A | 476 | Crystal Structure Of Human Drug Metabolizing Cytoch | 9e-10 | ||
| 3l4d_A | 453 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 2e-09 | ||
| 3r9c_A | 418 | Crystal Structure Of Mycobacterium Smegmatis Cyp164 | 3e-09 | ||
| 3g1q_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 5e-09 | ||
| 3gw9_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 5e-09 | ||
| 3tik_A | 454 | Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom | 5e-09 | ||
| 3p99_A | 453 | Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma | 5e-09 | ||
| 2wv2_A | 475 | X-Ray Structure Of Cyp51 From The Human Pathogen Tr | 5e-09 | ||
| 2x2n_A | 475 | X-Ray Structure Of Cyp51 From Trypanosoma Brucei In | 6e-09 | ||
| 1n97_A | 389 | Crystal Stucture Of Cyp175a1 From Thermus Thermophi | 6e-09 | ||
| 1wiy_A | 389 | Crystal Structure Analysis Of A 6-Coordinated Cytoc | 8e-09 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 1e-08 | ||
| 3pm0_A | 507 | Structural Characterization Of The Complex Between | 6e-08 | ||
| 1f4t_A | 368 | Thermophilic P450: Cyp119 From Sulfolobus Solfactar | 9e-08 | ||
| 1io8_A | 368 | Thermophilic Cytochrome P450 (Cyp119) From Sulfolob | 1e-07 | ||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 1e-07 | ||
| 3tyw_A | 417 | Crystal Structure Of Cyp105n1 From Streptomyces Coe | 1e-07 | ||
| 4dnz_A | 410 | The Crystal Structures Of Cyp199a4 Length = 410 | 2e-07 | ||
| 3ejb_B | 404 | Crystal Structure Of P450bioi In Complex With Tetra | 2e-07 | ||
| 2z3t_A | 425 | Crystal Structure Of Substrate Free Cytochrome P450 | 9e-07 | ||
| 3e4e_A | 476 | Human Cytochrome P450 2e1 In Complex With The Inhib | 1e-06 | ||
| 3abb_A | 408 | Crystal Structure Of Cyp105d6 Length = 408 | 2e-06 | ||
| 4i8v_A | 491 | Human Cytochrome P450 1a1 In Complex With Alpha-nap | 2e-06 | ||
| 2fr7_A | 412 | Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt | 3e-06 | ||
| 4ep6_A | 392 | Crystal Structure Of The Xpla Heme Domain In Comple | 3e-06 | ||
| 2wiv_A | 394 | Cytochrome-P450 Xpla Heme Domain P21 Length = 394 | 3e-06 | ||
| 2z36_A | 413 | Crystal Structure Of Cytochrome P450 Moxa From Nono | 1e-05 | ||
| 3tzo_A | 410 | The Role Of I87 Of Cyp158a2 In Oxidative Coupling R | 1e-05 | ||
| 1t93_A | 406 | Evidence For Multiple Substrate Recognition And Mol | 1e-05 | ||
| 3tnk_A | 407 | Crystal Structure Of Mutant I87r In Cyp158a2 Length | 1e-05 | ||
| 1se6_A | 406 | Crystal Structure Of Streptomyces Coelicolor A3(2) | 1e-05 | ||
| 2d0e_A | 407 | Substrate Assited In Oxygen Activation In Cytochrom | 1e-05 | ||
| 1s1f_A | 406 | Crystal Structure Of Streptomyces Coelicolor A3(2) | 2e-05 | ||
| 2d09_A | 407 | A Role For Active Site Water Molecules And Hydroxyl | 2e-05 | ||
| 3aba_A | 403 | Crystal Structure Of Cyp105p1 In Complex With Filip | 2e-05 | ||
| 3e5l_A | 403 | Crystal Structure Of Cyp105p1 H72a Mutant Length = | 2e-05 | ||
| 1ue8_A | 367 | Crystal Structure Of Thermophilic Cytochrome P450 F | 2e-05 | ||
| 3p3o_A | 416 | Crystal Structure Of The Cytochrome P450 Monooxygen | 3e-05 | ||
| 3p3l_A | 406 | Crystal Structure Of The Cytochrome P450 Monooxygen | 3e-05 | ||
| 2wh8_A | 413 | Interaction Of Mycobacterium Tuberculosis Cyp130 Wi | 3e-05 | ||
| 2uuq_A | 414 | Crystal Structure Of Cyp130 From Mycobacterium Tube | 3e-05 | ||
| 2wgy_A | 413 | Crystal Structure Of The G243a Mutant Of Cyp130 Fro | 3e-05 | ||
| 3e5j_A | 403 | Crystal Structure Of Cyp105p1 Wild-type Ligand-free | 3e-05 | ||
| 2jjn_A | 411 | Structure Of Closed Cytochrome P450 Eryk Length = 4 | 4e-05 | ||
| 2vrv_A | 431 | Structure Of Histidine Tagged Cytochrome P450 Eryk | 4e-05 | ||
| 1f25_A | 402 | Crystal Structure Of No Complex Of Thr243asn Mutant | 5e-05 | ||
| 1f26_A | 402 | Crystal Structure Of No Complex Of Thr243val Mutant | 5e-05 | ||
| 1cl6_A | 402 | Crystal Structures Of Ferric-No Complexes Of Fungal | 5e-05 | ||
| 1ehe_A | 403 | Crystal Structures Of Cytochrome P450nor And Its Mu | 5e-05 | ||
| 1cmn_A | 402 | Crystal Structures Of Ferric-No Complexes Of Fungal | 5e-05 | ||
| 1f24_A | 402 | Crystal Structure Of No Complex Of Thr243ala Mutant | 5e-05 | ||
| 1jfb_A | 404 | X-Ray Structure Of Nitric Oxide Reductase (Cytochro | 5e-05 | ||
| 1cmj_A | 402 | Crystal Structures Of Ferric-No Complexes Of Fungal | 5e-05 | ||
| 1ehg_A | 403 | Crystal Structures Of Cytochrome P450nor And Its Mu | 5e-05 | ||
| 1ehf_A | 403 | Crystal Structures Of Cytochrome P450nor And Its Mu | 5e-05 | ||
| 1xqd_A | 403 | Crystal Structure Of P450nor Complexed With 3- Pyri | 5e-05 | ||
| 1ulw_A | 402 | Crystal Structure Of P450nor Ser73gly/ser75gly Muta | 5e-05 | ||
| 2bvj_A | 436 | Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 | 5e-05 | ||
| 2vz7_A | 436 | Crystal Structure Of The Yc-17-Bound Pikc D50n Muta | 6e-05 | ||
| 2whw_A | 436 | Selective Oxidation Of Carbolide C-H Bonds By Engin | 6e-05 | ||
| 1cpt_A | 428 | Crystal Structure And Refinement Of Cytochrome P450 | 7e-05 | ||
| 3awp_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len | 7e-05 | ||
| 1izo_A | 417 | Cytochrome P450 Bs Beta Complexed With Fatty Acid L | 7e-05 | ||
| 2yoo_A | 407 | Cholest-4-en-3-one Bound Structure Of Cyp142 From M | 9e-05 | ||
| 3sn5_A | 491 | Crystal Structure Of Human Cyp7a1 In Complex With C | 1e-04 | ||
| 3dax_A | 491 | Crystal Structure Of Human Cyp7a1 Length = 491 | 1e-04 | ||
| 3vno_A | 407 | Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len | 1e-04 | ||
| 3voo_A | 407 | Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len | 1e-04 | ||
| 3vm4_A | 407 | Cytochrome P450sp Alpha (Cyp152b1) In Complex With | 1e-04 | ||
| 3awq_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng | 1e-04 | ||
| 3awm_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P | 1e-04 | ||
| 2xkr_A | 398 | Crystal Structure Of Mycobacterium Tuberculosis Cyp | 4e-04 | ||
| 3mgx_A | 415 | Crystal Structure Of P450 Oxyd That Is Involved In | 4e-04 | ||
| 1jip_A | 403 | P450eryf(A245s)KETOCONAZOLE Length = 403 | 5e-04 | ||
| 1jio_A | 403 | P450eryf/6deb Length = 403 | 5e-04 | ||
| 1z8q_A | 404 | Ferrous Dioxygen Complex Of The A245t Cytochrome P4 | 6e-04 | ||
| 1z8p_A | 404 | Ferrous Dioxygen Complex Of The A245s Cytochrome P4 | 6e-04 | ||
| 1z8o_A | 404 | Ferrous Dioxygen Complex Of The Wild-Type Cytochrom | 6e-04 | ||
| 3cxy_A | 396 | Crystal Structure Of The Cytochrome P450 Cyp121 P34 | 8e-04 |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
|
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 | Back alignment and structure |
| >pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 | Back alignment and structure |
| >pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 | Back alignment and structure |
| >pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 | Back alignment and structure |
| >pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 | Back alignment and structure |
| >pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 | Back alignment and structure |
| >pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 | Back alignment and structure |
| >pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 | Back alignment and structure |
| >pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 | Back alignment and structure |
| >pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 | Back alignment and structure |
| >pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 | Back alignment and structure |
| >pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 | Back alignment and structure |
| >pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 | Back alignment and structure |
| >pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 | Back alignment and structure |
| >pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 | Back alignment and structure |
| >pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 | Back alignment and structure |
| >pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 | Back alignment and structure |
| >pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 | Back alignment and structure |
| >pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 | Back alignment and structure |
| >pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 | Back alignment and structure |
| >pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 | Back alignment and structure |
| >pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 | Back alignment and structure |
| >pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 | Back alignment and structure |
| >pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 | Back alignment and structure |
| >pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 | Back alignment and structure |
| >pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 | Back alignment and structure |
| >pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 | Back alignment and structure |
| >pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 | Back alignment and structure |
| >pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 | Back alignment and structure |
| >pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 | Back alignment and structure |
| >pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 | Back alignment and structure |
| >pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 | Back alignment and structure |
| >pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 | Back alignment and structure |
| >pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 | Back alignment and structure |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
| >pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 | Back alignment and structure |
| >pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 | Back alignment and structure |
| >pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 | Back alignment and structure |
| >pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 | Back alignment and structure |
| >pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 | Back alignment and structure |
| >pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 | Back alignment and structure |
| >pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 | Back alignment and structure |
| >pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 | Back alignment and structure |
| >pdb|4EP6|A Chain A, Crystal Structure Of The Xpla Heme Domain In Complex With Imidazole And Peg Length = 392 | Back alignment and structure |
| >pdb|2WIV|A Chain A, Cytochrome-P450 Xpla Heme Domain P21 Length = 394 | Back alignment and structure |
| >pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 | Back alignment and structure |
| >pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 | Back alignment and structure |
| >pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 | Back alignment and structure |
| >pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 | Back alignment and structure |
| >pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 | Back alignment and structure |
| >pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 | Back alignment and structure |
| >pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 | Back alignment and structure |
| >pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 | Back alignment and structure |
| >pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 | Back alignment and structure |
| >pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 | Back alignment and structure |
| >pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 | Back alignment and structure |
| >pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 | Back alignment and structure |
| >pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 | Back alignment and structure |
| >pdb|2WH8|A Chain A, Interaction Of Mycobacterium Tuberculosis Cyp130 With Heterocyclic Arylamines Length = 413 | Back alignment and structure |
| >pdb|2UUQ|A Chain A, Crystal Structure Of Cyp130 From Mycobacterium Tuberculosis In The Ligand-Free Form Length = 414 | Back alignment and structure |
| >pdb|2WGY|A Chain A, Crystal Structure Of The G243a Mutant Of Cyp130 From M. Tuberculosis Length = 413 | Back alignment and structure |
| >pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 | Back alignment and structure |
| >pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 | Back alignment and structure |
| >pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 | Back alignment and structure |
| >pdb|1F25|A Chain A, Crystal Structure Of No Complex Of Thr243asn Mutants Of Cytochrome P450nor Length = 402 | Back alignment and structure |
| >pdb|1F26|A Chain A, Crystal Structure Of No Complex Of Thr243val Mutants Of Cytochrome P450nor Length = 402 | Back alignment and structure |
| >pdb|1CL6|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Its Ser286 Mutants At Cryogenic Temperature Length = 402 | Back alignment and structure |
| >pdb|1EHE|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 | Back alignment and structure |
| >pdb|1CMN|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 | Back alignment and structure |
| >pdb|1F24|A Chain A, Crystal Structure Of No Complex Of Thr243ala Mutants Of Cytochrome P450nor Length = 402 | Back alignment and structure |
| >pdb|1JFB|A Chain A, X-Ray Structure Of Nitric Oxide Reductase (Cytochrome P450nor) In The Ferric Resting State At Atomic Resolution Length = 404 | Back alignment and structure |
| >pdb|1CMJ|A Chain A, Crystal Structures Of Ferric-No Complexes Of Fungal Nitric Oxide Reductase And Their Ser286 Mutants At Cryogenic Temperature Length = 402 | Back alignment and structure |
| >pdb|1EHG|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 | Back alignment and structure |
| >pdb|1EHF|A Chain A, Crystal Structures Of Cytochrome P450nor And Its Mutants (Ser286 Val, Thr) In The Ferric Resting State At Cryogenic Temperature: A Comparative Analysis With Monooxygenase Cytochrome P450s Length = 403 | Back alignment and structure |
| >pdb|1XQD|A Chain A, Crystal Structure Of P450nor Complexed With 3- Pyridinealdehyde Adenine Dinucleotide Length = 403 | Back alignment and structure |
| >pdb|1ULW|A Chain A, Crystal Structure Of P450nor Ser73gly/ser75gly Mutant Length = 402 | Back alignment and structure |
| >pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 | Back alignment and structure |
| >pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 | Back alignment and structure |
| >pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 | Back alignment and structure |
| >pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 | Back alignment and structure |
| >pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 | Back alignment and structure |
| >pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 | Back alignment and structure |
| >pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From Mycobacterium Smegmatis Length = 407 | Back alignment and structure |
| >pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 | Back alignment and structure |
| >pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 | Back alignment and structure |
| >pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 | Back alignment and structure |
| >pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 | Back alignment and structure |
| >pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 | Back alignment and structure |
| >pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 | Back alignment and structure |
| >pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 | Back alignment and structure |
| >pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 | Back alignment and structure |
| >pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 | Back alignment and structure |
| >pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 | Back alignment and structure |
| >pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 | Back alignment and structure |
| >pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 | Back alignment and structure |
| >pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 | Back alignment and structure |
| >pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 | Back alignment and structure |
| >pdb|3CXY|A Chain A, Crystal Structure Of The Cytochrome P450 Cyp121 P346l Mutant From M. Tuberculosis Length = 396 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 197 | |||
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 3e-66 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 2e-61 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 2e-61 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 4e-59 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 6e-57 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 1e-56 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 2e-55 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 8e-50 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 3e-49 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 2e-48 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 6e-48 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 2e-47 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 1e-46 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 8e-46 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 3e-43 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 6e-42 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 2e-37 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 4e-36 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 6e-33 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 3e-26 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 2e-25 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 3e-25 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 2e-24 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 3e-24 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 8e-24 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 3e-23 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 6e-23 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 7e-23 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 4e-22 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 6e-14 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 1e-13 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 2e-13 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 3e-13 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 4e-13 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 5e-13 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 8e-13 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 8e-13 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 9e-13 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 1e-12 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 1e-12 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 6e-12 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 6e-12 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 9e-12 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 9e-12 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 1e-11 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 1e-11 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 1e-11 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 2e-11 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 2e-11 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 2e-11 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 2e-11 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 2e-11 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 3e-11 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 3e-11 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 3e-11 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 4e-11 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 5e-11 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 5e-11 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 5e-11 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 5e-11 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 6e-11 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 1e-10 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 1e-10 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 1e-10 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 2e-10 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 3e-10 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 3e-10 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 4e-10 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 2e-09 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 3e-09 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 3e-09 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 5e-09 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 1e-08 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 1e-08 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-06 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 2e-05 |
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
Score = 209 bits (533), Expect = 3e-66
Identities = 50/184 (27%), Positives = 84/184 (45%), Gaps = 13/184 (7%)
Query: 14 SQHPYLEAVESSFRVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPVIA 73
S+ P E V R+ E+ +V+G ++ L RL L++V+KE++RL+P A
Sbjct: 271 SRQP--EIVA---RLQAEVDEVIGS--KRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTF 323
Query: 74 RSAPYEVQCGDYTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVP 133
R E +P + Y + R + +P F+PDRF P + Y P
Sbjct: 324 RLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAP--KPRFTYFP 381
Query: 134 FSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIR 193
FSLG R CIG ++A +++K ++ +L+R + Q + T++ L
Sbjct: 382 FSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPG----QRFGLQEQATLKPLDPVLCT 437
Query: 194 IEPR 197
+ PR
Sbjct: 438 LRPR 441
|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 100.0 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 100.0 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 100.0 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 100.0 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 100.0 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 100.0 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 100.0 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 100.0 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 100.0 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 100.0 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 100.0 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 100.0 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 100.0 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 100.0 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 100.0 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 100.0 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 100.0 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 100.0 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 100.0 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 100.0 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 100.0 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 100.0 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 100.0 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 100.0 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 100.0 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 100.0 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 100.0 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 100.0 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 100.0 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 100.0 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 100.0 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 100.0 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 100.0 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 100.0 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 100.0 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 100.0 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 100.0 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 100.0 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 100.0 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 100.0 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 100.0 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 100.0 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 100.0 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 100.0 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 100.0 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 100.0 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 100.0 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 100.0 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 100.0 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 100.0 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 100.0 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 100.0 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 100.0 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 100.0 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 100.0 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 100.0 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 100.0 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 100.0 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 100.0 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 100.0 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 100.0 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 100.0 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 100.0 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 100.0 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 100.0 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-53 Score=356.25 Aligned_cols=193 Identities=19% Similarity=0.371 Sum_probs=173.9
Q ss_pred CCCcchhhhHHHHhhhHHhhChhHHHHHHHHHHHHhCCCCCCCCCHHhhccChHHHHHHHHHhcCCCCCccc-eeecCce
Q psy16719 1 MFGVDFEIQRNHYSQHPYLEAVESSFRVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPVI-ARSAPYE 79 (197)
Q Consensus 1 ~ag~~t~~~~~~~~l~~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~~~~~~~-~r~~~~~ 79 (197)
+||+|||+++++|++++|++||++|+|+++||+++++.. . .++++++++|||++|||+|+||++|+++.. .|.+.+|
T Consensus 282 ~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~-~-~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d 359 (479)
T 3tbg_A 282 SAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQV-R-RPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRD 359 (479)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSS-S-CCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSC
T ss_pred HhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhc-c-ccchhhhccccccccceeeeccccccccccceeecCCC
Confidence 489999999999999999999999999999999998752 3 349999999999999999999999999984 5678889
Q ss_pred eecCCEEeCCCCEEEecchhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCcCCccHHHHHHHHHHHHHHHh
Q psy16719 80 VQCGDYTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTIL 159 (197)
Q Consensus 80 ~~~~g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll 159 (197)
++++|+.||+|+.|.++.+++||||++|+||++|+||||+++++....+..|+|||+|+|.|+|++||++|+++++|.||
T Consensus 360 ~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll 439 (479)
T 3tbg_A 360 IEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLL 439 (479)
T ss_dssp EEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHH
T ss_pred ceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999887777788999999999999999999999999999999
Q ss_pred hhCeEeeCCCCCCcccceeecceeEeeCCCceeEEEeC
Q psy16719 160 RRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 197 (197)
Q Consensus 160 ~~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R 197 (197)
++|||+++++... .......+++..|+ +++|++++|
T Consensus 440 ~~f~~~~~~~~~~-~~~~~~~~~~~~P~-~~~v~~~pR 475 (479)
T 3tbg_A 440 QHFSFSVPTGQPR-PSHHGVFAFLVSPS-PYELCAVPR 475 (479)
T ss_dssp HHEEEECCTTSCC-CCSCEEESSSEEEC-CCCBEEEEC
T ss_pred HccEEEeCCCCCC-ccccccceeeecCC-CeEEEEEEC
Confidence 9999999876321 12333346777887 899999998
|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 197 | ||||
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 3e-37 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 1e-33 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 8e-33 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 4e-26 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 3e-23 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 9e-21 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 3e-19 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 8e-19 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-17 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 2e-17 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 3e-17 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 1e-16 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 1e-15 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 2e-15 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 3e-15 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 5e-15 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 1e-14 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 4e-14 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 1e-13 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 3e-13 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 4e-13 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 132 bits (332), Expect = 3e-37
Identities = 52/197 (26%), Positives = 92/197 (46%), Gaps = 4/197 (2%)
Query: 1 MFGVDFEIQRNHYSQHPYLEAVESSFRVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIK 60
G + + + + ++ E+ VL + PTYD + +++ L V+
Sbjct: 277 FAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAP--PTYDTVLQMEYLDMVVN 334
Query: 61 ETMRLFPAAPVIARSAPYEVQCGDYTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLP 120
ET+RLFP A + R +V+ IP G + I Y LHR P+ W P +F P+RF
Sbjct: 335 ETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSK 394
Query: 121 SQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEF 180
+ +P Y PF GPR CIG ++A++ MK + +L+ + P + + ++
Sbjct: 395 KNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQ--IPLKLSL 452
Query: 181 GMTMRSLPGNDIRIEPR 197
G ++ +++E R
Sbjct: 453 GGLLQPEKPVVLKVESR 469
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 197 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 100.0 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 100.0 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 100.0 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 100.0 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 100.0 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 100.0 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 100.0 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 100.0 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 100.0 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 100.0 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 100.0 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 100.0 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 100.0 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 100.0 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 100.0 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 100.0 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.97 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=7.5e-51 Score=339.34 Aligned_cols=193 Identities=26% Similarity=0.532 Sum_probs=177.5
Q ss_pred CCCcchhhhHHHHhhhHHhhChhHHHHHHHHHHHHhCCCCCCCCCHHhhccChHHHHHHHHHhcCCCCCccceeecCcee
Q psy16719 1 MFGVDFEIQRNHYSQHPYLEAVESSFRVYHELQDVLGDSPDSAPTYDQLQRLDLLTRVIKETMRLFPAAPVIARSAPYEV 80 (197)
Q Consensus 1 ~ag~~t~~~~~~~~l~~l~~~p~~~~~~~~Ei~~~~~~~~~~~~~~~~~~~l~~l~a~i~E~lRl~~~~~~~~r~~~~~~ 80 (197)
+||++||+++++|++++|++||++|+++++||+++++.. ... +.+++.++||++||++|++|++|+++.+.|.+.+|+
T Consensus 277 ~Ag~~tta~~l~~~l~~L~~~Pe~~~klr~Ei~~~~~~~-~~~-~~~~l~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~ 354 (472)
T d1tqna_ 277 FAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNK-APP-TYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDV 354 (472)
T ss_dssp HHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHSTTT-CCC-CHHHHHHCHHHHHHHHHHHHHCCTTCCEEEECCSCE
T ss_pred hcccccccccceeeccccccCccccccccceeheecccc-ccc-hHHHhhccccccceeeeccccCCcccccccccccCc
Confidence 489999999999999999999999999999999999753 334 889999999999999999999999999999999999
Q ss_pred ecCCEEeCCCCEEEecchhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCcCCccHHHHHHHHHHHHHHHhh
Q psy16719 81 QCGDYTIPAGASIAIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILR 160 (197)
Q Consensus 81 ~~~g~~ip~g~~v~~~~~~~~~~~~~~~~p~~F~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~~A~~e~~~~l~~ll~ 160 (197)
.++|+.||+|+.|+++.+.+|+||++|+||++|+||||++.+.....+..|+|||+|+|.|+|++||.+|++++++.||+
T Consensus 355 ~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~ 434 (472)
T d1tqna_ 355 EINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQ 434 (472)
T ss_dssp EETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHT
T ss_pred cccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999988776667889999999999999999999999999999999
Q ss_pred hCeEeeCCCCCCcccceeecceeEeeCCCceeEEEeC
Q psy16719 161 RYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 197 (197)
Q Consensus 161 ~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R 197 (197)
+|||+++++. +.+.+...+.+++|+.++.|++++|
T Consensus 435 ~f~~~~~~~~--~~~~~~~~~~~~~p~~~~~~~~~~R 469 (472)
T d1tqna_ 435 NFSFKPCKET--QIPLKLSLGGLLQPEKPVVLKVESR 469 (472)
T ss_dssp TEEEECCTTC--CSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred hCEEEeCCCC--CCCceeccceEEeeCCCEEEEEEEC
Confidence 9999988763 2344555677889999999999998
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|