Psyllid ID: psy16746

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------

MNSRSPDYQANVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIYK

cccccccHHHHHHHHHcccccccccHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEEccccccccHHHHHccccccccEEEEEEEEEccHHHcccHHHHHHHHHHHHHHHHccccccEEEEEEEEccHHHHHHHHHcccEEEEEEccccccccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccEEEEcccEEEccccccccccccccccccccEEHHHHHHccEEEEc

cccccccccHEEccEEEEEccccccHHHHHHHHcccccEEEEEEEccEEEEEEEEEEEccccccccccccccccccccccEEEEEEEcccHHHHHccHHHHHHHHHHHHHHHcccccccEEEEEEEEccHHHHHHHHHcccEEEEEEccEEEEccccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEcHcccccccccccccccHHHHccccHHHHHHHHHHHHHHHcc

mnsrspdyqanvltstslrhsgnyplswykditsepsFYSLAALYNGVIIGLIVAEILQYtslnkedkdILASSFDKHIEVGYILSLgvsedyrrNGIASLLLDNLISHLTTAENSSCKAIFLHVltsnkpaihFYEKRRFRLhsflpyyysikgrsrdgFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYlkcqdwfpidyplswykditsepsfYSLAALRNFFFIYK

mnsrspdyqanvltstslrhsgnyPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIYK

******************RHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIY*

***RSPDYQANVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIYK

**********NVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIYK

****SPDYQANVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESLYSKEFLSKKKGIRNWLVCIKYLKCQDWFPIDYPLSWYKDITSEPSFYSLAALRNFFFIYK

oooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi

ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		247	2.2.26 [Sep-21-2011]
Q95SX8		276	N-alpha-acetyltransferase	no	N/A	0.655	0.586	0.590	2e-55
Q3MHC1		242	N-alpha-acetyltransferase	yes	N/A	0.663	0.677	0.587	2e-52
Q9DBU2		242	N-alpha-acetyltransferase	yes	N/A	0.663	0.677	0.587	2e-52
A3KPA3		242	N-alpha-acetyltransferase	yes	N/A	0.676	0.690	0.586	5e-52
Q9H7X0		242	N-alpha-acetyltransferase	yes	N/A	0.672	0.685	0.574	6e-52
Q17QK9		242	N-alpha-acetyltransferase	yes	N/A	0.663	0.677	0.581	1e-51
A8E5V7		242	N-alpha-acetyltransferase	yes	N/A	0.668	0.681	0.563	3e-50
Q980R9		167	Uncharacterized N-acetylt	no	N/A	0.566	0.838	0.298	3e-06
Q9BSU3		229	N-alpha-acetyltransferase	no	N/A	0.417	0.449	0.296	4e-06
Q4V8K3		246	N-alpha-acetyltransferase	no	N/A	0.417	0.418	0.304	6e-06

>sp\|Q95SX8\|NAA60_DROME N-alpha-acetyltransferase 60 OS=Drosophila melanogaster GN=CG18177 PE=1 SV=1	Back alignment and function desciption

 Score =  215 bits (548), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 130/183 (71%), Gaps = 21/183 (11%)

Query: 23  NYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKE---------------- 66
           +YPLSWY+DITS   F++LAA+YN  IIGLIVAEI  Y ++NKE                
Sbjct: 58  DYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEVIANMSDSDELYTRLS 117

Query: 67  -----DKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAI 121
                DK IL  S  +  +VGYILSLGV   +RRNGI SLLLD L++HLTTAE  S KAI
Sbjct: 118 GFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERHSVKAI 177

Query: 122 FLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVK 181
           FLH LT+N+PAI FYEKRRF LHSFLPYYY+I+G+ +DGFTYV YINGGH  W+L D++K
Sbjct: 178 FLHTLTTNQPAIFFYEKRRFTLHSFLPYYYNIRGKGKDGFTYVNYINGGHPPWTLLDHIK 237

Query: 182 HWC 184
           H+ 
Sbjct: 238 HYA 240

Displays alpha (N-terminal) acetyltransferase activity towards a range of N-terminal sequences including those starting with Met-Lys, Met-Val, Met-Ala and Met-Met. Required for normal chromosomal segregation during anaphase. Isoform A has histone acetyltransferase toward free histones, while isoform B has no histone acetyltransferase activity.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 8EC: 8

>sp\|Q3MHC1\|NAA60_RAT N-alpha-acetyltransferase 60 OS=Rattus norvegicus GN=Naa60 PE=2 SV=1	Back alignment and function description

>sp\|Q9DBU2\|NAA60_MOUSE N-alpha-acetyltransferase 60 OS=Mus musculus GN=Naa60 PE=2 SV=1	Back alignment and function description

>sp\|A3KPA3\|NAA60_DANRE N-alpha-acetyltransferase 60 OS=Danio rerio GN=naa60 PE=2 SV=1	Back alignment and function description

>sp\|Q9H7X0\|NAA60_HUMAN N-alpha-acetyltransferase 60 OS=Homo sapiens GN=NAA60 PE=1 SV=1	Back alignment and function description

>sp\|Q17QK9\|NAA60_BOVIN N-alpha-acetyltransferase 60 OS=Bos taurus GN=NAA60 PE=2 SV=1	Back alignment and function description

>sp\|A8E5V7\|NAA60_XENTR N-alpha-acetyltransferase 60 OS=Xenopus tropicalis GN=naa60 PE=2 SV=1	Back alignment and function description

>sp\|Q980R9\|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2	Back alignment and function description

>sp\|Q9BSU3\|NAA11_HUMAN N-alpha-acetyltransferase 11 OS=Homo sapiens GN=NAA11 PE=1 SV=3	Back alignment and function description

>sp\|Q4V8K3\|NAA11_RAT N-alpha-acetyltransferase 11 OS=Rattus norvegicus GN=Naa11 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
195440318		256	GK11823 [Drosophila willistoni] gi\|19416	0.732	0.707	0.596	1e-57
332031623		306	N-acetyltransferase 15 [Acromyrmex echin	0.676	0.545	0.658	3e-57
195326435		255	GM25182 [Drosophila sechellia] gi\|194118	0.668	0.647	0.654	3e-57
195490712		255	GE20874 [Drosophila yakuba] gi\|194179356	0.668	0.647	0.654	3e-57
194868103		255	GG15408 [Drosophila erecta] gi\|190654004	0.668	0.647	0.654	3e-57
45550582		255	N(alpha)-acetyltransferase 60, isoform B	0.655	0.635	0.666	4e-57
195589147		456	GD14213 [Drosophila simulans] gi\|1941963	0.668	0.361	0.654	4e-57
194747685		254	GF24673 [Drosophila ananassae] gi\|190623	0.668	0.649	0.654	4e-57
307192783		291	N-acetyltransferase UNQ2771/PRO7155-like	0.647	0.549	0.681	5e-57
195174133		255	GL16291 [Drosophila persimilis] gi\|19846	0.668	0.647	0.648	9e-57

>gi\|195440318\|ref\|XP_002067989.1\| GK11823 [Drosophila willistoni] gi\|194164074\|gb\|EDW78975.1\| GK11823 [Drosophila willistoni]	Back alignment and taxonomy information

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 111/186 (59%), Positives = 140/186 (75%), Gaps = 5/186 (2%)

Query: 23  NYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVG 82
           +YPLSWY+DITS   F++LAA+YN  IIGLIVAEI  Y ++NKEDK IL  S  +H +VG
Sbjct: 59  DYPLSWYEDITSSTRFFALAAVYNLAIIGLIVAEIKPYRNVNKEDKGILPDSMGRHADVG 118

Query: 83  YILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFR 142
           YILSLGV   +RRNGI SLLLD L++HLTT E  S KAIFLH LT+N+PAI FYEK+RF 
Sbjct: 119 YILSLGVHRSHRRNGIGSLLLDALMNHLTTVERHSVKAIFLHTLTTNQPAIFFYEKQRFT 178

Query: 143 LHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSLCDYVKHWCESL-YSKEFL----SKKK 197
           LHSFLPYYY+I+G+ +DGFTYV YINGGH  W+L D++KH+   + ++  F     S+ +
Sbjct: 179 LHSFLPYYYNIRGKGKDGFTYVTYINGGHPPWTLLDHIKHYASKVGHTSSFCVWMASRVQ 238

Query: 198 GIRNWL 203
            +  WL
Sbjct: 239 SVVRWL 244

Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|332031623\|gb\|EGI71095.1\| N-acetyltransferase 15 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|195326435\|ref\|XP_002029934.1\| GM25182 [Drosophila sechellia] gi\|194118877\|gb\|EDW40920.1\| GM25182 [Drosophila sechellia]	Back alignment and taxonomy information

>gi\|195490712\|ref\|XP_002093255.1\| GE20874 [Drosophila yakuba] gi\|194179356\|gb\|EDW92967.1\| GE20874 [Drosophila yakuba]	Back alignment and taxonomy information

>gi\|194868103\|ref\|XP_001972221.1\| GG15408 [Drosophila erecta] gi\|190654004\|gb\|EDV51247.1\| GG15408 [Drosophila erecta]	Back alignment and taxonomy information

>gi\|45550582\|ref\|NP_648353.3\| N(alpha)-acetyltransferase 60, isoform B [Drosophila melanogaster] gi\|25012265\|gb\|AAN71246.1\| LD27619p [Drosophila melanogaster] gi\|45445982\|gb\|AAF50213.2\| N(alpha)-acetyltransferase 60, isoform B [Drosophila melanogaster] gi\|220951890\|gb\|ACL88488.1\| CG18177-PB [synthetic construct]	Back alignment and taxonomy information

>gi\|195589147\|ref\|XP_002084317.1\| GD14213 [Drosophila simulans] gi\|194196326\|gb\|EDX09902.1\| GD14213 [Drosophila simulans]	Back alignment and taxonomy information

>gi\|194747685\|ref\|XP_001956282.1\| GF24673 [Drosophila ananassae] gi\|190623564\|gb\|EDV39088.1\| GF24673 [Drosophila ananassae]	Back alignment and taxonomy information

>gi\|307192783\|gb\|EFN75873.1\| N-acetyltransferase UNQ2771/PRO7155-like protein [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|195174133\|ref\|XP_002027835.1\| GL16291 [Drosophila persimilis] gi\|198466068\|ref\|XP_002135099.1\| GA23434 [Drosophila pseudoobscura pseudoobscura] gi\|194115511\|gb\|EDW37554.1\| GL16291 [Drosophila persimilis] gi\|198150431\|gb\|EDY73726.1\| GA23434 [Drosophila pseudoobscura pseudoobscura]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
FB\|FBgn0036039		276	Naa60 "N(alpha)-acetyltransfer	0.502	0.449	0.645	6.9e-55
MGI\|MGI:1922013		242	Naa60 "N(alpha)-acetyltransfer	0.643	0.657	0.603	1.1e-50
RGD\|1308915		242	Naa60 "N(alpha)-acetyltransfer	0.643	0.657	0.603	1.1e-50
UNIPROTKB\|Q9H7X0		242	NAA60 "N-alpha-acetyltransfera	0.672	0.685	0.578	2.8e-50
UNIPROTKB\|E2QYA4		242	NAA60 "Uncharacterized protein	0.643	0.657	0.591	4.6e-50
ZFIN\|ZDB-GENE-041111-143		242	nat15 "N-acetyltransferase 15	0.672	0.685	0.590	4.6e-50
UNIPROTKB\|Q17QK9		242	NAA60 "N-alpha-acetyltransfera	0.643	0.657	0.597	7.4e-50
UNIPROTKB\|A8E5V7		242	naa60 "N-alpha-acetyltransfera	0.643	0.657	0.578	2.3e-48
UNIPROTKB\|E1BYK0		190	NAT15 "Uncharacterized protein	0.619	0.805	0.594	4.2e-47
UNIPROTKB\|H9KZH4		191	H9KZH4 "Uncharacterized protei	0.619	0.801	0.496	3.4e-38

FB\|FBgn0036039 Naa60 "N(alpha)-acetyltransferase 60" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 433 (157.5 bits), Expect = 6.9e-55, Sum P(2) = 6.9e-55
 Identities = 82/127 (64%), Positives = 99/127 (77%)

Query:    60 YTSLN---KEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENS 116
             YT L+    +DK IL  S  +  +VGYILSLGV   +RRNGI SLLLD L++HLTTAE  
Sbjct:   113 YTRLSGFPMQDKGILPDSMGRSADVGYILSLGVHRSHRRNGIGSLLLDALMNHLTTAERH 172

Query:   117 SCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWSL 176
             S KAIFLH LT+N+PAI FYEKRRF LHSFLPYYY+I+G+ +DGFTYV YINGGH  W+L
Sbjct:   173 SVKAIFLHTLTTNQPAIFFYEKRRFTLHSFLPYYYNIRGKGKDGFTYVNYINGGHPPWTL 232

Query:   177 CDYVKHW 183
              D++KH+
Sbjct:   233 LDHIKHY 239

GO:0000090 "mitotic anaphase" evidence=IMP

GO:0005737 "cytoplasm" evidence=IC

GO:0004596 "peptide alpha-N-acetyltransferase activity" evidence=IDA

GO:0017196 "N-terminal peptidyl-methionine acetylation" evidence=IDA

GO:0007059 "chromosome segregation" evidence=IMP

MGI\|MGI:1922013 Naa60 "N(alpha)-acetyltransferase 60, NatF catalytic subunit" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1308915 Naa60 "N(alpha)-acetyltransferase 60, NatF catalytic subunit" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9H7X0 NAA60 "N-alpha-acetyltransferase 60" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QYA4 NAA60 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-041111-143 nat15 "N-acetyltransferase 15 (GCN5-related, putative)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q17QK9 NAA60 "N-alpha-acetyltransferase 60" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|A8E5V7 naa60 "N-alpha-acetyltransferase 60" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BYK0 NAT15 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|H9KZH4 H9KZH4 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q9H7X0	NAA60_HUMAN	2, ., 3, ., 1, ., 8, 8	0.5748	0.6720	0.6859	yes	N/A
Q9DBU2	NAA60_MOUSE	2, ., 3, ., 1, ., 8, 8	0.5878	0.6639	0.6776	yes	N/A
A3KPA3	NAA60_DANRE	2, ., 3, ., 1, ., 8, 8	0.5868	0.6761	0.6900	yes	N/A
A8E5V7	NAA60_XENTR	2, ., 3, ., 1, ., 8, 8	0.5636	0.6680	0.6818	yes	N/A
Q17QK9	NAA60_BOVIN	2, ., 3, ., 1, ., 8, 8	0.5818	0.6639	0.6776	yes	N/A
Q3MHC1	NAA60_RAT	2, ., 3, ., 1, ., 8, 8	0.5878	0.6639	0.6776	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	2.3.1	0.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		247
pfam00583		80	pfam00583, Acetyltransf_1, Acetyltransferase (GNAT	6e-14
COG0456		177	COG0456, RimI, Acetyltransferases [General functio	1e-13
TIGR01575		131	TIGR01575, rimI, ribosomal-protein-alanine acetylt	4e-11
pfam08445		86	pfam08445, FR47, FR47-like protein	2e-07
cd04301		65	cd04301, NAT_SF, N-Acyltransferase superfamily: Va	1e-06
PRK03624		140	PRK03624, PRK03624, putative acetyltransferase; Pr	4e-06
COG1670		187	COG1670, RimL, Acetyltransferases, including N-ace	0.001
pfam13508		79	pfam13508, Acetyltransf_7, Acetyltransferase (GNAT	0.002

>gnl\|CDD\|216007 pfam00583, Acetyltransf_1, Acetyltransferase (GNAT) family	Back alignment and domain information

 Score = 65.0 bits (159), Expect = 6e-14
 Identities = 29/100 (29%), Positives = 39/100 (39%), Gaps = 20/100 (20%)

Query: 43  ALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLL 102
           A  +G ++G                     S  D+   V  I  L V  +YR  GI + L
Sbjct: 1   AEEDGELVGFASL-----------------SIIDEEGNVAEIEGLAVDPEYRGKGIGTAL 43

Query: 103 LDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFR 142
           L+ L  +   A     K I L VL  N+ AI  YEK  F+
Sbjct: 44  LEALEEY---ARELGLKRIELEVLEDNEAAIALYEKLGFK 80

This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins. Length = 80

>gnl\|CDD\|223532 COG0456, RimI, Acetyltransferases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233477 TIGR01575, rimI, ribosomal-protein-alanine acetyltransferase	Back alignment and domain information

>gnl\|CDD\|117022 pfam08445, FR47, FR47-like protein	Back alignment and domain information

>gnl\|CDD\|173926 cd04301, NAT_SF, N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate	Back alignment and domain information

>gnl\|CDD\|235142 PRK03624, PRK03624, putative acetyltransferase; Provisional	Back alignment and domain information

>gnl\|CDD\|224584 COG1670, RimL, Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|222185 pfam13508, Acetyltransf_7, Acetyltransferase (GNAT) domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		247
PRK10140		162	putative acetyltransferase YhhY; Provisional	99.83
PRK09491		146	rimI ribosomal-protein-alanine N-acetyltransferase	99.81
TIGR03827		266	GNAT_ablB putative beta-lysine N-acetyltransferase	99.79
TIGR01575		131	rimI ribosomal-protein-alanine acetyltransferase.	99.79
KOG3139\|consensus		165		99.77
PF13420		155	Acetyltransf_4: Acetyltransferase (GNAT) domain; P	99.77
PRK10146		144	aminoalkylphosphonic acid N-acetyltransferase; Pro	99.77
PRK10809		194	ribosomal-protein-S5-alanine N-acetyltransferase;	99.76
PRK15130		186	spermidine N1-acetyltransferase; Provisional	99.76
PRK10151		179	ribosomal-protein-L7/L12-serine acetyltransferase;	99.75
TIGR03585		156	PseH pseudaminic acid biosynthesis N-acetyl transf	99.74
KOG3138\|consensus		187		99.73
COG0456		177	RimI Acetyltransferases [General function predicti	99.73
PRK03624		140	putative acetyltransferase; Provisional	99.72
COG1247		169	Sortase and related acyltransferases [Cell envelop	99.72
TIGR02406		157	ectoine_EctA L-2,4-diaminobutyric acid acetyltrans	99.71
TIGR02382		191	wecD_rffC TDP-D-fucosamine acetyltransferase. This	99.7
PF00583		83	Acetyltransf_1: Acetyltransferase (GNAT) family; I	99.68
PHA00673		154	acetyltransferase domain containing protein	99.67
KOG3235\|consensus		193		99.67
PRK10975		194	TDP-fucosamine acetyltransferase; Provisional	99.67
PTZ00330		147	acetyltransferase; Provisional	99.65
PRK09831		147	putative acyltransferase; Provisional	99.63
PF13523		152	Acetyltransf_8: Acetyltransferase (GNAT) domain; P	99.62
PLN02706		150	glucosamine 6-phosphate N-acetyltransferase	99.62
PF13527		127	Acetyltransf_9: Acetyltransferase (GNAT) domain; P	99.6
TIGR03103		547	trio_acet_GNAT GNAT-family acetyltransferase TIGR0	99.6
PRK10514		145	putative acetyltransferase; Provisional	99.6
PF13673		117	Acetyltransf_10: Acetyltransferase (GNAT) domain;	99.6
KOG3216\|consensus		163		99.6
PRK07922		169	N-acetylglutamate synthase; Validated	99.57
KOG3234\|consensus		173		99.56
PRK07757		152	acetyltransferase; Provisional	99.55
PRK10562		145	putative acetyltransferase; Provisional	99.53
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	99.53
PLN02825		515	amino-acid N-acetyltransferase	99.53
PRK05279		441	N-acetylglutamate synthase; Validated	99.52
TIGR01890		429	N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi	99.5
PF13508		79	Acetyltransf_7: Acetyltransferase (GNAT) domain; P	99.5
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	99.5
PRK10314		153	putative acyltransferase; Provisional	99.49
TIGR03448		292	mycothiol_MshD mycothiol biosynthesis acetyltransf	99.48
PHA01807		153	hypothetical protein	99.47
PRK12308		614	bifunctional argininosuccinate lyase/N-acetylgluta	99.45
COG1246		153	ArgA N-acetylglutamate synthase and related acetyl	99.43
COG1670		187	RimL Acetyltransferases, including N-acetylases of	99.43
PF13302		142	Acetyltransf_3: Acetyltransferase (GNAT) domain; P	99.4
COG3153		171	Predicted acetyltransferase [General function pred	99.37
PRK01346		411	hypothetical protein; Provisional	99.37
PRK13688		156	hypothetical protein; Provisional	99.34
KOG2488\|consensus		202		99.24
KOG3396\|consensus		150		99.23
cd02169		297	Citrate_lyase_ligase Citrate lyase ligase. Citrate	99.22
PF08445		86	FR47: FR47-like protein; InterPro: IPR013653 Prote	99.18
TIGR00124		332	cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP	99.05
COG3393		268	Predicted acetyltransferase [General function pred	99.03
COG3981		174	Predicted acetyltransferase [General function pred	98.93
KOG3397\|consensus		225		98.87
PF13718		196	GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z	98.82
KOG4144\|consensus		190		98.74
cd04301		65	NAT_SF N-Acyltransferase superfamily: Various enzy	98.73
PF12746		265	GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S	98.71
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	98.7
COG3818		167	Predicted acetyltransferase, GNAT superfamily [Gen	98.69
COG2153		155	ElaA Predicted acyltransferase [General function p	98.65
PF12568		128	DUF3749: Acetyltransferase (GNAT) domain; InterPro	98.59
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	98.48
PF14542		78	Acetyltransf_CG: GCN5-related N-acetyl-transferase	98.37
PF08444		89	Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt	98.36
COG4552		389	Eis Predicted acetyltransferase involved in intrac	98.12
KOG4135\|consensus		185		98.05
COG5628		143	Predicted acetyltransferase [General function pred	97.96
COG2388		99	Predicted acetyltransferase [General function pred	97.78
PF00765		182	Autoind_synth: Autoinducer synthetase; InterPro: I	97.77
PF13480		142	Acetyltransf_6: Acetyltransferase (GNAT) domain	97.72
COG0454		156	WecD Histone acetyltransferase HPA2 and related ac	97.69
COG3053		352	CitC Citrate lyase synthetase [Energy production a	97.66
COG3375		266	Uncharacterized conserved protein [Function unknow	97.44
PRK13834		207	putative autoinducer synthesis protein; Provisiona	97.41
PF01233		162	NMT: Myristoyl-CoA:protein N-myristoyltransferase,	97.29
PF06852		181	DUF1248: Protein of unknown function (DUF1248); In	97.19
TIGR03694		241	exosort_acyl putative PEP-CTERM/exosortase system-	97.13
TIGR03827		266	GNAT_ablB putative beta-lysine N-acetyltransferase	97.03
KOG3138\|consensus		187		96.91
PF13880		70	Acetyltransf_13: ESCO1/2 acetyl-transferase	96.75
TIGR03019		330	pepcterm_femAB FemAB-related protein, PEP-CTERM sy	96.65
PF09390		161	DUF1999: Protein of unknown function (DUF1999); In	96.5
COG3916		209	LasI N-acyl-L-homoserine lactone synthetase [Signa	96.43
COG3882		574	FkbH Predicted enzyme involved in methoxymalonyl-A	96.42
PF05301		120	Mec-17: Touch receptor neuron protein Mec-17; Inte	96.27
cd04264		99	DUF619-NAGS DUF619 domain of various N-acetylgluta	96.11
COG1243		515	ELP3 Histone acetyltransferase [Transcription / Ch	95.92
TIGR03244		336	arg_catab_AstA arginine N-succinyltransferase. In	95.74
TIGR03245		336	arg_AOST_alph arginine/ornithine succinyltransfera	95.71
PF04958		342	AstA: Arginine N-succinyltransferase beta subunit;	95.61
KOG2036\|consensus		1011		95.5
TIGR03243		335	arg_catab_AOST arginine and ornithine succinyltran	95.29
PRK10456		344	arginine succinyltransferase; Provisional	95.26
PRK14852		989	hypothetical protein; Provisional	95.15
PF02474		196	NodA: Nodulation protein A (NodA); InterPro: IPR00	94.89
cd04265		99	DUF619-NAGS-U DUF619 domain of various N-acetylglu	94.87
KOG2779\|consensus		421		94.53
KOG2535\|consensus		554		93.91
PF04377		128	ATE_C: Arginine-tRNA-protein transferase, C termin	93.69
PF13444		101	Acetyltransf_5: Acetyltransferase (GNAT) domain	93.25
PRK00756		196	acyltransferase NodA; Provisional	92.71
PHA00432		137	internal virion protein A	92.64
KOG4601\|consensus		264		92.39
PHA01733		153	hypothetical protein	92.04
PF09924		299	DUF2156: Uncharacterized conserved protein (DUF215	91.86
KOG3014\|consensus		257		91.81
PF04768		170	DUF619: Protein of unknown function (DUF619); Inte	91.53
PRK01305		240	arginyl-tRNA-protein transferase; Provisional	91.52
COG3138		336	AstA Arginine/ornithine N-succinyltransferase beta	90.39
PF01853		188	MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i	88.67
KOG3698\|consensus		891		87.07
COG5092		451	NMT1 N-myristoyl transferase [Lipid metabolism]	86.84
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	85.99
COG5630		495	ARG2 Acetylglutamate synthase [Amino acid transpor	85.16
PF11039		151	DUF2824: Protein of unknown function (DUF2824); In	84.66
PF02799		190	NMT_C: Myristoyl-CoA:protein N-myristoyltransferas	84.38
PLN03238		290	probable histone acetyltransferase MYST; Provision	82.26
PF04339		370	DUF482: Protein of unknown function, DUF482; Inter	81.35

>PRK10140 putative acetyltransferase YhhY; Provisional	Back alignment and domain information

Probab=99.83  E-value=5.7e-19  Score=139.99  Aligned_cols=147  Identities=18%  Similarity=0.281  Sum_probs=114.8

Q ss_pred             CCCCChhhHHHHHHhhcCC--CC------CCCchhHHHHhhcCCCeEEEEEEECCEEEEEEEEEeeeccccCccchhhhh
Q psy16746          1 MNSRSPDYQANVLTSTSLR--HS------GNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILA   72 (247)
Q Consensus         1 ~~~~~~~d~~~i~~l~~~~--fp------~~~~~~~~~~~~~~~~~~~~va~~~~~iVG~~~~~~~~~~~~~~~~~~~~~   72 (247)
                      ||+++++|.+.+.++....  +.      ...++.|.......+....+++..+|++||++.+.....+           
T Consensus         6 lr~~~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~vG~~~~~~~~~~-----------   74 (162)
T PRK10140          6 IRHAETRDYEAIRQIHAQPEVYHNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRP-----------   74 (162)
T ss_pred             EEecchhhHHHHHHHHhCcccccccccCCCcCHHHHHHHhhcCCCcEEEEEEECCEEEEEEEEeccccc-----------
Confidence            4778999999999998642  11      1122344443333344567888889999999998753210           


Q ss_pred             cccCCCCcEEEEEEEEeCcccccCCHHHHHHHHHHHHHhhhccCCccEEEEEEEcCCHHHHHHHHhCCCEEeeeecceec
Q psy16746         73 SSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYS  152 (247)
Q Consensus        73 ~~~~~~~~~~~I~~l~V~p~~rg~GiG~~Ll~~l~~~a~~~~~~g~~~i~l~v~~~N~~a~~fy~k~GF~~~g~~~~~~~  152 (247)
                          .....+.+ +++|+|++||+|+|+.|++.++++++  +..|++.+.+.|.+.|.+|++||+|+||+..|..+.++.
T Consensus        75 ----~~~~~~~~-~~~v~p~~rg~Gig~~ll~~l~~~~~--~~~~~~~i~l~v~~~N~~a~~~y~k~GF~~~g~~~~~~~  147 (162)
T PRK10140         75 ----RRSHVADF-GICVDSRWKNRGVASALMREMIEMCD--NWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYAL  147 (162)
T ss_pred             ----ccceEEEE-EEEECHHHcCCCHHHHHHHHHHHHHH--hhCCccEEEEEEEcCCHHHHHHHHHCCCEEEeeccccee
Confidence                11223444 49999999999999999999999998  237999999999999999999999999999999998888


Q ss_pred             cCCcccceEEEEE
Q psy16746        153 IKGRSRDGFTYVL  165 (247)
Q Consensus       153 ~~g~~~d~~~m~~  165 (247)
                      .+|.+.|...|.+
T Consensus       148 ~~~~~~d~~~~~~  160 (162)
T PRK10140        148 RNGEYVDAYYMAR  160 (162)
T ss_pred             eCCeEEEEEEEEe
Confidence            8899999999876

>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase	Back alignment and domain information

>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase	Back alignment and domain information

>KOG3139\|consensus	Back alignment and domain information

>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A	Back alignment and domain information

>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional	Back alignment and domain information

>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional	Back alignment and domain information

>PRK15130 spermidine N1-acetyltransferase; Provisional	Back alignment and domain information

>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional	Back alignment and domain information

>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase	Back alignment and domain information

>KOG3138\|consensus	Back alignment and domain information

>COG0456 RimI Acetyltransferases [General function prediction only]	Back alignment and domain information

>PRK03624 putative acetyltransferase; Provisional	Back alignment and domain information

>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase	Back alignment and domain information

>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase	Back alignment and domain information

>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2	Back alignment and domain information

>PHA00673 acetyltransferase domain containing protein	Back alignment and domain information

>KOG3235\|consensus	Back alignment and domain information

>PRK10975 TDP-fucosamine acetyltransferase; Provisional	Back alignment and domain information

>PTZ00330 acetyltransferase; Provisional	Back alignment and domain information

>PRK09831 putative acyltransferase; Provisional	Back alignment and domain information

>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A	Back alignment and domain information

>PLN02706 glucosamine 6-phosphate N-acetyltransferase	Back alignment and domain information

>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B	Back alignment and domain information

>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103	Back alignment and domain information

>PRK10514 putative acetyltransferase; Provisional	Back alignment and domain information

>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A	Back alignment and domain information

>KOG3216\|consensus	Back alignment and domain information

>PRK07922 N-acetylglutamate synthase; Validated	Back alignment and domain information

>KOG3234\|consensus	Back alignment and domain information

>PRK07757 acetyltransferase; Provisional	Back alignment and domain information

>PRK10562 putative acetyltransferase; Provisional	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>PLN02825 amino-acid N-acetyltransferase	Back alignment and domain information

>PRK05279 N-acetylglutamate synthase; Validated	Back alignment and domain information

>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase	Back alignment and domain information

>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>PRK10314 putative acyltransferase; Provisional	Back alignment and domain information

>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase	Back alignment and domain information

>PHA01807 hypothetical protein	Back alignment and domain information

>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional	Back alignment and domain information

>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism]	Back alignment and domain information

>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A	Back alignment and domain information

>COG3153 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>PRK01346 hypothetical protein; Provisional	Back alignment and domain information

>PRK13688 hypothetical protein; Provisional	Back alignment and domain information

>KOG2488\|consensus	Back alignment and domain information

>KOG3396\|consensus	Back alignment and domain information

>cd02169 Citrate_lyase_ligase Citrate lyase ligase	Back alignment and domain information

>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT)	Back alignment and domain information

>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase	Back alignment and domain information

>COG3393 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>COG3981 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>KOG3397\|consensus	Back alignment and domain information

>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B	Back alignment and domain information

>KOG4144\|consensus	Back alignment and domain information

>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate	Back alignment and domain information

>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only]	Back alignment and domain information

>COG2153 ElaA Predicted acyltransferase [General function prediction only]	Back alignment and domain information

>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A	Back alignment and domain information

>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2	Back alignment and domain information

>COG4552 Eis Predicted acetyltransferase involved in intracellular survival and related acetyltransferases [General function prediction only]	Back alignment and domain information

>KOG4135\|consensus	Back alignment and domain information

>COG5628 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>COG2388 Predicted acetyltransferase [General function prediction only]	Back alignment and domain information

>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth	Back alignment and domain information

>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain	Back alignment and domain information

>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only]	Back alignment and domain information

>COG3053 CitC Citrate lyase synthetase [Energy production and conversion]	Back alignment and domain information

>COG3375 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK13834 putative autoinducer synthesis protein; Provisional	Back alignment and domain information

>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2	Back alignment and domain information

>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans	Back alignment and domain information

>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase	Back alignment and domain information

>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase	Back alignment and domain information

>KOG3138\|consensus	Back alignment and domain information

>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase	Back alignment and domain information

>TIGR03019 pepcterm_femAB FemAB-related protein, PEP-CTERM system-associated	Back alignment and domain information

>PF09390 DUF1999: Protein of unknown function (DUF1999); InterPro: IPR018987 This family contains a putative Fe-S binding reductase (Q72J89 from SWISSPROT) whose structure adopts an alpha and beta fold	Back alignment and domain information

>COG3916 LasI N-acyl-L-homoserine lactone synthetase [Signal transduction mechanisms / Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch	Back alignment and domain information

>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish	Back alignment and domain information

>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics]	Back alignment and domain information

>TIGR03244 arg_catab_AstA arginine N-succinyltransferase	Back alignment and domain information

>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit	Back alignment and domain information

>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine	Back alignment and domain information

>KOG2036\|consensus	Back alignment and domain information

>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits	Back alignment and domain information

>PRK10456 arginine succinyltransferase; Provisional	Back alignment and domain information

>PRK14852 hypothetical protein; Provisional	Back alignment and domain information

>PF02474 NodA: Nodulation protein A (NodA); InterPro: IPR003484 Rhizobial nodulation (Nod) factors are signalling molecules secreted by root-nodulating rhizobia in response to flavanoids excreted by the host plant	Back alignment and domain information

>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish	Back alignment and domain information

>KOG2779\|consensus	Back alignment and domain information

>KOG2535\|consensus	Back alignment and domain information

>PF04377 ATE_C: Arginine-tRNA-protein transferase, C terminus; InterPro: IPR007472 Arginine-tRNA-protein transferase catalyses the post-translational conjugation of arginine to the N terminus of a protein	Back alignment and domain information

>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain	Back alignment and domain information

>PRK00756 acyltransferase NodA; Provisional	Back alignment and domain information

>PHA00432 internal virion protein A	Back alignment and domain information

>KOG4601\|consensus	Back alignment and domain information

>PHA01733 hypothetical protein	Back alignment and domain information

>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol []	Back alignment and domain information

>KOG3014\|consensus	Back alignment and domain information

>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2	Back alignment and domain information

>PRK01305 arginyl-tRNA-protein transferase; Provisional	Back alignment and domain information

>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism]	Back alignment and domain information

>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus	Back alignment and domain information

>KOG3698\|consensus	Back alignment and domain information

>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism]	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>PF11039 DUF2824: Protein of unknown function (DUF2824); InterPro: IPR022568 This family of proteins has no known function	Back alignment and domain information

>PF02799 NMT_C: Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain; InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2	Back alignment and domain information

>PLN03238 probable histone acetyltransferase MYST; Provisional	Back alignment and domain information

>PF04339 DUF482: Protein of unknown function, DUF482; InterPro: IPR007434 This family contains several proteins of uncharacterised function	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		247
2x7b_A		168	Crystal Structure Of The N-Terminal Acetylase Ard1		3e-07
3ld2_A		197	The Crystal Structure Of Smu.2055 From Streptococcu		8e-05
3tfy_A		169	Naa50p Amino-Terminal Acetyltransferase Bound To Su		5e-04

>pdb|2X7B|A Chain A, Crystal Structure Of The N-Terminal Acetylase Ard1 From Sulfolobus Solfataricus P2 Length = 168

Back alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 3e-07, Method: Compositional matrix adjust. Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 11/151 (7%) Query: 2 NSRSPDYQANVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYT 61 N+R D ++ L NYP ++ + E A+ + ++G I+ I Sbjct: 17 NARMDDID-QIIKINRLTLPENYPYYFFVEHLKEYGLAFFVAIVDNSVVGYIMPRIEWGF 75 Query: 62 SLNKEDKDILASSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAI 121 S K+ L S K G+++S+ V E+YRR GIA+ LL+ + + N+ + I Sbjct: 76 SNIKQ----LPSLVRK----GHVVSIAVLEEYRRKGIATTLLEASMKSMKNDYNA--EEI 125 Query: 122 FLHVLTSNKPAIHFYEKRRFRLHSFLPYYYS 152 +L V SN PAI YEK F+ L YY+ Sbjct: 126 YLEVRVSNYPAIALYEKLNFKKVKVLKGYYA 156

PyMOL of 2x7b

>pdb|3LD2|A Chain A, The Crystal Structure Of Smu.2055 From Streptococcus Mutans Ua159 Length = 197

Back alignment and structure

>pdb|3TFY|A Chain A, Naa50p Amino-Terminal Acetyltransferase Bound To Substrate Peptide Fragment And Coa Length = 169

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		247
2ob0_A		170	Human MAK3 homolog; acetyltransferase, structural	6e-30
2x7b_A		168	N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf	5e-23
1bo4_A		168	Protein (serratia marcescens aminoglycoside-3-N- a	2e-20
3jvn_A		166	Acetyltransferase; alpha-beta protein, structural	6e-18
3pp9_A		187	Putative streptothricin acetyltransferase; toxin p	3e-17
1wwz_A		159	Hypothetical protein PH1933; structural genomics,	4e-17
3ld2_A		197	SMU.2055, putative acetyltransferase; HET: COA; 2.	4e-17
2pdo_A		144	Acetyltransferase YPEA; alpha-beta-alpha sandwich,	1e-15
1s3z_A		165	Aminoglycoside 6'-N-acetyltransferase; GNAT, amino	2e-15
4e0a_A		164	BH1408 protein; structural genomics, PSI-biology,	6e-15
1on0_A		158	YYCN protein; structural genomics, alpha-beta prot	9e-15
2ae6_A		166	Acetyltransferase, GNAT family; GCN5-related N-ace	1e-14
2r7h_A		177	Putative D-alanine N-acetyltransferase of GNAT FA;	1e-14
3g8w_A		169	Lactococcal prophage PS3 protein 05; APC61042, ace	1e-14
1mk4_A		157	Hypothetical protein YQJY; alpha-beta-alpha sandwi	1e-14
2i79_A		172	Acetyltransferase, GNAT family; acetyl coenzyme *A	2e-14
3fyn_A		176	Integron gene cassette protein HFX_CASS3; integron	3e-14
1y9k_A		157	IAA acetyltransferase; structural genomics, midwes	3e-14
2ge3_A		170	Probable acetyltransferase; structural GEN PSI, pr	4e-14
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	5e-14
2i6c_A		160	Putative acetyltransferase; GNAT family, structura	5e-14
1ufh_A		180	YYCN protein; alpha and beta, fold, acetyltransfer	6e-14
3mgd_A		157	Predicted acetyltransferase; structural genomics,	6e-14
1z4e_A		153	Transcriptional regulator; nysgxrc target T2017, G	1e-13
4evy_A		166	Aminoglycoside N(6')-acetyltransferase type 1; cen	1e-13
2cnt_A		160	Modification of 30S ribosomal subunit protein S18;	1e-13
2aj6_A		159	Hypothetical protein MW0638; structural genomics,	2e-13
3bln_A		143	Acetyltransferase GNAT family; NP_981174.1, struct	4e-13
1u6m_A		199	Acetyltransferase, GNAT family; structural genomic	7e-13
1cjw_A		166	Protein (serotonin N-acetyltransferase); HET: COT;	8e-13
1yvk_A		163	Hypothetical protein BSU33890; ALPHS-beta protein,	9e-13
1vkc_A		158	Putative acetyl transferase; structural genomics,	1e-12
3ec4_A		228	Putative acetyltransferase from the GNAT family; Y	1e-12
3kkw_A		182	Putative uncharacterized protein; acetyltransferas	2e-12
1kux_A		207	Aralkylamine, serotonin N-acetyltransferase; enzym	2e-12
1tiq_A		180	Protease synthase and sporulation negative regulat	3e-12
3t9y_A		150	Acetyltransferase, GNAT family; PSI-biology, struc	5e-12
3dsb_A		157	Putative acetyltransferase; APC60368.2, ST genomic	7e-12
2dxq_A		150	AGR_C_4057P, acetyltransferase; structural genomic	1e-11
3c26_A		266	Putative acetyltransferase TA0821; NP_394282.1, A	3e-11
2r1i_A		172	GCN5-related N-acetyltransferase; YP_831484.1, put	8e-11
2vi7_A		177	Acetyltransferase PA1377; GNAT, GCN5 family, N-ace	9e-11
2eui_A		153	Probable acetyltransferase; dimer, structural geno	2e-10
3exn_A		160	Probable acetyltransferase; GCN5-related N-acetylt	2e-10
3f8k_A		160	Protein acetyltransferase; GCN5-related N-acetyltr	3e-10
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	6e-10
3fix_A		183	N-acetyltransferase; termoplasma acidophilum, stru	7e-10
2kcw_A		147	Uncharacterized acetyltransferase YJAB; GNAT fold,	1e-09
2fl4_A		149	Spermine/spermidine acetyltransferase; structural	1e-09
3frm_A		254	Uncharacterized conserved protein; APC61048, staph	3e-09
2vez_A		190	Putative glucosamine 6-phosphate acetyltransferase	4e-09
2cy2_A		174	TTHA1209, probable acetyltransferase; structural g	5e-09
3d3s_A		189	L-2,4-diaminobutyric acid acetyltransferase; alpha	8e-09
3fnc_A		163	Protein LIN0611, putative acetyltransferase; GNAT,	9e-09
3d8p_A		163	Acetyltransferase of GNAT family; NP_373092.1, str	1e-08
2ft0_A		235	TDP-fucosamine acetyltransferase; GNAT fold acetyl	1e-08
1i12_A		160	Glucosamine-phosphate N-acetyltransferase; GNAT, a	1e-08
2fia_A		162	Acetyltransferase; structural genomics, PSI, prote	2e-08
2gan_A		190	182AA long hypothetical protein; alpha-beta protei	3e-08
2bei_A		170	Diamine acetyltransferase 2; SSAT2, BC011751, AAH1	3e-08
2oh1_A		179	Acetyltransferase, GNAT family; YP_013287.1, struc	4e-08
2fe7_A		166	Probable N-acetyltransferase; structural genomics,	4e-08
2o28_A		184	Glucosamine 6-phosphate N-acetyltransferase; struc	4e-08
3qb8_A		197	A654L protein; GNAT N-acetyltransferase, acetyltra	7e-08
3t90_A		149	Glucose-6-phosphate acetyltransferase 1; GNAT fold	1e-07
2b5g_A		171	Diamine acetyltransferase 1; structural genomics,	1e-07
1sqh_A		312	Hypothetical protein CG14615-PA; structural genomi	2e-07
3owc_A		188	Probable acetyltransferase; structural genomics, P	2e-07
3i3g_A		161	N-acetyltransferase; malaria, structural genomics,	2e-07
3i9s_A		183	Integron cassette protein; oyster POND, woods HOLE	3e-07
1ghe_A		177	Acetyltransferase; acyl coenzyme A complex; HET: A	3e-07
1y9w_A		140	Acetyltransferase; structural genomics, Pro struct	4e-07
2fiw_A		172	GCN5-related N-acetyltransferase:aminotransferase	7e-07
3gy9_A		150	GCN5-related N-acetyltransferase; YP_001815201.1,	9e-07
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	1e-06
1qsm_A		152	HPA2 histone acetyltransferase; protein-acetyl coe	1e-06
4ag7_A		165	Glucosamine-6-phosphate N-acetyltransferase; HET:	1e-06
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	1e-06
3s6f_A		145	Hypothetical acetyltransferase; acyl-COA N-acyltra	1e-06
1m4i_A		181	Aminoglycoside 2'-N-acetyltransferase; COA binding	2e-06
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	2e-06
1y7r_A		133	Hypothetical protein SA2161; structural genomics,	2e-06
2g3a_A		152	Acetyltransferase; structural genomics, PSI, prote	2e-06
2atr_A		138	Acetyltransferase, GNAT family; MCSG, structural g	4e-06
2bue_A		202	AAC(6')-IB; GNAT, transferase, aminoglycoside, flu	8e-06
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	1e-05
3tth_A		170	Spermidine N1-acetyltransferase; central intermedi	1e-05
2ree_A		224	CURA; GNAT, S-acetyltransferase, decarboxylase, po	2e-05
2pc1_A		201	Acetyltransferase, GNAT family; NP_688560.1, struc	2e-05
2q7b_A		181	Acetyltransferase, GNAT family; NP_689019.1, struc	3e-05
2qec_A		204	Histone acetyltransferase HPA2 and related acetylt	5e-05
3f5b_A		182	Aminoglycoside N(6')acetyltransferase; APC60744, l	7e-05
3eo4_A		164	Uncharacterized protein MJ1062; APC60792.2,MJ_1062	2e-04
3eg7_A		176	Spermidine N1-acetyltransferase; structural genomi	2e-04
1n71_A		180	AAC(6')-II; aminoglycoside 6'-N-acetyltransferase,	2e-04
3lod_A		162	Putative acyl-COA N-acyltransferase; structural ge	3e-04
4fd5_A		222	Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A	4e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04
3e0k_A		150	Amino-acid acetyltransferase; N-acetylglutamate sy	6e-04
2qml_A		198	BH2621 protein; structural genomics, joint center	8e-04

>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Length = 170	Back alignment and structure

 Score =  108 bits (273), Expect = 6e-30
 Identities = 33/153 (21%), Positives = 62/153 (40%), Gaps = 20/153 (13%)

Query: 23  NYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIEVG 82
           +Y   +YKD+        LA  +N + +G +   +                   ++ +  
Sbjct: 31  SYNDKFYKDVLEVGELAKLAY-FNDIAVGAVCCRV----------------DHSQNQKRL 73

Query: 83  YILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFR 142
           YI++LG    YRR GI + +L+++++     ++ +   I+LHV  SN+ AI FY K  F 
Sbjct: 74  YIMTLGCLAPYRRLGIGTKMLNHVLNIC--EKDGTFDNIYLHVQISNESAIDFYRKFGFE 131

Query: 143 LHSFLPYYYSIKGRSRDGFTYVLYINGGHAAWS 175
           +      YY  +    D       +       +
Sbjct: 132 IIETKKNYYK-RIEPADAHVLQKNLKVPSGQNA 163

PyMOL of 2ob0

>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Length = 168	Back alignment and structure

>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Length = 168	Back alignment and structure

>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Length = 166	Back alignment and structure

>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Length = 187	Back alignment and structure

>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 159	Back alignment and structure

>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Length = 197	Back alignment and structure

>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Length = 144	Back alignment and structure

>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Length = 165	Back alignment and structure

>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Length = 164	Back alignment and structure

>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Length = 158	Back alignment and structure

>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 166	Back alignment and structure

>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Length = 177	Back alignment and structure

>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 169	Back alignment and structure

>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Length = 157	Back alignment and structure

>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Length = 172	Back alignment and structure

>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Length = 176	Back alignment and structure

>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Length = 157	Back alignment and structure

>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Length = 170	Back alignment and structure

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Length = 153	Back alignment and structure

>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Length = 160	Back alignment and structure

>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 180	Back alignment and structure

>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Length = 157	Back alignment and structure

>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Length = 153	Back alignment and structure

>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Length = 166	Back alignment and structure

>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Length = 160	Back alignment and structure

>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Length = 159	Back alignment and structure

>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Length = 143	Back alignment and structure

>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 199	Back alignment and structure

>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Length = 166	Back alignment and structure

>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Length = 163	Back alignment and structure

>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Length = 158	Back alignment and structure

>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Length = 228	Back alignment and structure

>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Length = 182	Back alignment and structure

>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Length = 207	Back alignment and structure

>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Length = 180	Back alignment and structure

>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Length = 150	Back alignment and structure

>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Length = 157	Back alignment and structure

>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Length = 150	Back alignment and structure

>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Length = 266	Back alignment and structure

>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Length = 172	Back alignment and structure

>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Length = 177	Back alignment and structure

>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Length = 153	Back alignment and structure

>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Length = 160	Back alignment and structure

>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Length = 160	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Length = 318	Back alignment and structure

>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Length = 183	Back alignment and structure

>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Length = 147	Back alignment and structure

>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 149	Back alignment and structure

>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Length = 254	Back alignment and structure

>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Length = 190	Back alignment and structure

>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Length = 174	Back alignment and structure

>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Length = 189	Back alignment and structure

>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} Length = 163	Back alignment and structure

>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Length = 163	Back alignment and structure

>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Length = 235	Back alignment and structure

>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Length = 160	Back alignment and structure

>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Length = 162	Back alignment and structure

>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Length = 190	Back alignment and structure

>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Length = 170	Back alignment and structure

>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Length = 179	Back alignment and structure

>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Length = 166	Back alignment and structure

>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Length = 184	Back alignment and structure

>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Length = 197	Back alignment and structure

>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Length = 149	Back alignment and structure

>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Length = 171	Back alignment and structure

>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Length = 312	Back alignment and structure

>3owc_A Probable acetyltransferase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Length = 188	Back alignment and structure

>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Length = 161	Back alignment and structure

>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Length = 183	Back alignment and structure

>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Length = 177	Back alignment and structure

>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Length = 140	Back alignment and structure

>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Length = 172	Back alignment and structure

>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Length = 150	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Length = 330	Back alignment and structure

>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Length = 152	Back alignment and structure

>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Length = 165	Back alignment and structure

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Length = 181	Back alignment and structure

>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Length = 145	Back alignment and structure

>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Length = 181	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Length = 288	Back alignment and structure

>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Length = 133	Back alignment and structure

>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Length = 152	Back alignment and structure

>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Length = 138	Back alignment and structure

>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Length = 202	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Length = 339	Back alignment and structure

>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Length = 170	Back alignment and structure

>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Length = 224	Back alignment and structure

>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Length = 201	Back alignment and structure

>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Length = 181	Back alignment and structure

>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Length = 204	Back alignment and structure

>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Length = 182	Back alignment and structure

>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Length = 164	Back alignment and structure

>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} Length = 176	Back alignment and structure

>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Length = 180	Back alignment and structure

>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Length = 162	Back alignment and structure

>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Length = 222	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Length = 150	Back alignment and structure

>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Length = 198	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		247
2cnt_A		160	Modification of 30S ribosomal subunit protein S18;	99.9
2ob0_A		170	Human MAK3 homolog; acetyltransferase, structural	99.89
2x7b_A		168	N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf	99.89
4h89_A		173	GCN5-related N-acetyltransferase; N-acyltransferas	99.88
1tiq_A		180	Protease synthase and sporulation negative regulat	99.88
2i79_A		172	Acetyltransferase, GNAT family; acetyl coenzyme *A	99.87
3kkw_A		182	Putative uncharacterized protein; acetyltransferas	99.87
3dr6_A		174	YNCA; acetyltransferase, csgid target, essential g	99.87
3g8w_A		169	Lactococcal prophage PS3 protein 05; APC61042, ace	99.87
2ae6_A		166	Acetyltransferase, GNAT family; GCN5-related N-ace	99.87
1vhs_A		175	Similar to phosphinothricin acetyltransferase; str	99.87
2i6c_A		160	Putative acetyltransferase; GNAT family, structura	99.87
2ge3_A		170	Probable acetyltransferase; structural GEN PSI, pr	99.87
3owc_A		188	Probable acetyltransferase; structural genomics, P	99.86
2jlm_A		182	Putative phosphinothricin N-acetyltransferase; met	99.86
1ghe_A		177	Acetyltransferase; acyl coenzyme A complex; HET: A	99.86
2j8m_A		172	Acetyltransferase PA4866 from P. aeruginosa; GCN5	99.86
2vi7_A		177	Acetyltransferase PA1377; GNAT, GCN5 family, N-ace	99.85
3tth_A		170	Spermidine N1-acetyltransferase; central intermedi	99.85
3eg7_A		176	Spermidine N1-acetyltransferase; structural genomi	99.85
1yr0_A		175	AGR_C_1654P, phosphinothricin acetyltransferase; s	99.85
3r9f_A		188	MCCE protein; microcin C7, acetyltransferase, SELF	99.84
1s7k_A		182	Acetyl transferase; GNAT; 1.80A {Salmonella typhim	99.84
3ld2_A		197	SMU.2055, putative acetyltransferase; HET: COA; 2.	99.84
3lod_A		162	Putative acyl-COA N-acyltransferase; structural ge	99.84
3fbu_A		168	Acetyltransferase, GNAT family; structur genomics,	99.84
1mk4_A		157	Hypothetical protein YQJY; alpha-beta-alpha sandwi	99.84
3igr_A		184	Ribosomal-protein-S5-alanine N-acetyltransferase;	99.84
4evy_A		166	Aminoglycoside N(6')-acetyltransferase type 1; cen	99.84
2dxq_A		150	AGR_C_4057P, acetyltransferase; structural genomic	99.83
2ree_A		224	CURA; GNAT, S-acetyltransferase, decarboxylase, po	99.83
1s3z_A		165	Aminoglycoside 6'-N-acetyltransferase; GNAT, amino	99.83
1nsl_A		184	Probable acetyltransferase; structural genomics, h	99.83
2r7h_A		177	Putative D-alanine N-acetyltransferase of GNAT FA;	99.83
4e0a_A		164	BH1408 protein; structural genomics, PSI-biology,	99.83
1yre_A		197	Hypothetical protein PA3270; APC5563, midwest cent	99.83
2fia_A		162	Acetyltransferase; structural genomics, PSI, prote	99.82
3d8p_A		163	Acetyltransferase of GNAT family; NP_373092.1, str	99.82
2cy2_A		174	TTHA1209, probable acetyltransferase; structural g	99.82
2fck_A		181	Ribosomal-protein-serine acetyltransferase, putat;	99.82
2q7b_A		181	Acetyltransferase, GNAT family; NP_689019.1, struc	99.82
2pdo_A		144	Acetyltransferase YPEA; alpha-beta-alpha sandwich,	99.81
1y9k_A		157	IAA acetyltransferase; structural genomics, midwes	99.81
2z10_A		194	Ribosomal-protein-alanine acetyltransferase; alpha	99.81
3pzj_A		209	Probable acetyltransferases; MCSG, PSI-2, structur	99.81
1n71_A		180	AAC(6')-II; aminoglycoside 6'-N-acetyltransferase,	99.81
1wwz_A		159	Hypothetical protein PH1933; structural genomics,	99.81
3bln_A		143	Acetyltransferase GNAT family; NP_981174.1, struct	99.81
1u6m_A		199	Acetyltransferase, GNAT family; structural genomic	99.8
1m4i_A		181	Aminoglycoside 2'-N-acetyltransferase; COA binding	99.8
2fl4_A		149	Spermine/spermidine acetyltransferase; structural	99.8
1z4e_A		153	Transcriptional regulator; nysgxrc target T2017, G	99.8
3t9y_A		150	Acetyltransferase, GNAT family; PSI-biology, struc	99.8
3fnc_A		163	Protein LIN0611, putative acetyltransferase; GNAT,	99.8
2eui_A		153	Probable acetyltransferase; dimer, structural geno	99.79
3fix_A		183	N-acetyltransferase; termoplasma acidophilum, stru	99.79
3tcv_A		246	GCN5-related N-acetyltransferase; GRAM negative co	99.79
2bei_A		170	Diamine acetyltransferase 2; SSAT2, BC011751, AAH1	99.79
1z4r_A		168	General control of amino acid synthesis protein 5-	99.79
3dsb_A		157	Putative acetyltransferase; APC60368.2, ST genomic	99.79
2fe7_A		166	Probable N-acetyltransferase; structural genomics,	99.79
1y9w_A		140	Acetyltransferase; structural genomics, Pro struct	99.79
1qsm_A		152	HPA2 histone acetyltransferase; protein-acetyl coe	99.78
3efa_A		147	Putative acetyltransferase; structural genom 2, pr	99.78
2fiw_A		172	GCN5-related N-acetyltransferase:aminotransferase	99.78
3ey5_A		181	Acetyltransferase-like, GNAT family; structural ge	99.78
3exn_A		160	Probable acetyltransferase; GCN5-related N-acetylt	99.77
1cjw_A		166	Protein (serotonin N-acetyltransferase); HET: COT;	99.77
3jvn_A		166	Acetyltransferase; alpha-beta protein, structural	99.76
1vkc_A		158	Putative acetyl transferase; structural genomics,	99.76
3ec4_A		228	Putative acetyltransferase from the GNAT family; Y	99.76
1y7r_A		133	Hypothetical protein SA2161; structural genomics,	99.76
1kux_A		207	Aralkylamine, serotonin N-acetyltransferase; enzym	99.76
2aj6_A		159	Hypothetical protein MW0638; structural genomics,	99.76
3f8k_A		160	Protein acetyltransferase; GCN5-related N-acetyltr	99.76
3i3g_A		161	N-acetyltransferase; malaria, structural genomics,	99.76
3f5b_A		182	Aminoglycoside N(6')acetyltransferase; APC60744, l	99.75
3fyn_A		176	Integron gene cassette protein HFX_CASS3; integron	99.75
2vzy_A		218	RV0802C; transferase, GCN5-related N-acetyltransfe	99.75
2bue_A		202	AAC(6')-IB; GNAT, transferase, aminoglycoside, flu	99.75
3i9s_A		183	Integron cassette protein; oyster POND, woods HOLE	99.75
2jdc_A		146	Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.	99.75
1q2y_A		140	Protein YJCF, similar to hypothetical proteins; GC	99.75
3d3s_A		189	L-2,4-diaminobutyric acid acetyltransferase; alpha	99.75
3pp9_A		187	Putative streptothricin acetyltransferase; toxin p	99.74
3mgd_A		157	Predicted acetyltransferase; structural genomics,	99.74
1yx0_A		159	Hypothetical protein YSNE; NESG, GFT structral gen	99.74
2b5g_A		171	Diamine acetyltransferase 1; structural genomics,	99.74
1bo4_A		168	Protein (serratia marcescens aminoglycoside-3-N- a	99.74
3e0k_A		150	Amino-acid acetyltransferase; N-acetylglutamate sy	99.74
2q0y_A		153	GCN5-related N-acetyltransferase; YP_295895.1, ace	99.74
1xeb_A		150	Hypothetical protein PA0115; midwest center for st	99.73
2oh1_A		179	Acetyltransferase, GNAT family; YP_013287.1, struc	99.73
3h4q_A		188	Putative acetyltransferase; NP_371943.1, structura	99.73
2atr_A		138	Acetyltransferase, GNAT family; MCSG, structural g	99.73
1on0_A		158	YYCN protein; structural genomics, alpha-beta prot	99.73
1ygh_A		164	ADA4, protein (transcriptional activator GCN5); tr	99.72
3eo4_A		164	Uncharacterized protein MJ1062; APC60792.2,MJ_1062	99.72
2ozh_A		142	Hypothetical protein XCC2953; structural genomics,	99.72
2g3a_A		152	Acetyltransferase; structural genomics, PSI, prote	99.72
1ufh_A		180	YYCN protein; alpha and beta, fold, acetyltransfer	99.72
1qst_A		160	TGCN5 histone acetyl transferase; GCN5-related N-a	99.72
3c26_A		266	Putative acetyltransferase TA0821; NP_394282.1, A	99.72
2r1i_A		172	GCN5-related N-acetyltransferase; YP_831484.1, put	99.71
4fd4_A		217	Arylalkylamine N-acetyltransferase like 5B; GNAT;	99.71
2kcw_A		147	Uncharacterized acetyltransferase YJAB; GNAT fold,	99.71
3t90_A		149	Glucose-6-phosphate acetyltransferase 1; GNAT fold	99.7
3gy9_A		150	GCN5-related N-acetyltransferase; YP_001815201.1,	99.7
2qec_A		204	Histone acetyltransferase HPA2 and related acetylt	99.7
2pc1_A		201	Acetyltransferase, GNAT family; NP_688560.1, struc	99.7
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	99.7
2qml_A		198	BH2621 protein; structural genomics, joint center	99.7
3te4_A		215	GH12636P, dopamine N acetyltransferase, isoform A;	99.68
2gan_A		190	182AA long hypothetical protein; alpha-beta protei	99.68
3qb8_A		197	A654L protein; GNAT N-acetyltransferase, acetyltra	99.68
2o28_A		184	Glucosamine 6-phosphate N-acetyltransferase; struc	99.68
2d4p_A		141	Hypothetical protein TTHA1254; structural genomics	99.68
2fsr_A		195	Acetyltransferase; alpha-beta-sandwich, structural	99.67
2k5t_A		128	Uncharacterized protein YHHK; N-acetyl transferase	99.67
1yk3_A		210	Hypothetical protein RV1347C/MT1389; acyltransfera	99.67
1yvk_A		163	Hypothetical protein BSU33890; ALPHS-beta protein,	99.67
2zw5_A		301	Bleomycin acetyltransferase; dimer, two domains; H	99.66
1i12_A		160	Glucosamine-phosphate N-acetyltransferase; GNAT, a	99.66
4ag7_A		165	Glucosamine-6-phosphate N-acetyltransferase; HET:	99.65
4fd5_A		222	Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A	99.65
2q04_A		211	Acetoin utilization protein; ZP_00540088.1, struct	99.64
3shp_A		176	Putative acetyltransferase STHE_0691; PSI-biology,	99.64
4ava_A		333	Lysine acetyltransferase; allosteric regulation, d	99.64
2vez_A		190	Putative glucosamine 6-phosphate acetyltransferase	99.64
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	99.63
3juw_A		175	Probable GNAT-family acetyltransferase; structural	99.62
2g0b_A		198	FEEM; N-acyl transferase, environmental DNA, prote	99.62
3frm_A		254	Uncharacterized conserved protein; APC61048, staph	99.61
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	99.59
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	99.59
3d2m_A		456	Putative acetylglutamate synthase; protein-COA-Glu	99.59
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	99.58
2wpx_A		339	ORF14; transferase, acetyl transferase, antibiotic	99.56
4fd7_A		238	Putative arylalkylamine N-acetyltransferase 7; GNA	99.55
2pr1_A		163	Uncharacterized N-acetyltransferase YLBP; YIBP pro	99.55
2ozg_A		396	GCN5-related N-acetyltransferase; YP_325469.1, ace	99.54
1sqh_A		312	Hypothetical protein CG14615-PA; structural genomi	99.54
2ft0_A		235	TDP-fucosamine acetyltransferase; GNAT fold acetyl	99.52
3n7z_A		388	Acetyltransferase, GNAT family; PSI2, MCSG, struct	99.5
3r1k_A		428	Enhanced intracellular surviVal protein; GNAT, ace	99.49
3g3s_A		249	GCN5-related N-acetyltransferase; ZP_00874857.1, a	99.49
3s6f_A		145	Hypothetical acetyltransferase; acyl-COA N-acyltra	99.48
3tt2_A		330	GCN5-related N-acetyltransferase; structural genom	99.48
3sxn_A		422	Enhanced intracellular surviVal protein; GNAT fold	99.46
2hv2_A		400	Hypothetical protein; PSI, protein structure initi	99.45
2i00_A		406	Acetyltransferase, GNAT family; structural genomic	99.43
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	99.41
3dns_A		135	Ribosomal-protein-alanine acetyltransferase; N-ter	99.39
1p0h_A		318	Hypothetical protein RV0819; GNAT fold, acetyltran	99.38
1r57_A		102	Conserved hypothetical protein; GCN5, N-acetyltran	99.28
1ro5_A		201	Autoinducer synthesis protein LASI; alpha-beta-alp	98.88
3p2h_A		201	AHL synthase; acyl-ACP binding, SAM binding, signa	98.61
1xmt_A		103	Putative acetyltransferase; structural genomics, p	98.59
1kzf_A		230	Acyl-homoserinelactone synthase ESAI; alpha-beta,	98.44
1bob_A		320	HAT1, histone acetyltransferase; histone modificat	98.16
1yle_A		342	Arginine N-succinyltransferase, alpha chain; struc	97.84
3ddd_A		288	Putative acetyltransferase; NP_142035.1, structura	97.22
4b14_A		385	Glycylpeptide N-tetradecanoyltransferase; malaria,	97.12
3iu1_A		383	Glycylpeptide N-tetradecanoyltransferase 1; N-myri	96.9
2wuu_A		421	N-myristoyltransferase; acyltransferase; HET: NHM;	96.55
3s6g_A		460	N-acetylglutamate kinase / N-acetylglutamate SYNT;	96.51
1iic_A		422	Peptide N-myristoyltransferase; HET: MYA; 2.20A {S	96.49
1iyk_A		392	Myristoyl-COA:protein N-myristoyltransferase; HET:	96.48
4hkf_A		191	Alpha-tubulin N-acetyltransferase; tubulin acetylt	96.27
2p0w_A		324	Histone acetyltransferase type B catalytic subuni;	96.25
1rxt_A		496	Myristoyl-, glycylpeptide N-tetradecanoyltransfera	96.07
4b5o_A		200	Alpha-tubulin N-acetyltransferase; microtubules, c	95.93
3gkr_A		336	FEMX; FEMX, peptidoglycan, hexapeptide, transferas	95.42
4h6u_A		200	Alpha-tubulin N-acetyltransferase; tubulin acetylt	95.33
4gs4_A		240	Alpha-tubulin N-acetyltransferase; acetyl coenzyme	95.13
3gkr_A		336	FEMX; FEMX, peptidoglycan, hexapeptide, transferas	94.48
3s6k_A		467	Acetylglutamate kinase; synthase, transferase; 2.8	94.41
3iwg_A		276	Acetyltransferase, GNAT family; structural genomic	93.9
1lrz_A		426	FEMA, factor essential for expression of methicill	91.24
4ab7_A		464	Protein Arg5,6, mitochondrial; transferase, argini	89.58
4b14_A		385	Glycylpeptide N-tetradecanoyltransferase; malaria,	85.95
3to7_A		276	Histone acetyltransferase ESA1; MYST family; HET:	83.97
2ou2_A		280	Histone acetyltransferase htatip; structural genom	83.77
2ozu_A		284	Histone acetyltransferase MYST3; structural genomi	83.77
2wuu_A		421	N-myristoyltransferase; acyltransferase; HET: NHM;	83.74
2pq8_A		278	Probable histone acetyltransferase MYST1; MOF, str	81.68

>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A*	Back alignment and structure

Probab=99.90  E-value=1.5e-22  Score=158.62  Aligned_cols=147  Identities=18%  Similarity=0.308  Sum_probs=129.7

Q ss_pred             CCCCChhhHHHHHHhhcCCCCCCCchhHHHHhhcCCCeEEEEEEECCEEEEEEEEEeeeccccCccchhhhhcccCCCCc
Q psy16746          1 MNSRSPDYQANVLTSTSLRHSGNYPLSWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILASSFDKHIE   80 (247)
Q Consensus         1 ~~~~~~~d~~~i~~l~~~~fp~~~~~~~~~~~~~~~~~~~~va~~~~~iVG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (247)
                      ||.++++|++.+.++....++.+++...+...+.. ....+++..+|++||++.+...                    ..
T Consensus         4 ir~~~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~~-~~~~~v~~~~~~~vG~~~~~~~--------------------~~   62 (160)
T 2cnt_A            4 ISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGE-RYLNLKLTADDRMAAFAITQVV--------------------LD   62 (160)
T ss_dssp             EEECCGGGHHHHHHHHHHHCSSCCCHHHHHHSCST-TBCCEEEEETTEEEEEEEEEEE--------------------TT
T ss_pred             EEeCCHHHHHHHHHHHHhhcccCCCHHHHHHHhcc-CccEEEEEECCeEEEEEEEEec--------------------CC
Confidence            46789999999999999888878887777777654 4566888999999999998753                    24


Q ss_pred             EEEEEEEEeCcccccCCHHHHHHHHHHHHHhhhccCCccEEEEEEEcCCHHHHHHHHhCCCEEeeeecceeccCCcccce
Q psy16746         81 VGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYSIKGRSRDG  160 (247)
Q Consensus        81 ~~~I~~l~V~p~~rg~GiG~~Ll~~l~~~a~~~~~~g~~~i~l~v~~~N~~a~~fy~k~GF~~~g~~~~~~~~~g~~~d~  160 (247)
                      .++|..++|+|+|||+|+|++|++.+++.++   +.|++.+.+.|.+.|.+|++||+|+||+.++..+.++..++.+.|.
T Consensus        63 ~~~i~~~~v~p~~rg~Gig~~ll~~~~~~~~---~~g~~~i~l~v~~~N~~a~~~y~k~GF~~~~~~~~~~~~~~~~~d~  139 (160)
T 2cnt_A           63 EATLFNIAVDPDFQRRGLGRMLLEHLIDELE---TRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDA  139 (160)
T ss_dssp             EEEEEEEEECGGGCSSSHHHHHHHHHHHHHH---HTTCCEEEEEEETTCHHHHHHHHHHTCEEEEEEEEEEEETTEEEEE
T ss_pred             ceEEEEEEECHHHcCCCHHHHHHHHHHHHHH---HcCCcEEEEEEecCCHHHHHHHHHCCCEEEEEEeeeeecCCCCccE
Confidence            6889999999999999999999999999999   7999999999999999999999999999999999999877778999


Q ss_pred             EEEEEEecCCC
Q psy16746        161 FTYVLYINGGH  171 (247)
Q Consensus       161 ~~m~~~l~~~~  171 (247)
                      ++|.+.+....
T Consensus       140 ~~~~~~~~~~~  150 (160)
T 2cnt_A          140 IIMALPISMKL  150 (160)
T ss_dssp             EEEEEECCCCC
T ss_pred             EEEEeechhhh
Confidence            99999886543

PyMOL of 2cnt

>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A*	Back alignment and structure

>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus}	Back alignment and structure

>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida}	Back alignment and structure

>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae}	Back alignment and structure

>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1}	Back alignment and structure

>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A*	Back alignment and structure

>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A*	Back alignment and structure

>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1	Back alignment and structure

>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa}	Back alignment and structure

>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi}	Back alignment and structure

>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A*	Back alignment and structure

>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A	Back alignment and structure

>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa}	Back alignment and structure

>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii}	Back alignment and structure

>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0	Back alignment and structure

>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A*	Back alignment and structure

>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A	Back alignment and structure

>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans}	Back alignment and structure

>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str}	Back alignment and structure

>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0	Back alignment and structure

>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A	Back alignment and structure

>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A*	Back alignment and structure

>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A*	Back alignment and structure

>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp}	Back alignment and structure

>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A*	Back alignment and structure

>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp}	Back alignment and structure

>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A*	Back alignment and structure

>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1	Back alignment and structure

>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V}	Back alignment and structure

>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A}	Back alignment and structure

>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1	Back alignment and structure

>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A*	Back alignment and structure

>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum}	Back alignment and structure

>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A*	Back alignment and structure

>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus}	Back alignment and structure

>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A*	Back alignment and structure

>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1	Back alignment and structure

>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1	Back alignment and structure

>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus}	Back alignment and structure

>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0	Back alignment and structure

>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1	Back alignment and structure

>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A*	Back alignment and structure

>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID}	Back alignment and structure

>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A*	Back alignment and structure

>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B*	Back alignment and structure

>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile}	Back alignment and structure

>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1	Back alignment and structure

>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1	Back alignment and structure

>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A	Back alignment and structure

>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1}	Back alignment and structure

>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1	Back alignment and structure

>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus}	Back alignment and structure

>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A	Back alignment and structure

>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri}	Back alignment and structure

>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1	Back alignment and structure

>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID}	Back alignment and structure

>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1	Back alignment and structure

>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E*	Back alignment and structure

>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1	Back alignment and structure

>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2}	Back alignment and structure

>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A	Back alignment and structure

>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp}	Back alignment and structure

>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium}	Back alignment and structure

>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A*	Back alignment and structure

>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A*	Back alignment and structure

>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae}	Back alignment and structure

>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A*	Back alignment and structure

>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822}	Back alignment and structure

>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis}	Back alignment and structure

>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum}	Back alignment and structure

>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A*	Back alignment and structure

>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1	Back alignment and structure

>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus}	Back alignment and structure

>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134}	Back alignment and structure

>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1	Back alignment and structure

>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str}	Back alignment and structure

>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp}	Back alignment and structure

>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1	Back alignment and structure

>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1	Back alignment and structure

>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii}	Back alignment and structure

>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV}	Back alignment and structure

>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A*	Back alignment and structure

>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728}	Back alignment and structure

>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP}	Back alignment and structure

>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti}	Back alignment and structure

>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli}	Back alignment and structure

>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana}	Back alignment and structure

>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A*	Back alignment and structure

>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V}	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea}	Back alignment and structure

>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans}	Back alignment and structure

>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A*	Back alignment and structure

>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1	Back alignment and structure

>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1}	Back alignment and structure

>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A	Back alignment and structure

>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A	Back alignment and structure

>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1	Back alignment and structure

>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12}	Back alignment and structure

>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1	Back alignment and structure

>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1	Back alignment and structure

>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A*	Back alignment and structure

>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A	Back alignment and structure

>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A*	Back alignment and structure

>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A	Back alignment and structure

>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum}	Back alignment and structure

>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus}	Back alignment and structure

>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A*	Back alignment and structure

>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A*	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis}	Back alignment and structure

>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium}	Back alignment and structure

>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis}	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii}	Back alignment and structure

>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A*	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A*	Back alignment and structure

>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti}	Back alignment and structure

>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis}	Back alignment and structure

>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5	Back alignment and structure

>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A*	Back alignment and structure

>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis}	Back alignment and structure

>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A	Back alignment and structure

>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis}	Back alignment and structure

>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans}	Back alignment and structure

>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus}	Back alignment and structure

>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis}	Back alignment and structure

>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum}	Back alignment and structure

>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A*	Back alignment and structure

>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A*	Back alignment and structure

>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3	Back alignment and structure

>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A*	Back alignment and structure

>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A*	Back alignment and structure

>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A	Back alignment and structure

>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1	Back alignment and structure

>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8	Back alignment and structure

>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii}	Back alignment and structure

>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A*	Back alignment and structure

>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A*	Back alignment and structure

>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A*	Back alignment and structure

>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A*	Back alignment and structure

>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A*	Back alignment and structure

>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A	Back alignment and structure

>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A*	Back alignment and structure

>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens}	Back alignment and structure

>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2	Back alignment and structure

>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A*	Back alignment and structure

>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A	Back alignment and structure

>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A*	Back alignment and structure

>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens}	Back alignment and structure

>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A	Back alignment and structure

>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV}	Back alignment and structure

>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea}	Back alignment and structure

>1lrz_A FEMA, factor essential for expression of methicillin resistance; peptidoglycan, X-RAY crystallography, multiple anomalous dispersion; 2.10A {Staphylococcus aureus} SCOP: a.2.7.4 d.108.1.4 d.108.1.4	Back alignment and structure

>4ab7_A Protein Arg5,6, mitochondrial; transferase, arginine biosynthesis, amino acid kinase domain GCN5-related acetyltransferase, GNAT; HET: NLG; 3.25A {Saccharomyces cerevisiae} PDB: 3zzi_A*	Back alignment and structure

>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A*	Back alignment and structure

>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A*	Back alignment and structure

>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens}	Back alignment and structure

>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A	Back alignment and structure

>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A*	Back alignment and structure

>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		247
d1p0ha_		308	d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacter	7e-11
d1sqha_		297	d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fr	9e-11
d1s3za_		147	d.108.1.1 (A:) Aminoglycoside N-acetyltransferase	5e-09
d1cjwa_		166	d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep	6e-09
d1vkca_		149	d.108.1.1 (A:) Putative acetyltransferase PF0028 {	2e-08
d1u6ma_		189	d.108.1.1 (A:) Putative acetyltransferase EF0945 {	1e-07
d2gana1		182	d.108.1.1 (A:1-182) Hypothetical protein PH0736 {P	1e-07
d1bo4a_		137	d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferas	2e-07
d1z4ea1		150	d.108.1.1 (A:4-153) Transcriptional regulator BH19	2e-07
d1y9ka1		152	d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillu	1e-06
d2cy2a1		174	d.108.1.1 (A:1-174) Probable acetyltransferase TTH	7e-06
d1tiqa_		173	d.108.1.1 (A:) Protease synthase and sporulation n	8e-06
d1n71a_		180	d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransfera	1e-05
d1ygha_		164	d.108.1.1 (A:) Catalytic domain of GCN5 histone ac	2e-05
d2ae6a1		161	d.108.1.1 (A:1-161) Putative acetyltransferase EF0	2e-05
d2fe7a1		156	d.108.1.1 (A:3-158) Probable N-acetyltransferase P	6e-05
d1y7ra1		133	d.108.1.1 (A:1-133) Hypothetical protein SA2161 {S	1e-04
d2atra1		137	d.108.1.1 (A:1-137) Probable acetyltransferase SP0	2e-04
d1wwza1		157	d.108.1.1 (A:1-157) Hypothetical protein PH1933 {P	2e-04
d1m4ia_		181	d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransfera	2e-04
d1yvka1		152	d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu	3e-04
d1yk3a1		198	d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/	3e-04
d1i12a_		157	d.108.1.1 (A:) Glucosamine-phosphate N-acetyltrans	4e-04
d1ufha_		155	d.108.1.1 (A:) Putative acetyltransferase YycN {Ba	0.001
d2b5ga1		167	d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {H	0.003
d1z4ra1		162	d.108.1.1 (A:497-658) Catalytic domain of GCN5 his	0.004
d2hv2a2		285	d.108.1.10 (A:2-286) Hypothetical protein EF1021 {	0.004

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 308	Back information, alignment and structure


class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Mycothiol synthase MshD
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score = 59.0 bits (141), Expect = 7e-11
 Identities = 20/81 (24%), Positives = 33/81 (40%), Gaps = 7/81 (8%)

Query: 78  HIEVGYILSLGVSEDYRRNGIASLLLDNLISHL-------TTAENSSCKAIFLHVLTSNK 130
           H  +G +  LGV    +R G+  +L    I  L        T + +   A+ L+V + N 
Sbjct: 227 HPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLGGRKTLDPAVEPAVLLYVESDNV 286

Query: 131 PAIHFYEKRRFRLHSFLPYYY 151
            A+  Y+   F  +S    Y 
Sbjct: 287 AAVRTYQSLGFTTYSVDTAYA 307

PyMOL of d1p0ha_

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 297	Back information, alignment and structure

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Length = 147	Back information, alignment and structure

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Length = 166	Back information, alignment and structure

>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Length = 149	Back information, alignment and structure

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Length = 189	Back information, alignment and structure

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Length = 182	Back information, alignment and structure

>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Length = 137	Back information, alignment and structure

>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Length = 150	Back information, alignment and structure

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Length = 152	Back information, alignment and structure

>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Length = 174	Back information, alignment and structure

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Length = 173	Back information, alignment and structure

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Length = 180	Back information, alignment and structure

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 164	Back information, alignment and structure

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Length = 161	Back information, alignment and structure

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Length = 156	Back information, alignment and structure

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Length = 133	Back information, alignment and structure

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Length = 137	Back information, alignment and structure

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Length = 157	Back information, alignment and structure

>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181	Back information, alignment and structure

>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Length = 152	Back information, alignment and structure

>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198	Back information, alignment and structure

>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 157	Back information, alignment and structure

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Length = 155	Back information, alignment and structure

>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 167	Back information, alignment and structure

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Length = 285	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		247
d2ae6a1		161	Putative acetyltransferase EF0244 {Enterococcus fa	99.9
d1yr0a1		163	Phosphinothricin acetyltransferase {Agrobacterium	99.9
d1yvoa1		169	Hypothetical protein PA4866 {Pseudomonas aeruginos	99.9
d1vhsa_		165	Putative phosphinothricin acetyltransferase YwnH {	99.88
d1tiqa_		173	Protease synthase and sporulation negative regulat	99.87
d1s3za_		147	Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal	99.87
d1ghea_		170	Tabtoxin resistance protein {Pseudomonas syringae	99.87
d2ge3a1		164	Probable acetyltransferase Atu2290 {Agrobacterium	99.86
d1mk4a_		157	Hypothetical protein YqiY {Bacillus subtilis [TaxI	99.86
d1n71a_		180	Aminoglycoside 6'-N-acetyltransferase {Enterococcu	99.85
d2i6ca1		160	Putative acetyltransferase PA4794 {Pseudomonas aer	99.85
d2cy2a1		174	Probable acetyltransferase TTHA1209 {Thermus therm	99.83
d2fiwa1		156	Probable N-acetyltransferase RPA1999 {Rhodopseudom	99.83
d2fl4a1		146	Probable spermine/spermidine acetyltransferase EF1	99.83
d2fe7a1		156	Probable N-acetyltransferase PA0478 {Pseudomonas a	99.83
d2fiaa1		157	Probable acetyltransferase EF1919 {Enterococcus fa	99.81
d1z4ea1		150	Transcriptional regulator BH1968 {Bacillus halodur	99.81
d1s7ka1		174	L7/L12-Ribosomal-protein-serine acetyltransferase	99.8
d1yvka1		152	Hypothetical protein YvbK (BSu33890) {Bacillus sub	99.8
d1yrea1		183	Hypothetical protein PA3270 {Pseudomonas aeruginos	99.8
d1wwza1		157	Hypothetical protein PH1933 {Pyrococcus horikoshii	99.79
d1y9ka1		152	IAA acetyltransferase {Bacillus cereus [TaxId: 139	99.79
d1y9wa1		140	Probable acetyltransferase BC2806 {Bacillus cereus	99.79
d1nsla_		180	Probable acetyltransferase YdaF {Bacillus subtilis	99.79
d2fcka1		178	Putative ribosomal-protein-serine acetyltransferas	99.78
d1u6ma_		189	Putative acetyltransferase EF0945 {Enterococcus fa	99.77
d1cjwa_		166	Serotonin N-acetyltranferase {Sheep (Ovis aries) [	99.77
d1qsra_		162	Catalytic domain of GCN5 histone acetyltransferase	99.77
d2euia1		153	Probable acetyltransferase PA4026 {Pseudomonas aer	99.76
d1ygha_		164	Catalytic domain of GCN5 histone acetyltransferase	99.76
d1qsma_		150	Histone acetyltransferase HPA2 {Baker's yeast (Sac	99.76
d1z4ra1		162	Catalytic domain of GCN5 histone acetyltransferase	99.75
d1ufha_		155	Putative acetyltransferase YycN {Bacillus subtilis	99.74
d1i12a_		157	Glucosamine-phosphate N-acetyltransferase GNA1 {Ba	99.74
d1bo4a_		137	Aminoglycoside 3-N-acetyltransferase {Serratia mar	99.73
d1yx0a1		151	Hypothetical protein YsnE {Bacillus subtilis [TaxI	99.73
d2g3aa1		137	Probable acetyltransferase Atu2258 {Agrobacterium	99.73
d2atra1		137	Probable acetyltransferase SP0256 {Streptococcus p	99.73
d2b5ga1		167	Diamine acetyltransferase 1 {Human (Homo sapiens)	99.72
d1y7ra1		133	Hypothetical protein SA2161 {Staphylococcus aureus	99.72
d1vkca_		149	Putative acetyltransferase PF0028 {Pyrococcus furi	99.72
d2beia1		167	Diamine acetyltransferase 2 {Human (Homo sapiens)	99.71
d2gana1		182	Hypothetical protein PH0736 {Pyrococcus horikoshii	99.71
d2jdca1		145	Probable acetyltransferase YitI {Bacillus lichenif	99.68
d1q2ya_		140	Probable acetyltransferase YjcF {Bacillus subtilis	99.68
d1yk3a1		198	Hypothetical protein Rv1347c/MT1389 {Mycobacterium	99.6
d1xeba_		149	Hypothetical protein PA0115 {Pseudomonas aeruginos	99.57
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	99.57
d1sqha_		297	Hypothetical protein cg14615-pa {Fruit fly (Drosop	99.56
d2ozga2		283	Putative acetyltransferase Ava4977 {Anabaena varia	99.55
d2hv2a2		285	Hypothetical protein EF1021 {Enterococcus faecalis	99.53
d2aj6a1		118	Hypothetical protein MW0638 {Staphylococcus aureus	99.52
d1m4ia_		181	Aminoglycoside 2'-N-acetyltransferase {Mycobacteri	99.51
d2i00a2		291	Putative acetyltransferase EF2353 {Enterococcus fa	99.44
d2fsra1		164	Probable acetyltranferase Atu2435 {Agrobacterium t	99.42
d1r57a_		102	Hypothetical protein SA2309 {Staphylococcus aureus	98.97
d1p0ha_		308	Mycothiol synthase MshD {Mycobacterium tuberculosi	98.82
d1ro5a_		197	Autoinducer synthesis protein LasI {Pseudomonas ae	98.44
d1kzfa_		210	Acyl-homoserinelactone synthase EsaI {Pantoea stew	97.99
d1rxta1		141	N-myristoyl transferase, NMT {Human (Homo sapiens)	97.72
d1iyka1		165	N-myristoyl transferase, NMT {Yeast (Candida albic	97.66
d1lrza3		182	Methicillin resistance protein FemA {Staphylococcu	97.55
d1iica1		185	N-myristoyl transferase, NMT {Baker's yeast (Sacch	97.51
d1xmta_		95	Hypothetical protein AT1g77540 {Thale cress (Arabi	97.28
d2d4pa1		130	Hypothetical protein TTHA1254 {Thermus thermophilu	97.22
d1ylea1		338	Arginine N-succinyltransferase, alpha chain, AstA	96.73
d1ne9a2		171	Peptidyltransferase FemX {Weissella viridescens [T	95.75
d1boba_		315	Histone acetyltransferase HAT1 {Baker's yeast (Sac	95.72
d1ne9a1		164	Peptidyltransferase FemX {Weissella viridescens [T	94.47
d1lrza2		165	Methicillin resistance protein FemA {Staphylococcu	90.4
d2giva1		271	Probable histone acetyltransferase MYST1 {Human (H	88.06
d2ozua1		270	Histone acetyltransferase MYST3 {Human (Homo sapie	85.4
d1iyka2		227	N-myristoyl transferase, NMT {Yeast (Candida albic	84.72
d1fy7a_		273	Histone acetyltransferase ESA1 {Baker's yeast (Sac	82.6
d1iica2		237	N-myristoyl transferase, NMT {Baker's yeast (Sacch	81.28

>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Putative acetyltransferase EF0244
species: Enterococcus faecalis [TaxId: 1351]

Probab=99.90  E-value=2.2e-23  Score=162.34  Aligned_cols=147  Identities=20%  Similarity=0.291  Sum_probs=118.5

Q ss_pred             CCCCChhhHHHHHHhhcCCCCCCCch--------hHHHHhhcCCCeEEEEEEECCEEEEEEEEEeeeccccCccchhhhh
Q psy16746          1 MNSRSPDYQANVLTSTSLRHSGNYPL--------SWYKDITSEPSFYSLAALYNGVIIGLIVAEILQYTSLNKEDKDILA   72 (247)
Q Consensus         1 ~~~~~~~d~~~i~~l~~~~fp~~~~~--------~~~~~~~~~~~~~~~va~~~~~iVG~~~~~~~~~~~~~~~~~~~~~   72 (247)
                      ||.++++|++.+.++.+..+......        ..+....  ++..+++++.+|++||++.+.....            
T Consensus         7 iR~~~~~D~~~i~~l~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~va~~~~~~vG~~~~~~~~~------------   72 (161)
T d2ae6a1           7 IRLVAEADWPALHALDQIIWTKKNTPAEIQPLSLAAYQEKM--KDETIFVAISGQQLAGFIEVHPPTS------------   72 (161)
T ss_dssp             EEECCGGGHHHHHHHHTTC-------------CCSHHHHHT--TSSEEEEEEETTEEEEEEEEECSSS------------
T ss_pred             EEeCCHHHHHHHHHHHHHHhhhcCCcccCChhhHHHHHHhC--CCCcEEEEEECCEEEEEEeeccccc------------
Confidence            57789999999999988877533211        1122222  3456789999999999998875321            


Q ss_pred             cccCCCCcEEEEEEEEeCcccccCCHHHHHHHHHHHHHhhhccCCccEEEEEEEcCCHHHHHHHHhCCCEEeeeecceec
Q psy16746         73 SSFDKHIEVGYILSLGVSEDYRRNGIASLLLDNLISHLTTAENSSCKAIFLHVLTSNKPAIHFYEKRRFRLHSFLPYYYS  152 (247)
Q Consensus        73 ~~~~~~~~~~~I~~l~V~p~~rg~GiG~~Ll~~l~~~a~~~~~~g~~~i~l~v~~~N~~a~~fy~k~GF~~~g~~~~~~~  152 (247)
                         .......++..++|+|+|||+|+|++|++.++++++   ..|++++.+.+.++|.+|++||+|+||+.+|..++++.
T Consensus        73 ---~~~~~~~~~~~~~v~~~~rg~Gig~~ll~~l~~~~~---~~g~~~i~~~~~~~N~~a~~~y~~~GF~~~g~~~~~~~  146 (161)
T d2ae6a1          73 ---LAAHQKQWLLSIGVSPDFQDQGIGGSLLSYIKDMAE---ISGIHKLSLRVMATNQEAIRFYEKHGFVQEAHFKEEFY  146 (161)
T ss_dssp             ---CGGGTTEEEEEEEECGGGTTSSHHHHHHHHHHHHHH---HHTCCEEEEEEETTCHHHHHHHHHTTCEEEEEEEEEEE
T ss_pred             ---ccccceEEEEEEEEeeccccccccccchhheeeccc---cccchhheehhccccHHHHHHHHHCCCEEEEEEeeeEE
Confidence               112245778889999999999999999999999998   88999999999999999999999999999999999988


Q ss_pred             cCCcccceEEEEEEe
Q psy16746        153 IKGRSRDGFTYVLYI  167 (247)
Q Consensus       153 ~~g~~~d~~~m~~~l  167 (247)
                      ++|.+.|.+.|.+.|
T Consensus       147 ~~g~~~D~~~~~~~~  161 (161)
T d2ae6a1         147 INGHYCDDYQYAYFI  161 (161)
T ss_dssp             ETTEEEEEEEEEEEC
T ss_pred             ECCEEEEEEEEEEEC
Confidence            999999999999875

PyMOL of d2ae6a1

>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]}	Back information, alignment and structure

>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]}	Back information, alignment and structure

>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]}	Back information, alignment and structure

>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]}	Back information, alignment and structure

>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]}	Back information, alignment and structure

>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]}	Back information, alignment and structure

>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]}	Back information, alignment and structure

>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]}	Back information, alignment and structure

>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]}	Back information, alignment and structure

>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}	Back information, alignment and structure

>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2d4pa1 d.108.1.1 (A:1-130) Hypothetical protein TTHA1254 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}	Back information, alignment and structure

>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ne9a1 d.108.1.4 (A:1-164) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}	Back information, alignment and structure

>d1lrza2 d.108.1.4 (A:1-165) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyka2 d.108.1.2 (A:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}	Back information, alignment and structure

>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1iica2 d.108.1.2 (A:219-455) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure