Psyllid ID: psy16770


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550----
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLEEEEI
cHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccEEEEEcccccccccccccccccccccccccEEEEEEEEEEccccccccccEEEcccccEEEccccEEEEEcccccHHHHHHHHHHHccccEEEccccccHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHccccccccEEEccccccccccccccccccHHHHHHHHHccccccccccccHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHcccccccccccEEEEEEEEccccEEEEEcccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
cHHHHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHccccccccccccccccccccEEEcccEcccccccEEEEEEEccccccHHHcccHHHHHHHHHccccEEEEEEEccHHHHHHHHccccccccEEEEEEccccEEEccccccHHHHHHHHHHHcccccEEccccccHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHcccEEEEEEEccccccHHHHHHccccccccEEEEEcccccccccEEEcccccHHHHHHHHHHcccccccccccHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHccccccccccccEEEEEEccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MLWYTFLLNVLFINcavsldpyetlgvprtaSLQEIRKNYKRLVVEwhpdknndpTAQEKFLQLTEAYNILSDAErrkqydlfgttdgfsgqdsasrnfhnhmynpfddvfsegfnfpfeehdisLFHKLSTThwnfeknyipksyttphlILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLarrlgvgsqlpqialltdgrtsffkepsfsVQKMVEFFRLklpyklivplsatnvdAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYdqedsssvfqrfkvpgdkdsllifkedkdrpsasitmnsipvptlqditdnnpyltlprissqsmldavcpVKKLCVVLfsedspehdasRHTLRRFAQESRFVHNNIAFMYVFIEKQPEfvnaltspedsseISLHIAAMWRMDYKKIKYgwllgdavddwkdynttkdRLDAGLRSlvndpynnllyDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSlsrqhilpaVSLIFTVIIIVVLAMIMNHYMKLEEEEI
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQrfkvpgdkdsllifkedkdrpsasitmnsipvptlqdiTDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEdspehdasrHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLEEEEI
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLEEEEI
*LWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHP**********KFLQLTEAYNILSDAERRKQYDLFGTTDGF********NFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPG**DSLLIF*****************VPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFS************LRRFAQESRFVHNNIAFMYVFIEKQPEFVNALT******EISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMK******
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDL********************MYNPFDDVFSEG*********************NFEKNYIPKSYTTPHLILFYSDWCF**L***********ELSPLGVGFFTVHVHNEQ**AR***VGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHT****A******HNNIAFMYVFIEKQPEFV**************HIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLE****
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLEEEEI
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSG*DSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLWYTFLLNVLFINCAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMKLEEEEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query554 2.2.26 [Sep-21-2011]
Q5FVM7 771 DnaJ homolog subfamily C yes N/A 0.967 0.695 0.303 6e-66
Q9Y2G8 782 DnaJ homolog subfamily C yes N/A 0.949 0.672 0.302 2e-65
Q5RCM7 782 DnaJ homolog subfamily C yes N/A 0.949 0.672 0.299 3e-65
Q80TN4 772 DnaJ homolog subfamily C yes N/A 0.967 0.694 0.295 2e-64
Q5ZKZ4 777 DnaJ homolog subfamily C yes N/A 0.850 0.606 0.317 5e-61
Q8TQR1382 Chaperone protein DnaJ OS yes N/A 0.171 0.248 0.447 8e-19
Q9UXR9387 Chaperone protein DnaJ OS N/A N/A 0.171 0.245 0.437 5e-18
P0CW06389 Chaperone protein DnaJ OS yes N/A 0.171 0.244 0.437 7e-18
P0CW07389 Chaperone protein DnaJ OS yes N/A 0.171 0.244 0.437 7e-18
Q6TUG0358 DnaJ homolog subfamily B no N/A 0.176 0.273 0.455 3e-17
>sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 Back     alignment and function desciption
 Score =  252 bits (643), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 172/567 (30%), Positives = 288/567 (50%), Gaps = 31/567 (5%)

Query: 3   WYTFLLNVLFINC--AVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEK 60
           W   ++ VL +    A+  DPY  LGV RTAS  +I+K YK+L  EWHPDKN DP A++K
Sbjct: 10  WQFLIVLVLILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDK 69

Query: 61  FLQLTEAYNILSDAERRKQYDLF---GTTDGFSGQDSAS-RNFHNHMYNPFDDVFSEGFN 116
           F+Q+++AY ILS+ E+R  YD +   G   G+  Q     R+FH + Y  FD+ F   F+
Sbjct: 70  FIQISKAYEILSNEEKRTNYDHYGDAGENQGYQQQREYRFRHFHENFY--FDESF---FH 124

Query: 117 FPF-EEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDE 175
           FPF  E   S+  K      ++    +P S+  P+LI   SDWCF+C+ +EPI+K+++ E
Sbjct: 125 FPFNSERRDSIDEKYLLHFSHYVNEVVPDSFKKPYLIKITSDWCFSCIHIEPIWKEVVQE 184

Query: 176 LSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLK 235
           L  LGVG   VH   E+ LA  LG  S  P I  + +G+ SFF   +   + + +F    
Sbjct: 185 LEGLGVGIGVVHAGYERRLAHHLGAHST-PSILGIINGKISFFHN-AVVHENLRQFVESL 242

Query: 236 LPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVY 295
           LP  L+  ++  N   FL  W+++NK HALLF ++    L Y + AF ++  + FG +  
Sbjct: 243 LPGNLVEKVTNKNYVRFLSGWQQENKPHALLFGQTPAAPLLYKLTAFAYKDYVSFGYVYV 302

Query: 296 DQEDSSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRI 355
                  + +++ V     ++LIFKE  ++P+ +I    +    ++D    N YL   R+
Sbjct: 303 GLRGVEEMTRQYNVNIYAPTMLIFKEHINKPADAIQARGLKKQVIEDFITQNKYLLASRL 362

Query: 356 SSQSMLDAVCPVK------KLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVF 409
           +SQ +   +CPVK      K CVVL + ++ +          FA  +    + + F++V+
Sbjct: 363 TSQKLFHELCPVKRSHRQRKYCVVLLTAEANKLSKPFDAFLSFALAN--TQDTVRFVHVY 420

Query: 410 IEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLLGDAVDD-WKDYNTTKDRLD 468
             +Q EF + L    ++ +    ++ + R +      G ++   ++D W    + K  L 
Sbjct: 421 SSRQQEFASTLLPDIEAFQGKSGVSILERRNTA----GRVVFKTLEDPWTGSESDKFVLL 476

Query: 469 AGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSL---SRQHILP 525
             L  L  DP   L  +  L +++DE      +R    +  ++    +SL   + + ++P
Sbjct: 477 GYLDQLRKDP-AFLSSEAVLPDLTDELAPVFLLRWLYSVSDYLSDFWESLLHSNWREMMP 535

Query: 526 AVSLIFTVIIIVVLAMIMNHYMKLEEE 552
            +SLIF+ + I+   +I+  +    EE
Sbjct: 536 LLSLIFSALFILFGTVIVQAFSDSNEE 562





Rattus norvegicus (taxid: 10116)
>sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 Back     alignment and function description
>sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 Back     alignment and function description
>sp|Q5ZKZ4|DJC16_CHICK DnaJ homolog subfamily C member 16 OS=Gallus gallus GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query554
383849234 816 PREDICTED: dnaJ homolog subfamily C memb 0.960 0.651 0.423 1e-127
350414890 816 PREDICTED: dnaJ homolog subfamily C memb 0.960 0.651 0.424 1e-126
157129663 807 hypothetical protein AaeL_AAEL002502 [Ae 0.954 0.655 0.418 1e-125
307199297 812 DnaJ-like protein subfamily C member 16 0.956 0.652 0.410 1e-125
340722024 816 PREDICTED: dnaJ homolog subfamily C memb 0.960 0.651 0.421 1e-125
328777418 815 PREDICTED: dnaJ homolog subfamily C memb 0.960 0.652 0.413 1e-124
380012969 815 PREDICTED: dnaJ homolog subfamily C memb 0.960 0.652 0.413 1e-124
307173003 809 DnaJ-like protein subfamily C member 16 0.956 0.655 0.423 1e-124
170052877 831 conserved hypothetical protein [Culex qu 0.963 0.642 0.397 1e-121
312380617 795 hypothetical protein AND_07273 [Anophele 0.989 0.689 0.398 1e-120
>gi|383849234|ref|XP_003700250.1| PREDICTED: dnaJ homolog subfamily C member 16-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 231/546 (42%), Positives = 351/546 (64%), Gaps = 14/546 (2%)

Query: 20  DPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQ 79
           +PY+ LGV + A+LQEIRK YK LV EWHPDK + P A+ KF+++T+AY IL+D ERRK+
Sbjct: 58  NPYKILGVHKRATLQEIRKAYKNLVKEWHPDKTDHPGAENKFVEITKAYEILTDPERRKK 117

Query: 80  YDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEK 139
           +D  G T+    +     +  N++ +P +++F+  F F ++  DISLF+K+S T+ +FE 
Sbjct: 118 FDNHGITEESISRQRRDNSHFNNVLDPLEELFAGNFKFHYQNRDISLFYKMSITYRSFEN 177

Query: 140 NYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLG 199
             +PK+Y TP++ILFYSDWCFACLQVEP +++L+DEL PLG+G  T H   E  LARRLG
Sbjct: 178 VIVPKTYRTPYMILFYSDWCFACLQVEPTWRRLIDELEPLGLGLATAHAEKESALARRLG 237

Query: 200 VGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWRED 259
           + S LP + ++ DGR+S +KE  FS+QK+V+F R K PYKLI  ++  NVD FL  W  D
Sbjct: 238 IHS-LPCLVVIIDGRSSVYKESLFSIQKIVDFLRNKFPYKLIPSINTNNVDNFLSGWI-D 295

Query: 260 NKVHALLFQRSLPVRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIF 319
           N++ AL+F +   VRLRYL  AF +R  + FG +  D+ ++ ++  ++K+  D D+LL+F
Sbjct: 296 NRIRALIFDKKESVRLRYLFIAFYYRDRVAFGFVQMDKPETEAIAAKYKISMDLDTLLLF 355

Query: 320 KEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVC------PVKKLCVV 373
            E+ ++P AS++M  I   T+ ++  NN +L LPR+S+Q+MLD+VC      P K+LC V
Sbjct: 356 NENSEKPMASVSMKDISSDTMHNVISNNKFLALPRLSNQAMLDSVCPPEWLRPQKRLCAV 415

Query: 374 LFS-EDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSS-EISL 431
           L S ++SP HD +RH  R+ A ES +    + + YVF + QPEFV+AL++ E S  E  L
Sbjct: 416 LISQQNSPLHDLARHKFRQAALESSYSTERVRYTYVFKDTQPEFVSALSTGEGSPLEPLL 475

Query: 432 HIAAMWRMDYKKIKYGWLLGD---AVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTAL 488
           HI  +WR D   +KY WL  D   A  D   +N T+  L+  ++ L+      L Y   +
Sbjct: 476 HIVIIWRRDANHLKYEWLPTDWIEAAQDETQWNETRQNLEQTIQRLLRVS-EALPYAAVV 534

Query: 489 KEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVSLIFTVIIIVVLAMIMNHYMK 548
            E++DE+ Q    ++  +  + ++    SL+++ ILP VS+I T+++I      M++ +K
Sbjct: 535 GELADEHAQGTVDKLIGKALLAVDYISDSLTKEQILPLVSVIATLMLIGAAGYGMSYLVK 594

Query: 549 LEEEEI 554
           LEE  +
Sbjct: 595 LEEASV 600




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350414890|ref|XP_003490458.1| PREDICTED: dnaJ homolog subfamily C member 16-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|157129663|ref|XP_001655444.1| hypothetical protein AaeL_AAEL002502 [Aedes aegypti] gi|108882045|gb|EAT46270.1| AAEL002502-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307199297|gb|EFN79950.1| DnaJ-like protein subfamily C member 16 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340722024|ref|XP_003399412.1| PREDICTED: dnaJ homolog subfamily C member 16-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328777418|ref|XP_395584.4| PREDICTED: dnaJ homolog subfamily C member 16-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380012969|ref|XP_003690544.1| PREDICTED: dnaJ homolog subfamily C member 16-like [Apis florea] Back     alignment and taxonomy information
>gi|307173003|gb|EFN64145.1| DnaJ-like protein subfamily C member 16 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170052877|ref|XP_001862421.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167873643|gb|EDS37026.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312380617|gb|EFR26558.1| hypothetical protein AND_07273 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query554
FB|FBgn0058178 780 CG40178 [Drosophila melanogast 0.965 0.685 0.320 6.2e-85
UNIPROTKB|Q5TDG9595 DNAJC16 "DnaJ homolog subfamil 0.960 0.894 0.306 2.8e-66
UNIPROTKB|Q5TDH4655 DNAJC16 "DnaJ homolog subfamil 0.960 0.812 0.306 2.8e-66
UNIPROTKB|Q9Y2G8 782 DNAJC16 "DnaJ homolog subfamil 0.960 0.680 0.306 2.8e-66
UNIPROTKB|F1PZP2 782 DNAJC16 "Uncharacterized prote 0.960 0.680 0.306 7.4e-66
RGD|1359395 771 Dnajc16 "DnaJ (Hsp40) homolog, 0.967 0.695 0.303 7.4e-66
UNIPROTKB|A7MBJ0 782 DNAJC16 "DNAJC16 protein" [Bos 0.960 0.680 0.304 5.2e-65
UNIPROTKB|F1SUU5 782 DNAJC16 "Uncharacterized prote 0.960 0.680 0.301 8.5e-65
UNIPROTKB|Q5ZKZ4 777 DNAJC16 "DnaJ homolog subfamil 0.945 0.674 0.312 1.1e-64
MGI|MGI:2442146 772 Dnajc16 "DnaJ (Hsp40) homolog, 0.967 0.694 0.295 3.7e-64
FB|FBgn0058178 CG40178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 850 (304.3 bits), Expect = 6.2e-85, P = 6.2e-85
 Identities = 181/564 (32%), Positives = 319/564 (56%)

Query:     7 LLNVLFINCAVSL-DPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLT 65
             L    +I+   SL DPY  LG+ + A+  EIR+ YK L  +WHPDK  +    EKF+Q+ 
Sbjct:    16 LCTTSYIHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIK 75

Query:    66 EAYNILSDAERRKQYDLFGTTDGFSGQDSASRNFHNHMYNPF-----DDVFSEGFNFPFE 120
              AY IL+D +RR+ +D +G +D  + Q    ++ ++  YN F     DD F + F+    
Sbjct:    76 LAYEILADLDRRRIFDRYGVSD-INSQYFQKKHDYSE-YNRFTLNQNDDDFGQRFDI--- 130

Query:   121 EHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLG 180
             + DI+ + KLS T   FEK  + K+    H+++FY+DWCF C ++   FKK+++ L P+G
Sbjct:   131 KQDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILELLQPIG 190

Query:   181 VGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKL 240
             + F TV+  +E+ + R+ G   ++PQ+ L+ D +   +++ SF+ QK+VEF R K+P+ +
Sbjct:   191 INFATVNAVHEESVFRKCGA-REVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKKIPFNV 249

Query:   241 IVPLSATNVDAFLDNWREDNKVHALLFQ-RSLPVRLRYLINAFKHRTTIVFGVIVYDQED 299
                +   N + FL  W  DN+  AL+F+ RSL  RLRYL+ AF+    + FG +    +D
Sbjct:   250 FKRIEHDNFNDFLGGW-SDNRARALIFEPRSL-TRLRYLLTAFEFYDRVAFGFVNTISKD 307

Query:   300 SSSVFQRFKVPGDKDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQS 359
             SS++  RFKV    D+L++F ED    +AS+ M  IP   L ++   N +L  PRISSQ+
Sbjct:   308 SSNIITRFKVNTSLDTLILFNEDTTTFTASVCMEEIPNHILVNMVSTNQFLAFPRISSQN 367

Query:   360 MLDAVCPV------KKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQ 413
             ++++VCP       K LCV+L +E++ + D  R  LR  A    +    + F Y+F E Q
Sbjct:   368 IMESVCPTEWNRQRKHLCVILITENNRKKDFERVALRNIALSVGYNSEKVRFAYIFKESQ 427

Query:   414 PEFVNALTSPEDSSEISLHIAAMWRMDYKKIKYGWLL-----GDAVDDWKDYNTTKDRLD 468
             P+F+ +++       + + I  +WR D K+IKY W+      G++  +    N+TKD++ 
Sbjct:   428 PDFIKSISKGSFKDSL-IEIVIIWRRDKKRIKYNWVYVAKQNGNSSPEHL-MNSTKDQIS 485

Query:   469 AGLRSLVNDPYNNLLYDTALKEISDEYIQSLGVRIFNRIFMHIEMAQQSLSRQHILPAVS 528
               ++ L+ +    L Y+  ++ + +E+ Q +  +  ++    ++    ++  +H+L   S
Sbjct:   486 NAVKKLLKNS-EALCYEAIVENLFNEHSQGILTKWISQFLYVVDYLSDNIEDEHLLAVFS 544

Query:   529 LIFTVIIIVVLAMIMNHYMKLEEE 552
             L+ T+  +  +  ++ +++++EE+
Sbjct:   545 LLGTIAFMFTVGYVLIYFVRVEEK 568




GO:0045454 "cell redox homeostasis" evidence=IEA
UNIPROTKB|Q5TDG9 DNAJC16 "DnaJ homolog subfamily C member 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TDH4 DNAJC16 "DnaJ homolog subfamily C member 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2G8 DNAJC16 "DnaJ homolog subfamily C member 16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZP2 DNAJC16 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1359395 Dnajc16 "DnaJ (Hsp40) homolog, subfamily C, member 16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBJ0 DNAJC16 "DNAJC16 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUU5 DNAJC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKZ4 DNAJC16 "DnaJ homolog subfamily C member 16" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2442146 Dnajc16 "DnaJ (Hsp40) homolog, subfamily C, member 16" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZKZ4DJC16_CHICKNo assigned EC number0.31790.85010.6061yesN/A
Q5FVM7DJC16_RATNo assigned EC number0.30330.96750.6952yesN/A
Q9Y2G8DJC16_HUMANNo assigned EC number0.30280.94940.6726yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query554
cd02963111 cd02963, TRX_DnaJ, TRX domain, DnaJ domain contain 4e-36
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 8e-30
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-29
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 9e-26
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-25
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 2e-24
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 9e-24
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 3e-23
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-22
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 7e-22
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-21
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-21
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 2e-21
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 5e-21
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-21
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 5e-20
PRK14281397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 5e-20
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 6e-20
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 1e-19
PRK14295389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-19
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-19
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 5e-19
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-18
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 2e-18
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 1e-17
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-17
PRK14289386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 3e-17
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-17
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-17
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 7e-17
PRK14285365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 8e-16
PRK14279392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-15
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 1e-14
PTZ00037421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 2e-14
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 8e-14
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-13
PRK14288369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 2e-11
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 5e-11
COG3118304 COG3118, COG3118, Thioredoxin domain-containing pr 6e-07
PTZ003411136 PTZ00341, PTZ00341, Ring-infected erythrocyte surf 2e-06
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 1e-05
cd0294793 cd02947, TRX_family, TRX family; composed of two g 2e-05
cd0295696 cd02956, ybbN, ybbN protein family; ybbN is a hypo 5e-05
cd02994101 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co 1e-04
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 2e-04
COG1076174 COG1076, DjlA, DnaJ-domain-containing proteins 1 [ 3e-04
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 3e-04
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 8e-04
PTZ00443224 PTZ00443, PTZ00443, Thioredoxin domain-containing 0.002
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.002
COG5269379 COG5269, ZUO1, Ribosome-associated chaperone zuoti 0.003
>gnl|CDD|239261 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
 Score =  130 bits (328), Expect = 4e-36
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 124 ISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGF 183
            S  +K S T   +E   +PKS+  P+LI   SDWCF+C+ +EP++K+++ EL PLGVG 
Sbjct: 1   DSFDYKYSLTFSQYENEIVPKSFKKPYLIKITSDWCFSCIHIEPVWKEVIQELEPLGVGI 60

Query: 184 FTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLK 235
            TV+  +E+ LAR+LG    +P I  + +G+ +F+ + SF+ Q +V+F R  
Sbjct: 61  ATVNAGHERRLARKLGA-HSVPAIVGIINGQVTFYHDSSFTKQHVVDFVRKL 111


DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network. Length = 111

>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|225660 COG3118, COG3118, Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173534 PTZ00341, PTZ00341, Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|239254 cd02956, ybbN, ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|224002 COG1076, DjlA, DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information
>gnl|CDD|227594 COG5269, ZUO1, Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 554
KOG0190|consensus493 100.0
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 100.0
KOG4277|consensus468 99.98
PTZ00102477 disulphide isomerase; Provisional 99.97
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.94
KOG0912|consensus375 99.92
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.91
KOG0713|consensus336 99.91
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.83
KOG0712|consensus337 99.83
PRK14296372 chaperone protein DnaJ; Provisional 99.81
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.8
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.8
PRK14288369 chaperone protein DnaJ; Provisional 99.79
KOG0191|consensus383 99.79
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.79
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.78
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.78
PRK14298377 chaperone protein DnaJ; Provisional 99.78
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.77
PRK14287371 chaperone protein DnaJ; Provisional 99.77
KOG0910|consensus150 99.77
PRK14276380 chaperone protein DnaJ; Provisional 99.77
PRK14286372 chaperone protein DnaJ; Provisional 99.77
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.76
PRK14301373 chaperone protein DnaJ; Provisional 99.76
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.75
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.75
PRK14282369 chaperone protein DnaJ; Provisional 99.75
PRK14291382 chaperone protein DnaJ; Provisional 99.75
PRK14278378 chaperone protein DnaJ; Provisional 99.75
COG3118304 Thioredoxin domain-containing protein [Posttransla 99.75
PRK14294366 chaperone protein DnaJ; Provisional 99.75
PRK14280376 chaperone protein DnaJ; Provisional 99.75
PRK14277386 chaperone protein DnaJ; Provisional 99.74
PRK14285365 chaperone protein DnaJ; Provisional 99.74
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.74
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.74
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.73
PRK14297380 chaperone protein DnaJ; Provisional 99.73
PRK14299291 chaperone protein DnaJ; Provisional 99.73
PRK10767371 chaperone protein DnaJ; Provisional 99.72
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.72
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.71
PRK14279392 chaperone protein DnaJ; Provisional 99.71
PRK14283378 chaperone protein DnaJ; Provisional 99.7
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.7
PRK09381109 trxA thioredoxin; Provisional 99.7
PRK14300372 chaperone protein DnaJ; Provisional 99.7
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.69
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.69
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.68
PHA02278103 thioredoxin-like protein 99.67
KOG0624|consensus504 99.67
KOG0716|consensus279 99.67
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.66
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.66
KOG0721|consensus230 99.66
PRK14295389 chaperone protein DnaJ; Provisional 99.66
PRK14284391 chaperone protein DnaJ; Provisional 99.65
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.65
KOG0715|consensus288 99.65
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.65
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.65
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.64
PRK14281397 chaperone protein DnaJ; Provisional 99.64
PLN02309457 5'-adenylylsulfate reductase 99.64
KOG0691|consensus296 99.64
PRK10996139 thioredoxin 2; Provisional 99.64
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.64
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.64
KOG0717|consensus508 99.63
PRK14292371 chaperone protein DnaJ; Provisional 99.63
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.62
PRK14293374 chaperone protein DnaJ; Provisional 99.62
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.62
PRK14290365 chaperone protein DnaJ; Provisional 99.62
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.61
KOG0718|consensus546 99.61
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.61
PRK14289386 chaperone protein DnaJ; Provisional 99.61
KOG0719|consensus264 99.6
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.6
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.59
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.59
KOG1731|consensus 606 99.59
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.59
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.58
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.58
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.57
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.57
KOG0190|consensus493 99.55
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.54
KOG0191|consensus383 99.53
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.53
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.52
KOG0907|consensus106 99.52
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.52
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.51
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.51
PHA03102153 Small T antigen; Reviewed 99.5
PTZ0005198 thioredoxin; Provisional 99.48
KOG0722|consensus329 99.48
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.47
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.47
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.45
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.45
PTZ00102477 disulphide isomerase; Provisional 99.42
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.41
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 99.41
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.38
KOG0908|consensus288 99.37
PRK05014171 hscB co-chaperone HscB; Provisional 99.36
PRK01356166 hscB co-chaperone HscB; Provisional 99.35
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.35
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.35
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.34
KOG0720|consensus490 99.33
PTZ00062204 glutaredoxin; Provisional 99.32
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.32
PRK00294173 hscB co-chaperone HscB; Provisional 99.31
KOG0550|consensus486 99.29
PRK03578176 hscB co-chaperone HscB; Provisional 99.29
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.28
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.24
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.23
PTZ00100116 DnaJ chaperone protein; Provisional 99.23
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.18
KOG0714|consensus306 99.14
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.13
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.12
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.1
PHA0212575 thioredoxin-like protein 99.06
PHA02624 647 large T antigen; Provisional 99.05
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.02
KOG1150|consensus250 99.01
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.97
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.96
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.96
PRK01773173 hscB co-chaperone HscB; Provisional 98.95
PRK14018521 trifunctional thioredoxin/methionine sulfoxide red 98.9
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.9
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.87
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.87
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.85
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.83
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.82
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.81
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 98.81
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.8
KOG0914|consensus265 98.79
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.78
KOG0913|consensus248 98.77
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.75
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.75
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 98.73
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 98.72
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.7
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 98.7
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.7
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.61
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.58
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.55
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.51
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.5
PRK13728181 conjugal transfer protein TrbB; Provisional 98.48
cd02958114 UAS UAS family; UAS is a domain of unknown functio 98.45
PTZ00056199 glutathione peroxidase; Provisional 98.43
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.36
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 98.3
COG4232569 Thiol:disulfide interchange protein [Posttranslati 98.3
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.23
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.23
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.23
KOG0568|consensus342 98.22
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.2
PLN02412167 probable glutathione peroxidase 98.18
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 98.14
smart00594122 UAS UAS domain. 98.13
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.12
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.12
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 98.1
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.09
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 98.07
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.07
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.05
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.02
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.01
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.97
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 97.96
KOG0911|consensus227 97.94
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 97.93
KOG1789|consensus 2235 97.91
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.9
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 97.89
KOG1672|consensus211 97.88
PTZ00256183 glutathione peroxidase; Provisional 97.85
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 97.85
PF13728215 TraF: F plasmid transfer operon protein 97.84
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.83
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 97.83
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 97.82
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 97.79
KOG2501|consensus157 97.77
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.74
KOG0723|consensus112 97.74
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 97.73
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 97.71
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 97.7
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.67
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.66
PRK10606183 btuE putative glutathione peroxidase; Provisional 97.64
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 97.6
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 97.6
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.59
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 97.58
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.56
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.55
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 97.54
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.51
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.5
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.49
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 97.48
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 97.47
COG2143182 Thioredoxin-related protein [Posttranslational mod 97.45
PRK1120085 grxA glutaredoxin 1; Provisional 97.45
TIGR02739256 TraF type-F conjugative transfer system pilin asse 97.44
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 97.37
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 97.32
PRK13190202 putative peroxiredoxin; Provisional 97.28
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 97.28
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.23
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 97.21
PRK13703248 conjugal pilus assembly protein TraF; Provisional 97.18
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 97.17
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.17
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 97.16
PRK15000200 peroxidase; Provisional 97.14
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 97.12
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 97.12
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 97.11
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.11
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.1
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 97.1
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.1
PRK10877232 protein disulfide isomerase II DsbC; Provisional 97.09
KOG4277|consensus 468 97.07
KOG2603|consensus331 97.07
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.04
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 97.0
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.0
PRK10996139 thioredoxin 2; Provisional 97.0
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 96.98
KOG0912|consensus375 96.97
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 96.97
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 96.97
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 96.92
PTZ00137261 2-Cys peroxiredoxin; Provisional 96.91
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.91
PRK09381109 trxA thioredoxin; Provisional 96.91
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 96.91
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 96.9
KOG3425|consensus128 96.88
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 96.85
KOG0910|consensus150 96.83
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 96.82
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 96.81
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.76
PRK13599215 putative peroxiredoxin; Provisional 96.75
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 96.75
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 96.62
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 96.62
PRK13189222 peroxiredoxin; Provisional 96.57
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.54
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 96.53
KOG3192|consensus168 96.53
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 96.5
PTZ00253199 tryparedoxin peroxidase; Provisional 96.48
PRK13191215 putative peroxiredoxin; Provisional 96.4
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 96.38
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 96.38
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.38
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 96.37
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 96.35
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 96.33
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 96.32
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 96.24
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 96.14
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 96.09
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 96.08
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 96.05
KOG3414|consensus142 96.05
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 96.04
PLN02309457 5'-adenylylsulfate reductase 95.97
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 95.95
PTZ00443224 Thioredoxin domain-containing protein; Provisional 95.88
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 95.76
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 95.76
cd0294793 TRX_family TRX family; composed of two groups: Gro 95.76
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 95.75
cd02962152 TMX2 TMX2 family; composed of proteins similar to 95.73
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.65
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 95.55
cd03071116 PDI_b'_NRX PDIb' family, NRX subgroup, redox inact 95.55
PHA02278103 thioredoxin-like protein 95.54
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 95.53
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 95.51
PRK1032981 glutaredoxin-like protein; Provisional 95.44
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 95.43
PTZ0005198 thioredoxin; Provisional 95.42
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 95.4
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 95.37
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 95.35
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 95.34
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 95.32
KOG0431|consensus453 95.18
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 95.15
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 94.92
PHA03050108 glutaredoxin; Provisional 94.82
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 94.79
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 94.74
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 94.72
KOG0907|consensus106 94.68
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 94.63
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 94.61
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 94.4
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.39
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 94.07
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 93.75
PTZ00062204 glutaredoxin; Provisional 93.71
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 93.55
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 93.47
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.34
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 93.2
PRK1063883 glutaredoxin 3; Provisional 93.05
PRK10824115 glutaredoxin-4; Provisional 92.72
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 92.7
KOG1731|consensus 606 92.64
KOG3170|consensus240 91.93
KOG2640|consensus319 91.7
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 91.57
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 91.18
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 91.14
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 90.34
PRK00293571 dipZ thiol:disulfide interchange protein precursor 89.86
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 89.64
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 88.91
KOG3171|consensus273 88.49
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 88.12
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 87.79
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 87.65
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphat 86.97
KOG1752|consensus104 86.16
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 86.02
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 85.72
COG3019149 Predicted metal-binding protein [General function 85.39
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 85.09
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 84.83
cd02958114 UAS UAS family; UAS is a domain of unknown functio 83.86
KOG2603|consensus331 82.85
PF11833194 DUF3353: Protein of unknown function (DUF3353); In 82.64
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 80.57
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 80.18
>KOG0190|consensus Back     alignment and domain information
Probab=100.00  E-value=9.6e-42  Score=352.80  Aligned_cols=349  Identities=16%  Similarity=0.236  Sum_probs=282.4

Q ss_pred             ccccccccccccccccccCCCCCCcEEEEEEcccccccccchHHHHHHHHHhCCC--CEEEEEEEecCcHHHHHHhCCcC
Q psy16770        125 SLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPL--GVGFFTVHVHNEQGLARRLGVGS  202 (554)
Q Consensus       125 ~~~~~~~Lt~~~F~~~v~~~~~~~~~lV~Fya~wC~~C~~l~p~~~~~a~~l~~~--~v~~~~Vd~~~~~~l~~~~~v~~  202 (554)
                      ....+++||.+||+..|   ..+..++|+||||||+||++++|+|+++|+.|+..  .+.+++|||+.+..+|++|+|+|
T Consensus        23 ~~~~Vl~Lt~dnf~~~i---~~~~~vlVeFYAPWCghck~LaPey~kAA~~Lke~~s~i~LakVDat~~~~~~~~y~v~g   99 (493)
T KOG0190|consen   23 AEEDVLVLTKDNFKETI---NGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDATEESDLASKYEVRG   99 (493)
T ss_pred             cccceEEEecccHHHHh---ccCceEEEEEEchhhhhhhhhCcHHHHHHHHhhccCCCceeEEeecchhhhhHhhhcCCC
Confidence            34579999999999999   57889999999999999999999999999999854  69999999999999999999998


Q ss_pred             CCCcceeccCCeE-EEEeCCcccHHHHHHHHHHhCCCCccccCCcccHHHHHhhhhcCCceEEEEEecCCchhHHHHHHh
Q psy16770        203 QLPQIALLTDGRT-SFFKEPSFSVQKMVEFFRLKLPYKLIVPLSATNVDAFLDNWREDNKVHALLFQRSLPVRLRYLINA  281 (554)
Q Consensus       203 ~~Pti~~~~~g~~-~~y~~g~~~~~~i~~fl~~~~~~~~v~~~t~~~~~~fl~~~~~~~~~~v~~f~~~~~~~~~~~~~a  281 (554)
                       |||+++|+||.. ..|.|+ |++++|+.||+++.+|+...+-+.++++.|+..   ....++++|.+.....-.++..+
T Consensus       100 -yPTlkiFrnG~~~~~Y~G~-r~adgIv~wl~kq~gPa~~~l~~~~~a~~~l~~---~~~~vig~F~d~~~~~~~~~~~a  174 (493)
T KOG0190|consen  100 -YPTLKIFRNGRSAQDYNGP-READGIVKWLKKQSGPASKTLKTVDEAEEFLSK---KDVVVIGFFKDLESLAESFFDAA  174 (493)
T ss_pred             -CCeEEEEecCCcceeccCc-ccHHHHHHHHHhccCCCceecccHHHHHhhccC---CceEEEEEecccccchHHHHHHH
Confidence             999999999995 777766 589999999999999996656577889999963   45566667766665555566666


Q ss_pred             hccCCceEEEEEEccCCCChhHHhHhCCCCC-CceEEEEeCCCCCCCceeecCCCChhHHHhHHhcCCCcccccccchhh
Q psy16770        282 FKHRTTIVFGVIVYDQEDSSSVFQRFKVPGD-KDSLLIFKEDKDRPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSM  360 (554)
Q Consensus       282 ~~~~~~v~Fg~v~~~~~~~~~l~~k~~i~~~-~Ptlvvfk~~~~~~~~~i~~~~~~~~~l~~fi~~~~~~~v~~lt~~~~  360 (554)
                      ..+++++.|+++     ++.+++++++++.+ .+.++++++..+....  +.+++..+.|.+||..+++|++.++|.++.
T Consensus       175 ~~l~~d~~F~~t-----s~~~~~~~~~~~~~~~~~i~l~kk~d~~~~~--~~~~~~~~~l~~Fi~~~~~plv~~ft~~~~  247 (493)
T KOG0190|consen  175 SKLRDDYKFAHT-----SDSDVAKKLELNTEGTFPIVLFKKFDELLVK--YDGSFTPELLKKFIQENSLPLVTEFTVANN  247 (493)
T ss_pred             Hhccccceeecc-----CcHhHHhhccCCCCCcceEEeccccccchhh--cccccCHHHHHHHHHHhcccccceeccccc
Confidence            688999999977     78999999998721 3448888876665433  478899999999999999999999997543


Q ss_pred             ---hhhcCCCCceEEEEEcC-CCCcchhHHHHHHHHHhhccCCCCceEEEEEecccchHHHHhhCCCCCCccccceEEEE
Q psy16770        361 ---LDAVCPVKKLCVVLFSE-DSPEHDASRHTLRRFAQESRFVHNNIAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAM  436 (554)
Q Consensus       361 ---~~~~c~~~~lcvvl~~~-~~~~~~~~~~~l~~~a~~~~~~~~~v~F~~vd~~~q~~~~~~~~~~~~~~~~~~~~~~v  436 (554)
                         +....   .+-++++.. ...+.+.+++.++++|++  |++ .++|+++|.+..+..++.|    |..+.... +.+
T Consensus       248 ~~~~~~~~---~~~~~~~~~~~~~~~e~~~~~~~~vAk~--f~~-~l~Fi~~d~e~~~~~~~~~----Gl~~~~~~-~~~  316 (493)
T KOG0190|consen  248 AKIYSSFV---KLGLDFFVFFKCNRFEELRKKFEEVAKK--FKG-KLRFILIDPESFARVLEFF----GLEEEQLP-IRA  316 (493)
T ss_pred             ceeecccc---ccceeEEeccccccHHHHHHHHHHHHHh--ccc-ceEEEEEChHHhhHHHHhc----CcccccCC-eeE
Confidence               33322   344555542 223778999999999999  986 6999999998877777777    21111122 445


Q ss_pred             EEecCCCeeEEEecCCCCCcccccchhhHHHHHHHHhhhcCCCCCccccccccchhh-hhhhHHHHHHHHHHH
Q psy16770        437 WRMDYKKIKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPYNNLLYDTALKEISD-EYIQSLGVRIFNRIF  508 (554)
Q Consensus       437 ~~~~~~~~ky~~~~~~~~~~~~~~~~t~e~l~~fl~~~~~g~~~~~~~~~~lp~~~d-e~~~~~~~r~~~~~~  508 (554)
                      +..+.++.||.+-.+         +.+.++|.+|+.+++.|+.+|..+++++|+-+| .++..+|+++|+.++
T Consensus       317 v~~~~~~~Ky~~~~e---------~~~~~~ie~f~~~~l~Gk~~p~~kSqpiPe~~~~~pVkvvVgknfd~iv  380 (493)
T KOG0190|consen  317 VILNEDGSKYPLEEE---------ELDQENIESFVKDFLDGKVKPHLKSQPIPEDNDRSPVKVVVGKNFDDIV  380 (493)
T ss_pred             EeeccccccccCccc---------cccHHHHHHHHHHHhcCccccccccCCCCcccccCCeEEEeecCHHHHh
Confidence            556677788854333         467789999999999999999999999999999 889999999999844



>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>KOG4277|consensus Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>KOG0912|consensus Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>KOG1731|consensus Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG0190|consensus Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>KOG0191|consensus Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0908|consensus Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>KOG0914|consensus Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>KOG0913|consensus Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>KOG1672|consensus Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>KOG4277|consensus Back     alignment and domain information
>KOG2603|consensus Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>KOG0912|consensus Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG3425|consensus Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>KOG3414|consensus Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>KOG1731|consensus Back     alignment and domain information
>KOG3170|consensus Back     alignment and domain information
>KOG2640|consensus Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>KOG3171|consensus Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2603|consensus Back     alignment and domain information
>PF11833 DUF3353: Protein of unknown function (DUF3353); InterPro: IPR021788 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query554
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-19
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 4e-16
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 3e-15
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 1e-14
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 1e-14
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 3e-14
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 9e-14
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 1e-13
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 1e-13
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 2e-13
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-13
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 7e-12
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-11
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 6e-11
3lz8_A329 Structure Of A Putative Chaperone Dnaj From Klebsie 3e-10
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 4e-10
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 3e-09
2kqx_A73 Nmr Structure Of The J-Domain (Residues 2-72) In Th 4e-09
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 1e-08
2yua_A99 Solution Structure Of The Dnaj Domain From Human Wi 2e-07
2y4u_A450 Crystal Structure Of Human P58(Ipk) In Space Group 3e-06
2y4t_A450 Crystal Structure Of The Human Co-Chaperone P58(Ipk 3e-06
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 3e-06
2l6l_A155 Solution Structure Of Human J-Protein Co-Chaperone, 6e-06
2l5l_A136 Solution Structure Of Thioredoxin From Bacteroides 4e-05
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 5e-04
2j23_A121 Cross-Reactivity And Crystal Structure Of Malassezi 7e-04
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure

Iteration: 1

Score = 93.2 bits (230), Expect = 3e-19, Method: Composition-based stats. Identities = 38/70 (54%), Positives = 53/70 (75%) Query: 16 AVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAE 75 A+ DPY LGV RTAS +I+K YK+L EWHPDKN DP A+++F+Q+++AY ILS+ E Sbjct: 14 ALDFDPYRVLGVSRTASQADIKKAYKKLAREWHPDKNKDPGAEDRFIQISKAYEILSNEE 73 Query: 76 RRKQYDLFGT 85 +R YD +G+ Sbjct: 74 KRTNYDHYGS 83
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|3LZ8|A Chain A, Structure Of A Putative Chaperone Dnaj From Klebsiella Pneumoniae Subsp. Pneumoniae Mgh 78578 At 2.9 A Resolution. Length = 329 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2KQX|A Chain A, Nmr Structure Of The J-Domain (Residues 2-72) In The Escherichia Coli Cbpa Length = 73 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2YUA|A Chain A, Solution Structure Of The Dnaj Domain From Human Williams- Beuren Syndrome Chromosome Region 18 Protein Length = 99 Back     alignment and structure
>pdb|2Y4U|A Chain A, Crystal Structure Of Human P58(Ipk) In Space Group P312 Length = 450 Back     alignment and structure
>pdb|2Y4T|A Chain A, Crystal Structure Of The Human Co-Chaperone P58(Ipk) Length = 450 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure
>pdb|2L6L|A Chain A, Solution Structure Of Human J-Protein Co-Chaperone, Dph4 Length = 155 Back     alignment and structure
>pdb|2L5L|A Chain A, Solution Structure Of Thioredoxin From Bacteroides Vulgatus Length = 136 Back     alignment and structure
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2J23|A Chain A, Cross-Reactivity And Crystal Structure Of Malassezia Sympodialis Thioredoxin (Mala S 13), A Member Of A New Pan- Allergen Family Length = 121 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query554
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 2e-58
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-43
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 4e-17
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 3e-04
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 2e-31
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 9e-29
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 3e-28
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-27
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-27
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-27
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 4e-27
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 6e-27
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 8e-27
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 1e-26
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-26
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-26
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-26
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 4e-26
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 2e-24
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 4e-24
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 4e-24
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 3e-23
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 3e-23
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 4e-23
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-23
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 3e-20
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 9e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-14
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 2e-12
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 3e-12
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2guz_A71 Mitochondrial import inner membrane translocase su 2e-10
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 3e-10
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 3e-10
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 3e-09
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 4e-09
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 5e-09
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 4e-08
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 7e-08
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 8e-08
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 7e-07
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 1e-06
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 2e-06
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 3e-06
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 7e-06
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 8e-06
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 1e-05
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 2e-05
4euy_A105 Uncharacterized protein; structural genomics, PSI- 4e-05
2l57_A126 Uncharacterized protein; structural genomics, unkn 5e-05
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 8e-05
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 1e-04
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 1e-04
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 4e-04
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 5e-04
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 5e-04
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 6e-04
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 6e-04
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 6e-04
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 8e-04
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
 Score =  192 bits (490), Expect = 2e-58
 Identities = 54/223 (24%), Positives = 93/223 (41%), Gaps = 20/223 (8%)

Query: 20  DPYETLGVPRTASLQEIRKNYKRLVVEWHPDKN-NDPTAQEKFLQLTEAYNILSDAERRK 78
           + Y  LGV +TAS +EIR+ +K+L ++ HPDKN N+P A   FL++  AY +L D + RK
Sbjct: 3   NFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRK 62

Query: 79  QYDLFGTTDGFSGQDSASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFE 138
           +YD +G   G               Y  +   +   F    ++ +I    +         
Sbjct: 63  KYDKYG-EKGLEDN-------QGGQYESWSY-YRYDFGIYDDDPEIITLERREFDAAVNS 113

Query: 139 KNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRL 198
                        + FYS  C  C  + P +++   E+  L +    V+  +++ L R  
Sbjct: 114 G--------ELWFVNFYSPGCSHCHDLAPTWREFAKEVDGL-LRIGAVNCGDDRMLCRMK 164

Query: 199 GVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLI 241
           GV S  P + +   G  +       S + +V F    +   + 
Sbjct: 165 GVNS-YPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRSTVT 206


>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Length = 105 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Length = 116 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Length = 107 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Length = 139 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query554
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 100.0
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 100.0
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 100.0
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 100.0
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 100.0
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 100.0
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 100.0
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.95
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 99.94
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.92
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.9
3t58_A519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 99.86
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 99.83
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 99.83
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.82
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.8
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.8
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.8
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.79
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.78
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.78
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.78
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.78
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.77
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.77
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.76
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.76
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.75
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.75
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.75
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.75
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.74
2qsi_A137 Putative hydrogenase expression/formation protein; 99.74
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.74
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.73
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.73
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.73
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.73
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.73
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.72
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.72
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.71
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.71
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.71
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.7
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.7
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.7
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.7
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.7
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.7
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.7
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.7
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.7
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.7
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.69
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.69
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.69
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.69
1mek_A120 Protein disulfide isomerase; electron transport, r 99.69
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.69
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.68
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.68
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.68
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.68
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.68
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.68
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.68
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 99.68
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.68
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.68
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.68
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.68
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.67
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.67
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.67
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.66
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.66
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.66
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.65
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.65
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.65
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.65
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.65
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.65
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.65
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.65
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.65
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.65
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.64
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.64
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.64
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.64
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.64
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.63
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.63
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.63
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.63
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.62
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.62
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.62
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.62
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.62
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.62
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.62
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.61
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.61
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.61
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 99.61
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.6
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.6
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.59
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.59
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.59
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 99.37
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.58
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.57
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.57
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.57
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.57
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.57
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.56
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.56
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.55
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.55
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.55
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 99.55
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.53
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.52
2guz_A71 Mitochondrial import inner membrane translocase su 99.51
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 99.51
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.5
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.5
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.5
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.48
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.47
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.46
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.45
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.44
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.44
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.41
3qcp_A470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 99.41
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.39
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.38
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.37
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.37
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.35
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.03
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 99.34
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.33
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.3
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.3
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.29
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.29
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.26
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.25
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.25
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.25
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.24
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.23
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.23
3raz_A151 Thioredoxin-related protein; structural genomics, 99.23
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.21
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.2
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.2
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.19
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.16
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.16
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.15
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.15
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.15
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.14
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.14
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.13
4evm_A138 Thioredoxin family protein; structural genomics, n 99.12
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.11
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.1
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.08
1ttz_A87 Conserved hypothetical protein; structural genomic 99.08
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.06
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.06
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.05
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.05
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.04
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.04
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.04
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.03
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 99.03
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 99.03
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 99.01
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.0
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 98.98
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.97
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 98.97
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 98.96
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.96
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 98.96
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 98.95
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.93
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 98.92
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.91
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.91
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.91
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.85
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 98.85
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.3
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 98.81
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.8
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.79
2ls5_A159 Uncharacterized protein; structural genomics, unkn 98.26
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.77
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.74
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 98.74
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.74
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 98.73
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.72
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.7
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 98.7
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.69
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.69
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 98.69
2guz_B65 Mitochondrial import inner membrane translocase su 98.69
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.68
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 98.68
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.66
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.64
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 98.64
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 98.63
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.63
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.63
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 98.61
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.56
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.52
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 98.5
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.5
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.48
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.47
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.44
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 98.43
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 98.42
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 98.39
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.39
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.33
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 98.32
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.32
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.32
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.31
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.29
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.28
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.26
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.23
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.22
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.17
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.17
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.16
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 98.11
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 98.08
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 98.07
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.06
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 98.02
1kte_A105 Thioltransferase; redox-active center, electron tr 98.0
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 97.99
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 97.96
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 97.93
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 97.91
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 97.9
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.89
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 97.89
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 97.89
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 97.87
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.87
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 97.86
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.86
3me7_A170 Putative uncharacterized protein; electron transfe 97.82
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 97.79
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.78
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 97.76
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.75
1psq_A163 Probable thiol peroxidase; structural genomics, NY 97.73
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.69
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 97.69
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 97.67
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 97.67
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 97.67
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.66
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 97.65
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 97.64
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 97.61
2qsi_A137 Putative hydrogenase expression/formation protein; 97.61
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.6
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 97.6
1z6m_A175 Conserved hypothetical protein; structural genomic 97.6
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 97.56
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.55
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 97.51
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 97.51
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 97.5
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 97.5
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 97.49
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 97.41
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.41
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.39
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.37
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 97.36
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.36
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 97.34
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 97.33
2yzu_A109 Thioredoxin; redox protein, electron transport, st 97.31
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 97.3
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.29
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.28
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.28
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.26
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 97.26
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.24
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.24
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.23
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 97.23
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 97.23
1mek_A120 Protein disulfide isomerase; electron transport, r 97.2
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.19
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 97.19
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 97.19
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 97.18
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 97.18
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 97.16
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.16
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.15
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.12
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 97.09
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.09
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 97.09
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.08
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.07
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 97.06
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.04
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 97.04
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 97.03
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 97.01
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.01
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.01
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.01
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 96.97
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 96.95
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 96.94
2l5l_A136 Thioredoxin; structural genomics, electron transpo 96.93
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 96.91
4euy_A105 Uncharacterized protein; structural genomics, PSI- 96.9
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 96.87
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 96.86
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 96.86
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 96.86
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.85
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 96.84
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 96.82
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.82
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 96.79
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 96.78
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 96.73
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.72
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 96.72
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 96.7
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 96.7
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.7
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 96.65
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.59
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.57
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 96.56
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 96.55
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 96.48
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.48
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.47
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.43
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.41
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.4
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 96.32
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 96.31
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.31
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 96.23
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 96.2
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.19
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 96.17
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 96.16
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 96.09
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 96.05
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 95.97
3keb_A224 Probable thiol peroxidase; structural genomics, AP 95.95
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 95.95
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 95.9
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 95.76
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 95.64
2kuc_A130 Putative disulphide-isomerase; structural genomics 95.51
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 95.49
2l57_A126 Uncharacterized protein; structural genomics, unkn 95.45
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 95.23
1wmj_A130 Thioredoxin H-type; structural genomics, program f 95.22
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 95.19
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 95.18
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 95.13
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 95.08
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 94.04
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 94.96
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 94.92
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 94.76
1zma_A118 Bacterocin transport accessory protein; alpha-beta 94.65
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 94.58
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 94.49
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 94.43
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 94.4
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 94.26
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 94.21
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 94.18
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 93.74
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 93.68
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 93.38
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 93.11
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 92.7
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 92.48
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 92.32
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 92.31
3f9u_A172 Putative exported cytochrome C biogenesis-related; 91.87
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 91.6
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 91.55
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 90.43
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 90.4
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 89.96
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 89.95
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 89.94
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 89.53
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 88.58
2lrn_A152 Thiol:disulfide interchange protein; structural ge 88.53
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 88.45
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 87.83
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 87.53
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 87.52
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 87.13
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 86.4
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 85.49
3raz_A151 Thioredoxin-related protein; structural genomics, 85.47
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 85.28
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 85.05
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 85.05
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 84.89
2l5o_A153 Putative thioredoxin; structural genomics, unknown 84.68
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 83.98
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 83.43
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 81.94
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfa 81.49
4evm_A138 Thioredoxin family protein; structural genomics, n 81.06
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 80.98
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 80.68
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 80.16
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 80.09
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 80.04
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=1.3e-47  Score=437.39  Aligned_cols=413  Identities=19%  Similarity=0.251  Sum_probs=265.4

Q ss_pred             cCCCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCC-ChhHHHHHHHHHHHHHHcCChHHHHhhhccCCCCCCCCCC
Q psy16770         15 CAVSLDPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNN-DPTAQEKFLQLTEAYNILSDAERRKQYDLFGTTDGFSGQD   93 (554)
Q Consensus        15 ~~~~~d~y~~Lgv~~~a~~~~ik~ay~~l~~~~hPd~~~-~~~~~~~~~~i~~Ay~~L~~~~~r~~yd~~~~~~~~~~~~   93 (554)
                      .....|||++|||+++|+.++||+|||+|+++||||+++ ++.+.++|++|++||++|+||.+|+.||++|..+..... 
T Consensus        17 ~~~~~~~y~~lg~~~~a~~~~i~~ay~~l~~~~hpd~~~~~~~~~~~f~~i~~ay~~L~~~~~r~~yd~~~~~~~~~~~-   95 (780)
T 3apo_A           17 GRHDQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQ-   95 (780)
T ss_dssp             ------CHHHHTCCTTCCHHHHHHHHCC-----------------------CTHHHHHHSHHHHHHHTTC----------
T ss_pred             CCCCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCChHHHHHHHHHHHHHHHHcChHHHHHHHhhcccccccCC-
Confidence            345689999999999999999999999999999999995 577899999999999999999999999999987632221 


Q ss_pred             CccccccCCCCCCCCccccCCCCCCccccccccccccccccccccccccCCCCCCcEEEEEEcccccccccchHHHHHHH
Q psy16770         94 SASRNFHNHMYNPFDDVFSEGFNFPFEEHDISLFHKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLM  173 (554)
Q Consensus        94 ~~~~~~~~~~~~~f~~~f~~~~~f~f~~~~~~~~~~~~Lt~~~F~~~v~~~~~~~~~lV~Fya~wC~~C~~l~p~~~~~a  173 (554)
                        +.++  ..|+.|...|+.        ++ ....+++||.++|++.|   .++++++|+||||||++|+++.|.|++++
T Consensus        96 --~~~~--~~~~~~~~~fg~--------~~-~~~~v~~l~~~~f~~~i---~~~~~~lv~Fya~wC~~C~~~~p~~~~~a  159 (780)
T 3apo_A           96 --GGQY--ESWSYYRYDFGI--------YD-DDPEIITLERREFDAAV---NSGELWFVNFYSPGSSHSHDLAPTWREFA  159 (780)
T ss_dssp             ------------CCSSSSST--------TT-TCTTEEECCHHHHHHHH---TSSSCEEEEEECSSCHHHHHHHHHHHHHH
T ss_pred             --CCCc--ccccccchhhcc--------cC-CCcceeeechHhHHhhh---cCCCcEEEEEeCCCCcchhHhhHHHHHHH
Confidence              1111  122222222221        11 12358899999999999   56889999999999999999999999999


Q ss_pred             HHhCCCCEEEEEEEecCcHHHHHHhCCcCCCCcceeccCCeEEEEeCCcccHHHHHHHHHHhCCCCccccCCcc----cH
Q psy16770        174 DELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQIALLTDGRTSFFKEPSFSVQKMVEFFRLKLPYKLIVPLSAT----NV  249 (554)
Q Consensus       174 ~~l~~~~v~~~~Vd~~~~~~l~~~~~v~~~~Pti~~~~~g~~~~y~~g~~~~~~i~~fl~~~~~~~~v~~~t~~----~~  249 (554)
                      +.+++. +.+++|||++++.+|++++|++ +||+++|++|+....+.|.++.+.|++|+.+++++. +..++..    ++
T Consensus       160 ~~~~~~-v~~~~vd~~~~~~l~~~~~v~~-~Pt~~~~~~g~~~~~~~G~~~~~~l~~~l~~~~~~~-~~~i~~~~~~~~l  236 (780)
T 3apo_A          160 KEVDGL-LRIGAVNCGDDRMLCRMKGVNS-YPSLFIFRSGMAAVKYNGDRSKESLVAFAMQHVRST-VTELSTGNFVNAI  236 (780)
T ss_dssp             HHTTTT-SEEEEEETTTCSSCC---------CEEEEECTTSCCEECCSCSCHHHHHHHHHTTSCCC-EEECCHHHHHHHH
T ss_pred             HHhcCc-eEEEEEeCCCcHHHHHHcCCce-eeeEEEEeCCcEeeEecCCCCHHHHHHHHHHhchhh-heeccchhhHHHH
Confidence            999874 9999999999999999999998 999999999986544556679999999999999988 4555554    45


Q ss_pred             HHHHhhhhcCCceEEEEEecCCc---hhHHHHHHhhccCCceEEEEEEccCCCChhHHhHhCCCCCCceEEEEeCCCC--
Q psy16770        250 DAFLDNWREDNKVHALLFQRSLP---VRLRYLINAFKHRTTIVFGVIVYDQEDSSSVFQRFKVPGDKDSLLIFKEDKD--  324 (554)
Q Consensus       250 ~~fl~~~~~~~~~~v~~f~~~~~---~~~~~~~~a~~~~~~v~Fg~v~~~~~~~~~l~~k~~i~~~~Ptlvvfk~~~~--  324 (554)
                      ++++    +.+.+.|++|.+...   ........+..+++.+.||+++|+  .+..+++++++++ .| +++|++...  
T Consensus       237 ~~~~----~~~~~~vi~f~~~~~~~~~~~~~~~l~~~f~~~~~f~~v~c~--~~~~l~~~~gi~~-~p-~~~f~~~~~~~  308 (780)
T 3apo_A          237 ETAF----AAGVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCD--AQDSLCKSLDTTA-ST-TAYFPPGATLN  308 (780)
T ss_dssp             HHHH----HHTCEEEEEEECTTSCCCCHHHHHHHHHHTTTTEEEEEEETT--TSHHHHTCC------C-EEEECTTCCSS
T ss_pred             Hhhh----ccCCCEEEEEecCcccccCHHHHHHHHHHhhccceEEEEEcC--CCHHHHHHhCCCC-Cc-eeeeccccccC
Confidence            5555    347778888876543   222333344467899999999998  5679999999996 56 777766321  


Q ss_pred             --CCCceeecCCCChhHHHhHHhcCCCcccccccchhhhhhcCCCCceEEEEEcCCCCcchhHHHHHHHHHhhccCCCCc
Q psy16770        325 --RPSASITMNSIPVPTLQDITDNNPYLTLPRISSQSMLDAVCPVKKLCVVLFSEDSPEHDASRHTLRRFAQESRFVHNN  402 (554)
Q Consensus       325 --~~~~~i~~~~~~~~~l~~fi~~~~~~~v~~lt~~~~~~~~c~~~~lcvvl~~~~~~~~~~~~~~l~~~a~~~~~~~~~  402 (554)
                        .....++.+.++...|..|+.. ..|.+.++|..++.. .+...++ +|+|.... +.+...+.++++|..  ++++.
T Consensus       309 ~~~~~~~~y~g~~~~~~i~~~i~~-~~p~v~~it~~~f~~-~~~~~~~-lv~F~~~~-~~~~~~~~~~~~A~~--~~~~~  382 (780)
T 3apo_A          309 DREKSSVLFLNSLDAKEIYMEIIH-NLPDFELLSANQLED-RLAHHRW-LVFFHFGK-NENANDPELKKLKTL--LKNEH  382 (780)
T ss_dssp             TTTGGGSEEECCCCHHHHHHHHHH-HSCCCCEECHHHHHH-HHTTSEE-EEEEECC------CCGGGGGHHHH--HGGGT
T ss_pred             CCcccceeccccccHHHHHHHHHH-hCCCcccCCHHHHHH-HhccCCe-EEEEecCC-ccccchHHHHHHHHh--hccCc
Confidence              1123567889999999999995 889999998665543 3323344 44454332 223345688888888  77667


Q ss_pred             eEEEEEecccchHHHHhhCCCCCCccccceEEEEEEecCCC-eeEEEecCCCCCcccccchhhHHHHHHHHhhhcCCC
Q psy16770        403 IAFMYVFIEKQPEFVNALTSPEDSSEISLHIAAMWRMDYKK-IKYGWLLGDAVDDWKDYNTTKDRLDAGLRSLVNDPY  479 (554)
Q Consensus       403 v~F~~vd~~~q~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~-~ky~~~~~~~~~~~~~~~~t~e~l~~fl~~~~~g~~  479 (554)
                      +.|+|+|+..++.++..+    +..  .|.+ ++.  +... ..+..++|         +.+.+.|.+|+..-..+..
T Consensus       383 i~f~~~D~~~~~~~~~~~----~~~--~p~i-~l~--~~~~~e~~~~~~g---------~~~~~~i~~f~~~~~~~~v  442 (780)
T 3apo_A          383 IQVVRFDCSSAPGICSDL----YVF--QPSL-AVF--KGQGTKEYEIHHG---------KKILYDILAFAKESVNSHV  442 (780)
T ss_dssp             EEEEEEEGGGCHHHHHHT----TCC--SCEE-EEE--ESSTTSSEEECCS---------CCCHHHHHHHHHHHHTSCE
T ss_pred             eeEEEEeCCCchhhHhhc----ccc--CChh-hhc--cCCCcceeeeccc---------HhhHHHHHHHhhhccCCCC
Confidence            999999999889999887    111  1222 223  2223 33555565         3688999999988665544



>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 554
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 4e-20
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-18
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 4e-17
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 1e-15
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 7e-15
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-15
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 1e-13
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 1e-11
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 8e-05
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 4e-04
d1wjka_100 c.47.1.1 (A:) Thioredoxin-like structure containin 0.004
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: HSP40
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 82.5 bits (203), Expect = 4e-20
 Identities = 33/72 (45%), Positives = 52/72 (72%), Gaps = 1/72 (1%)

Query: 20 DPYETLGVPRTASLQEIRKNYKRLVVEWHPDKNNDPTAQEKFLQLTEAYNILSDAERRKQ 79
          D Y+TLG+ R AS +EI++ Y+R  + +HPDKN +P A+EKF ++ EAY++LSD  +R+ 
Sbjct: 4  DYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREI 63

Query: 80 YDLFGTTDGFSG 91
          +D +G  +G  G
Sbjct: 64 FDRYG-EEGLKG 74


>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query554
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.86
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.85
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.85
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.84
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.84
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.84
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.84
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.83
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.82
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.77
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.76
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.75
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.75
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.74
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.74
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.73
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.72
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.72
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.72
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.72
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.72
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.72
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.71
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.71
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.7
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.68
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.68
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.67
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.66
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.66
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.61
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.59
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.57
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.57
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.53
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.51
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.5
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.37
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.21
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.13
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 99.05
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.01
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.99
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.9
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.9
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.88
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.87
d1wjka_100 Thioredoxin-like structure containing protein C330 98.82
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 98.81
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 98.8
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.77
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.74
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.74
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.6
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.59
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.48
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.38
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 98.3
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.25
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.09
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.07
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.04
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.02
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.0
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.95
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.89
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.88
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.85
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.81
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 97.75
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 97.73
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 97.67
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.6
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.54
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.54
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.54
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.49
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 97.45
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.43
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.36
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 97.34
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.31
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.29
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.28
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.22
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 97.18
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.16
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 97.14
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 97.11
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 97.11
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 97.05
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 97.04
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 97.02
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.01
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 97.0
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.99
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 96.9
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 96.89
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 96.8
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.74
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 96.72
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 96.72
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 96.71
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 96.7
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 96.61
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 96.6
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 96.47
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.41
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 96.37
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 96.36
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 96.32
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 96.2
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.11
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.02
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 95.98
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 95.94
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 95.84
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 95.72
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 95.68
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.64
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 95.63
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 95.49
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 95.26
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 95.07
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 94.93
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 94.67
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 94.63
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 93.48
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 92.96
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 92.71
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 92.68
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 92.58
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 92.57
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 92.43
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 88.2
d1wjka_100 Thioredoxin-like structure containing protein C330 85.5
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 85.23
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 83.55
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 80.52
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: Thioltransferase
domain: Thioredoxin
species: Anabaena sp., pcc 7120 [TaxId: 1167]
Probab=99.86  E-value=5e-22  Score=167.17  Aligned_cols=105  Identities=18%  Similarity=0.389  Sum_probs=96.1

Q ss_pred             cccccccccccccccCCCCCCcEEEEEEcccccccccchHHHHHHHHHhCCCCEEEEEEEecCcHHHHHHhCCcCCCCcc
Q psy16770        128 HKLSTTHWNFEKNYIPKSYTTPHLILFYSDWCFACLQVEPIFKKLMDELSPLGVGFFTVHVHNEQGLARRLGVGSQLPQI  207 (554)
Q Consensus       128 ~~~~Lt~~~F~~~v~~~~~~~~~lV~Fya~wC~~C~~l~p~~~~~a~~l~~~~v~~~~Vd~~~~~~l~~~~~v~~~~Pti  207 (554)
                      .+++||++||+..|.  +++++++|.|||+||++|+++.|.|++++.++.+ .+.+++|||++++.+|++|+|++ +||+
T Consensus         3 ~V~~lt~~~f~~~v~--~~~~~vlv~f~a~wC~~C~~~~~~~~~~~~~~~~-~~~~~~vd~d~~~~l~~~~~I~~-~Pt~   78 (108)
T d1thxa_           3 GVITITDAEFESEVL--KAEQPVLVYFWASWCGPCQLMSPLINLAANTYSD-RLKVVKLEIDPNPTTVKKYKVEG-VPAL   78 (108)
T ss_dssp             SEEECCGGGHHHHTT--TCSSCEEEEEECTTCTTHHHHHHHHHHHHHHTTT-TCEEEEEESTTCHHHHHHTTCCS-SSEE
T ss_pred             CceECCHHHHHHHHH--hCCCcEEEEEECCCCCCccccchHHHHHHHhcCC-cceeceecccccHHHHHHhcccC-CCEE
Confidence            588999999998876  4578999999999999999999999999999987 49999999999999999999997 9999


Q ss_pred             eeccCCeEEEEeCCcccHHHHHHHHHHhC
Q psy16770        208 ALLTDGRTSFFKEPSFSVQKMVEFFRLKL  236 (554)
Q Consensus       208 ~~~~~g~~~~y~~g~~~~~~i~~fl~~~~  236 (554)
                      ++|++|+.+.++.|.++.+.|.+|+.+.+
T Consensus        79 ~~~~~g~~v~~~~G~~~~~~l~~~i~~~L  107 (108)
T d1thxa_          79 RLVKGEQILDSTEGVISKDKLLSFLDTHL  107 (108)
T ss_dssp             EEEETTEEEEEEESCCCHHHHHHHHHHHH
T ss_pred             EEEECCEEEEEEeCCCCHHHHHHHHHHhc
Confidence            99999998877667779999999998864



>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure