Psyllid ID: psy16800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-
MDEKEERQRRGSRSRKDDENKGGVGGEVGKVGEEMKEKEEERLPGEGREGEERDFSARDVKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGILIGVGEGSLMGAQGSSPNGGLYR
ccHHHHHHHHccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccEEHHHHcccHHHHHHHHHcccccccccccccccccccccccccc
cccHHHHHHccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcHHHccccccccccccccccccccccccc
mdekeerqrrgsrsrkddenkggvggevgkvgeemkekeeerlpgegregeerdfsardvKTIGIFFCVFSlsslrdlfpvkgeigvtkvqipselsplgvhphptspstdyttpltalkypppaalsqhqsllnnsgrtnftnkQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEgiligvgegslmgaqgsspngglyr
mdekeerqrrgsrsrkddenkggvggevgkvgeemkekeeerlpgegregeerdfsardvKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQIpselsplgvhphptsPSTDYTTPLTALKYPPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIAsvlqlnetqvkiwfqnrrmkqkkrIKEGiligvgegslmgaqgsspngglyr
MDEKEERQRRGSRSRKDDenkggvggevgkvgeemkekeeerlpgegregeerDFSARDVKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGILIGVGEGSLMGAQGSSPNGGLYR
**********************************************************DVKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQI*****************************************************QLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGILIGVG******************
**********************************************************************************************************************************************TNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRR**********************************
**********************GVGGEVGKVGE********************DFSARDVKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGILIGVGEGSLMGAQ**********
*********************************************************************************************************************ALK****************SGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRI***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDEKEERQRRGSRSRKDDENKGGVGGEVGKVGEEMKEKEEERLPGEGREGEERDFSARDVKTIGIFFCVFSLSSLRDLFPVKGEIGVTKVQIPSELSPLGVHPHPTSPSTDYTTPLTALKYPPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGILIGVGEGSLMGAQGSSPNGGLYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query221 2.2.26 [Sep-21-2011]
P10105635 Homeotic protein labial O yes N/A 0.276 0.096 0.901 1e-28
Q08821240 Homeobox protein Hox-A1 ( N/A N/A 0.289 0.266 0.875 8e-28
Q1KL10325 Homeobox protein Hox-A1a N/A N/A 0.289 0.196 0.875 2e-27
P49639335 Homeobox protein Hox-A1 O yes N/A 0.289 0.191 0.875 4e-27
P09022331 Homeobox protein Hox-A1 O yes N/A 0.289 0.193 0.875 5e-27
Q08820300 Homeobox protein Hox-D1 O N/A N/A 0.452 0.333 0.603 6e-27
Q01822327 Homeobox protein Hox-D1 O no N/A 0.524 0.354 0.515 6e-27
Q9IA19326 Homeobox protein Hox-A1 O N/A N/A 0.285 0.193 0.873 1e-26
Q28IU6301 Homeobox protein Hox-D1 O no N/A 0.452 0.332 0.603 2e-26
Q98SI1329 Homeobox protein Hox-A1a yes N/A 0.289 0.194 0.859 2e-26
>sp|P10105|LAB_DROME Homeotic protein labial OS=Drosophila melanogaster GN=lab PE=1 SV=2 Back     alignment and function desciption
 Score =  126 bits (316), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 60/61 (98%)

Query: 139 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGI 198
           RTNFTNKQLTELEKEFHFN+YLTRARRIEIA+ LQLNETQVKIWFQNRRMKQKKR+KEG+
Sbjct: 511 RTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRVKEGL 570

Query: 199 L 199
           +
Sbjct: 571 I 571




Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Required for proper head development.
Drosophila melanogaster (taxid: 7227)
>sp|Q08821|HXA1_XENLA Homeobox protein Hox-A1 (Fragment) OS=Xenopus laevis GN=hoxa1 PE=2 SV=1 Back     alignment and function description
>sp|Q1KL10|HXA1A_TAKRU Homeobox protein Hox-A1a OS=Takifugu rubripes GN=hoxa1a PE=3 SV=1 Back     alignment and function description
>sp|P49639|HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens GN=HOXA1 PE=1 SV=2 Back     alignment and function description
>sp|P09022|HXA1_MOUSE Homeobox protein Hox-A1 OS=Mus musculus GN=Hoxa1 PE=1 SV=2 Back     alignment and function description
>sp|Q08820|HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis GN=hoxd1 PE=2 SV=3 Back     alignment and function description
>sp|Q01822|HXD1_MOUSE Homeobox protein Hox-D1 OS=Mus musculus GN=Hoxd1 PE=2 SV=1 Back     alignment and function description
>sp|Q9IA19|HXA1_HETFR Homeobox protein Hox-A1 OS=Heterodontus francisci GN=HOXA1 PE=3 SV=1 Back     alignment and function description
>sp|Q28IU6|HXD1_XENTR Homeobox protein Hox-D1 OS=Xenopus tropicalis GN=hoxd1 PE=2 SV=1 Back     alignment and function description
>sp|Q98SI1|HXA1A_DANRE Homeobox protein Hox-A1a OS=Danio rerio GN=hoxa1a PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
347972359 548 AGAP004649-PA [Anopheles gambiae str. PE 0.343 0.138 0.8 1e-29
195107210 651 GI23760 [Drosophila mojavensis] gi|19391 0.307 0.104 0.882 2e-29
195389737 643 lab [Drosophila virilis] gi|194151617|gb 0.307 0.105 0.882 2e-29
37693039 655 homeodomain transcription factor labial 0.307 0.103 0.882 2e-29
59939347 659 Dbuz\lab-PA [Drosophila buzzatii] 0.307 0.103 0.882 2e-29
350418159 474 PREDICTED: hypothetical protein LOC10074 0.298 0.139 0.909 3e-29
340727752 477 PREDICTED: hypothetical protein LOC10064 0.298 0.138 0.909 3e-29
383849613 468 PREDICTED: uncharacterized protein LOC10 0.298 0.141 0.909 3e-29
195498962 631 GE25839 [Drosophila yakuba] gi|194182848 0.294 0.103 0.907 3e-29
380028371 501 PREDICTED: uncharacterized protein LOC10 0.298 0.131 0.909 3e-29
>gi|347972359|ref|XP_001688960.2| AGAP004649-PA [Anopheles gambiae str. PEST] gi|333469402|gb|EDO63634.2| AGAP004649-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 4/80 (5%)

Query: 124 PAALSQHQS--LLNN--SGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQV 179
           P+A+S HQS  ++NN  +GRTNFTNKQLTELEKEFHFNKYLTRARRIEIA+ L LNETQV
Sbjct: 409 PSAVSPHQSSFMINNNSTGRTNFTNKQLTELEKEFHFNKYLTRARRIEIANALHLNETQV 468

Query: 180 KIWFQNRRMKQKKRIKEGIL 199
           KIWFQNRRMKQKKR+KEG++
Sbjct: 469 KIWFQNRRMKQKKRVKEGLI 488




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195107210|ref|XP_001998208.1| GI23760 [Drosophila mojavensis] gi|193914802|gb|EDW13669.1| GI23760 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195389737|ref|XP_002053531.1| lab [Drosophila virilis] gi|194151617|gb|EDW67051.1| lab [Drosophila virilis] Back     alignment and taxonomy information
>gi|37693039|gb|AAQ98855.1| homeodomain transcription factor labial [Drosophila buzzatii] Back     alignment and taxonomy information
>gi|59939347|gb|AAX12439.1| Dbuz\lab-PA [Drosophila buzzatii] Back     alignment and taxonomy information
>gi|350418159|ref|XP_003491764.1| PREDICTED: hypothetical protein LOC100744978 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727752|ref|XP_003402200.1| PREDICTED: hypothetical protein LOC100643550 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383849613|ref|XP_003700439.1| PREDICTED: uncharacterized protein LOC100877608 [Megachile rotundata] Back     alignment and taxonomy information
>gi|195498962|ref|XP_002096747.1| GE25839 [Drosophila yakuba] gi|194182848|gb|EDW96459.1| GE25839 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|380028371|ref|XP_003697877.1| PREDICTED: uncharacterized protein LOC100865518 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query221
FB|FBgn0002522635 lab "labial" [Drosophila melan 0.294 0.102 0.907 2.8e-29
UNIPROTKB|Q08820300 hoxd1 "Homeobox protein Hox-D1 0.461 0.34 0.605 3.5e-27
UNIPROTKB|F1RZF8327 HOXD1 "Uncharacterized protein 0.597 0.403 0.479 3.2e-26
UNIPROTKB|P49639335 HOXA1 "Homeobox protein Hox-A1 0.479 0.316 0.577 5.2e-26
UNIPROTKB|F1NH11307 HOXB1 "Homeobox protein Hox-B1 0.348 0.250 0.746 8.4e-26
UNIPROTKB|P31259309 HOXB1 "Homeobox protein Hox-B1 0.348 0.249 0.746 8.4e-26
UNIPROTKB|E1B918333 HOXA1 "Uncharacterized protein 0.479 0.318 0.568 1.1e-25
UNIPROTKB|E2R5Z1333 HOXA1 "Uncharacterized protein 0.479 0.318 0.568 1.1e-25
UNIPROTKB|F1SHS9336 HOXA1 "Uncharacterized protein 0.479 0.315 0.568 1.1e-25
MGI|MGI:96170331 Hoxa1 "homeobox A1" [Mus muscu 0.479 0.320 0.568 1.1e-25
FB|FBgn0002522 lab "labial" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 317 (116.6 bits), Expect = 2.8e-29, Sum P(2) = 2.8e-29
 Identities = 59/65 (90%), Positives = 64/65 (98%)

Query:   135 NNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRI 194
             NNSGRTNFTNKQLTELEKEFHFN+YLTRARRIEIA+ LQLNETQVKIWFQNRRMKQKKR+
Sbjct:   507 NNSGRTNFTNKQLTELEKEFHFNRYLTRARRIEIANTLQLNETQVKIWFQNRRMKQKKRV 566

Query:   195 KEGIL 199
             KEG++
Sbjct:   567 KEGLI 571


GO:0005634 "nucleus" evidence=ISS;NAS;IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IPI
GO:0007420 "brain development" evidence=IGI;IMP
GO:0009790 "embryo development" evidence=IMP
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS;TAS
GO:0007494 "midgut development" evidence=TAS
GO:0030154 "cell differentiation" evidence=TAS
GO:0001709 "cell fate determination" evidence=TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0035284 "brain segmentation" evidence=IGI
UNIPROTKB|Q08820 hoxd1 "Homeobox protein Hox-D1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZF8 HOXD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P49639 HOXA1 "Homeobox protein Hox-A1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH11 HOXB1 "Homeobox protein Hox-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P31259 HOXB1 "Homeobox protein Hox-B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B918 HOXA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5Z1 HOXA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHS9 HOXA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:96170 Hoxa1 "homeobox A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-25
smart0038957 smart00389, HOX, Homeodomain 5e-23
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-22
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-06
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 94.5 bits (236), Expect = 1e-25
 Identities = 31/54 (57%), Positives = 37/54 (68%)

Query: 139 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKK 192
           RT FT +QL ELEKEF  N+Y +   R E+A  L L E QVK+WFQNRR K K+
Sbjct: 4   RTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 221
KOG0484|consensus125 99.77
KOG0489|consensus261 99.76
KOG0488|consensus309 99.75
KOG0850|consensus245 99.73
KOG0487|consensus308 99.72
KOG0842|consensus307 99.7
KOG0492|consensus246 99.7
KOG2251|consensus 228 99.69
KOG0843|consensus197 99.68
KOG0494|consensus 332 99.66
KOG0485|consensus268 99.65
KOG0848|consensus317 99.64
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.63
KOG0493|consensus342 99.57
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.57
KOG0486|consensus 351 99.54
KOG0844|consensus 408 99.5
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.48
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.46
KOG0491|consensus194 99.46
KOG3802|consensus398 99.45
COG5576156 Homeodomain-containing transcription factor [Trans 99.43
KOG0483|consensus198 99.43
KOG4577|consensus 383 99.41
KOG0847|consensus288 99.37
KOG0490|consensus235 99.28
KOG1168|consensus385 99.05
KOG0849|consensus354 99.04
KOG0775|consensus304 98.69
KOG0774|consensus334 98.44
KOG2252|consensus558 98.24
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.2
KOG0490|consensus235 98.1
KOG1146|consensus 1406 98.06
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.23
KOG0773|consensus342 96.07
KOG3623|consensus 1007 94.66
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 91.16
>KOG0484|consensus Back     alignment and domain information
Probab=99.77  E-value=1e-19  Score=138.93  Aligned_cols=68  Identities=40%  Similarity=0.557  Sum_probs=63.3

Q ss_pred             ccCCCCCCCcccCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCCCCceeeccccchhHHHHHhhhcc
Q psy16800        131 QSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEGI  198 (221)
Q Consensus       131 ~~~~~rr~Rt~ft~~Ql~~Le~~F~~~~yps~~~r~~LA~~L~Lt~~qVqvWFQNRRaK~Kr~~k~g~  198 (221)
                      ..++++|.||.||..||..||+.|...+||++..|++||..++|++.+|||||||||+|.+|+.+...
T Consensus        13 ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~a~   80 (125)
T KOG0484|consen   13 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERAAI   80 (125)
T ss_pred             HHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHHHH
Confidence            34567889999999999999999999999999999999999999999999999999999999988643



>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 7e-26
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 1e-16
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 2e-16
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-16
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 2e-16
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 1e-15
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 2e-15
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 3e-15
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 1e-14
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 7e-14
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 3e-13
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 3e-13
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 8e-11
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-10
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-10
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-10
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-10
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 4e-10
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 5e-10
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 6e-10
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 7e-10
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 9e-10
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 1e-09
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 2e-09
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-09
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 4e-09
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 6e-09
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 6e-09
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 8e-09
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 2e-08
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 4e-08
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 4e-08
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 9e-08
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 1e-07
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 1e-07
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-07
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 3e-07
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 4e-07
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 4e-07
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 1e-06
2vi6_A62 Crystal Structure Of The Nanog Homeodomain Length = 1e-06
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 5e-06
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 8e-06
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-05
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 2e-05
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 2e-05
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 4e-05
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 5e-05
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 5e-05
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 1e-04
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure

Iteration: 1

Score = 113 bits (283), Expect = 7e-26, Method: Compositional matrix adjust. Identities = 58/95 (61%), Positives = 69/95 (72%), Gaps = 1/95 (1%) Query: 104 HPTSPSTDYTTPLTALKYPPPAALSQHQSLLNNSG-RTNFTNKQLTELEKEFHFNKYLTR 162 P +P+ + + PP A L + SG RTNFT +QLTELEKEFHFNKYL+R Sbjct: 2 EPNTPTARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSR 61 Query: 163 ARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKEG 197 ARR+EIA+ L+LNETQVKIWFQNRRMKQKKR +EG Sbjct: 62 ARRVEIAATLELNETQVKIWFQNRRMKQKKREREG 96
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|2VI6|A Chain A, Crystal Structure Of The Nanog Homeodomain Length = 62 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query221
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-37
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-33
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 6e-33
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-32
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 4e-32
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-32
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 9e-31
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 1e-30
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-30
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 5e-30
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-30
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-29
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 7e-29
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-29
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-28
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 6e-28
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 9e-28
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 3e-27
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-27
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 6e-27
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-26
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 1e-26
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 2e-26
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-24
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-20
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-17
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-17
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-16
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-16
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-16
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-15
3a02_A60 Homeobox protein aristaless; homeodomain, developm 4e-15
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-15
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 9e-15
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-14
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-14
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-14
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-14
3d1n_I151 POU domain, class 6, transcription factor 1; prote 4e-14
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-14
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-13
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-13
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-13
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-13
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 5e-13
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 6e-12
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 7e-12
1uhs_A72 HOP, homeodomain only protein; structural genomics 9e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-10
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 8e-10
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-09
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 4e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 4e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 5e-06
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 9e-06
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 5e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 6e-05
2e19_A64 Transcription factor 8; homeobox domain, structura 2e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 7e-04
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
 Score =  124 bits (312), Expect = 5e-37
 Identities = 53/76 (69%), Positives = 62/76 (81%)

Query: 122 PPPAALSQHQSLLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKI 181
           P  A +S+      +  RTNFT +QLTELEKEFHFNKYL+RARR+EIA+ L+LNETQVKI
Sbjct: 21  PKTAKVSEPGLGSPSGLRTNFTTRQLTELEKEFHFNKYLSRARRVEIAATLELNETQVKI 80

Query: 182 WFQNRRMKQKKRIKEG 197
           WFQNRRMKQKKR +EG
Sbjct: 81  WFQNRRMKQKKREREG 96


>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.79
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.78
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.78
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.78
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.77
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.77
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.77
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.77
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.77
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.77
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.77
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.77
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.77
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.77
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.76
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.76
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.76
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.75
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.75
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.75
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.75
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.75
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.75
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.75
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.75
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.75
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.75
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.74
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.74
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.74
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.74
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.74
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.74
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.73
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.73
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.73
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.73
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.73
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.73
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.72
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.72
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.71
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.71
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.7
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.7
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.69
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.68
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.68
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.67
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.67
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.66
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.66
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.65
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.65
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.65
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.63
2e19_A64 Transcription factor 8; homeobox domain, structura 99.63
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.61
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.61
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.58
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.53
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.44
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.41
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.36
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.34
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.25
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.69
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 94.49
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.79  E-value=4.2e-20  Score=135.17  Aligned_cols=64  Identities=39%  Similarity=0.614  Sum_probs=60.2

Q ss_pred             CCCCCCCcccCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCCCCceeeccccchhHHHHHhhh
Q psy16800        133 LLNNSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKKRIKE  196 (221)
Q Consensus       133 ~~~rr~Rt~ft~~Ql~~Le~~F~~~~yps~~~r~~LA~~L~Lt~~qVqvWFQNRRaK~Kr~~k~  196 (221)
                      ...+|.||.|+..|+.+||.+|..++||+..++..||..|+|++.+|+|||||||+|+|+..+.
T Consensus        20 ~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~vWFqNRR~k~kk~~k~   83 (84)
T 2kt0_A           20 VKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKN   83 (84)
T ss_dssp             SCSCCCSSCCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHTTTSCCCC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHhhc
Confidence            3468889999999999999999999999999999999999999999999999999999987764



>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 221
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-24
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-23
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 1e-23
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-22
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-21
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 8e-21
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-20
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-20
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-20
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 7e-20
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 8e-20
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 1e-19
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-19
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-19
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-19
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-19
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 4e-19
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-19
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-18
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-17
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-17
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-17
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-17
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 6e-17
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-17
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 8e-16
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 1e-15
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-14
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-14
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 6e-14
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 7e-11
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-10
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
 Score = 89.1 bits (221), Expect = 3e-24
 Identities = 38/54 (70%), Positives = 41/54 (75%)

Query: 139 RTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKK 192
           R  +T  Q  ELEKEFHFN+YLTR RRIEIA  L L E Q+KIWFQNRRMK KK
Sbjct: 1   RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 54


>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query221
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.82
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.81
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.81
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.81
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.81
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.81
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.8
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.79
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.79
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.79
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.79
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.79
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.78
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.77
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.75
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.74
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.74
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.74
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.73
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.71
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.71
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.69
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.69
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.67
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.65
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.62
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.59
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.55
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.53
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.51
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=7.5e-22  Score=134.39  Aligned_cols=57  Identities=44%  Similarity=0.785  Sum_probs=55.2

Q ss_pred             CCCCcccCHHHHHHHHHHhhhCCCCCHHHHHHHHHHhCCCCCceeeccccchhHHHH
Q psy16800        136 NSGRTNFTNKQLTELEKEFHFNKYLTRARRIEIASVLQLNETQVKIWFQNRRMKQKK  192 (221)
Q Consensus       136 rr~Rt~ft~~Ql~~Le~~F~~~~yps~~~r~~LA~~L~Lt~~qVqvWFQNRRaK~Kr  192 (221)
                      +|.||.||..|+.+||.+|..++||+..++++||..|||++.+|+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            678999999999999999999999999999999999999999999999999999875



>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure